sperm-associated antigen 8

Overview
Namesperm-associated antigen 8
Smed IDSMED30026127
Length (bp)851
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of sperm-associated antigen 8 (SMED30026127) t-SNE clustered cells

Violin plots show distribution of expression levels for sperm-associated antigen 8 (SMED30026127) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of sperm-associated antigen 8 (SMED30026127) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for sperm-associated antigen 8 (SMED30026127) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026127

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026127SMESG000072188.1 SmedASXL_007150SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026127SMESG000072188.1 dd_Smed_v4_6123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026127SMESG000072188.1 dd_Smed_v4_6123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026127SMESG000072188.1 dd_Smed_v4_6123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026127SMESG000072188.1 dd_Smed_v4_6123_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026127SMESG000072188.1 dd_Smed_v6_6123_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30026127SMESG000072188.1 Contig35535newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026127SMESG000072188.1 Contig35535uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30026127SMESG000072188.1 dd_Smed_v4_6123_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026127SMESG000072188.1 dd_Smed_v4_6123_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of sperm-associated antigen 8 vs. Ensembl Human
Match: SPAG8 (sperm associated antigen 8 [Source:HGNC Symbol;Acc:HGNC:14105])

HSP 1 Score: 75.485 bits (184), Expect = 7.927e-15
Identity = 47/151 (31.13%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYL-GQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            F+  H+G+L++  +     S    D    P      L G+++  LE  L  +I K++++E EP     +  SVT  D+             +P +  +EQP ++W +   ++ G+S ++  DTPFRKN SFSTP+     + LPY+ ENYP
Sbjct:  309 FRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYP 459          
BLAST of sperm-associated antigen 8 vs. Ensembl Human
Match: SPAG8 (sperm associated antigen 8 [Source:HGNC Symbol;Acc:HGNC:14105])

HSP 1 Score: 75.485 bits (184), Expect = 8.202e-15
Identity = 47/151 (31.13%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYL-GQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            F+  H+G+L++  +     S    D    P      L G+++  LE  L  +I K++++E EP     +  SVT  D+             +P +  +EQP ++W +   ++ G+S ++  DTPFRKN SFSTP+     + LPY+ ENYP
Sbjct:  307 FRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYP 457          
BLAST of sperm-associated antigen 8 vs. Ensembl Human
Match: SPAG8 (sperm associated antigen 8 [Source:HGNC Symbol;Acc:HGNC:14105])

HSP 1 Score: 72.0182 bits (175), Expect = 1.500e-13
Identity = 47/151 (31.13%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYL-GQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            F+  H+G+L++  +     S    D    P      L G+++  LE  L  +I K++++E EP     +  SVT  D+      + +     P    +EQP ++W +   ++ G+S ++  DTPFRKN SFSTP+     + LPY+ ENYP
Sbjct:  307 FRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRME---LAQAGTPAP---TKEQPETFWIQRAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYP 451          
BLAST of sperm-associated antigen 8 vs. Ensembl Zebrafish
Match: spag8 (sperm associated antigen 8 [Source:ZFIN;Acc:ZDB-GENE-170411-2])

HSP 1 Score: 65.855 bits (159), Expect = 1.810e-12
Identity = 37/110 (33.64%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  415 GQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPC-------NMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQ 723
            G++   LE  L ++IR KI ++        +  SVTK D+      V     +R C           EQ +++W++   +I G++ V  KD+PF++NA+FSTPIGE  DQ
Sbjct:   79 GRRTELLENDLIKRIRDKINADLSADPPITELSSVTKADY-----KVEGFKSVRACPNSTMGHEYTTEQAITFWSDNYQKIQGMTAVTRKDSPFKRNATFSTPIGEQLDQ 183          
BLAST of sperm-associated antigen 8 vs. Ensembl Mouse
Match: Spag8 (sperm associated antigen 8 [Source:MGI Symbol;Acc:MGI:3056295])

HSP 1 Score: 84.3445 bits (207), Expect = 5.507e-18
Identity = 52/155 (33.55%), Postives = 80/155 (51.61%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEPTTFESVMHHDYKGLPLE-EQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVT----KVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            F+  H+G+L+   +     S    D   LP    Q   G+++  LE  L  +I K++++E EP     +  SVT    +V+     PP   KP     +  +EQP ++W +   R+ G+S ++  DTPFRKN SFSTP+     Q LPY+LE+ P
Sbjct:  294 FRHGHQGLLTTQPQSPMSSSTTQRDSYQLPRHICQPLRGKREAMLEMLLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTKPH----DYRQEQPETFWIQRAARLPGVSDIRTLDTPFRKNCSFSTPVPLSLGQPLPYELESGP 444          
BLAST of sperm-associated antigen 8 vs. Ensembl Mouse
Match: Spag8 (sperm associated antigen 8 [Source:MGI Symbol;Acc:MGI:3056295])

HSP 1 Score: 71.2478 bits (173), Expect = 4.832e-15
Identity = 41/111 (36.94%), Postives = 59/111 (53.15%), Query Frame = 1
Query:  433 LERSLYEKIRKKIESEAEPMDVSVDYRSVT----KVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            LE  L  +I K++++E EP     +  SVT    +V+     PP   K          EQP ++W +   R+ G+S ++  DTPFRKN SFSTP+     Q LPY+LE+ P
Sbjct:    6 LEMLLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTK----------EQPETFWIQRAARLPGVSDIRTLDTPFRKNCSFSTPVPLSLGQPLPYELESGP 106          
BLAST of sperm-associated antigen 8 vs. UniProt/SwissProt
Match: sp|Q3V0Q6|SPAG8_MOUSE (Sperm-associated antigen 8 OS=Mus musculus OX=10090 GN=Spag8 PE=1 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 3.852e-17
Identity = 52/155 (33.55%), Postives = 80/155 (51.61%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEPTTFESVMHHDYKGLPLE-EQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVT----KVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            F+  H+G+L+   +     S    D   LP    Q   G+++  LE  L  +I K++++E EP     +  SVT    +V+     PP   KP     +  +EQP ++W +   R+ G+S ++  DTPFRKN SFSTP+     Q LPY+LE+ P
Sbjct:  294 FRHGHQGLLTTQPQSPMSSSTTQRDSYQLPRHICQPLRGKREAMLEMLLRHQICKEVQAEQEPARKLFETESVTHHDYRVELVRAAPPASTKPH----DYRQEQPETFWIQRAARLPGVSDIRTLDTPFRKNCSFSTPVPLSLGQPLPYELESGP 444          
BLAST of sperm-associated antigen 8 vs. UniProt/SwissProt
Match: sp|Q99932|SPAG8_HUMAN (Sperm-associated antigen 8 OS=Homo sapiens OX=9606 GN=SPAG8 PE=1 SV=3)

HSP 1 Score: 75.485 bits (184), Expect = 3.807e-14
Identity = 47/151 (31.13%), Postives = 77/151 (50.99%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYL-GQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            F+  H+G+L++  +     S    D    P      L G+++  LE  L  +I K++++E EP     +  SVT  D+             +P +  +EQP ++W +   ++ G+S ++  DTPFRKN SFSTP+     + LPY+ ENYP
Sbjct:  309 FRHGHRGLLTMQLKSPMPSSTTQKDSYQPPGNVYWPLRGKREAMLEMLLQHQICKEVQAEQEPTRKLFEVESVTHHDYRMELAQAGTPAPTKPHDYRQEQPETFWIQRAPQLPGVSNIRTLDTPFRKNCSFSTPVPLSLGKLLPYEPENYP 459          
BLAST of sperm-associated antigen 8 vs. TrEMBL
Match: V4A557 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_234660 PE=4 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 5.808e-29
Identity = 67/157 (42.68%), Postives = 93/157 (59.24%), Query Frame = 1
Query:  304 FKAAHKGILSVTDEP-----TTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 759
            F+  H G+L+ T +      TTF       YK     +   +G K+  +E+ LYE+I K++  E  P   + D+RSVTKVD+  +  P          N   EQPV++WTE++DR+ G+SQVK KD+ FRKN +FS PI EYWD+  PY+LENYPKM
Sbjct:   48 FRVGHPGLLTTTSDAKAENLTTFRV----SYKKPESPDVRQIGAKKQLMEQMLYEQISKEVNEEFNPPPPATDFRSVTKVDYTKDFTPEEVVVDTSKHNYKTEQPVTFWTEHRDRVTGVSQVKTKDSGFRKNDAFSKPIDEYWDEPQPYELENYPKM 200          
BLAST of sperm-associated antigen 8 vs. TrEMBL
Match: A0A1S3K1N9 (sperm-associated antigen 8 OS=Lingula unguis OX=7574 GN=LOC106178072 PE=4 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 1.618e-28
Identity = 64/153 (41.83%), Postives = 91/153 (59.48%), Query Frame = 1
Query:  304 FKAAHKGILSVT-DEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 759
            FK  H G+LS   D      + +   Y+         +G+K   LE+  +E++ K++  +  P     DY SVT  DF      ++  P  +P ++ REQPV++WTE+ D++HG+SQ+K KDTPFRKNA+FS PI EY DQ  PY+LENYPKM
Sbjct:   50 FKHGHNGVLSTEFDAKAENLTTVRESYRPPTKPGVRQVGKKHELLEQMFFEQVSKEVHEDFNPPPPQPDYLSVTTKDFSKEFESIKPAP-TQPHDLTREQPVTFWTEHVDKLHGVSQIKTKDTPFRKNAAFSKPIDEYMDQPQPYELENYPKM 201          
BLAST of sperm-associated antigen 8 vs. TrEMBL
Match: C3ZA11 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_264461 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 7.324e-25
Identity = 66/158 (41.77%), Postives = 98/158 (62.03%), Query Frame = 1
Query:  307 KAAHKGILSVTDEP-----TTF-ESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPK-IRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 759
            +  HKG+L+   E      TTF  S    D  G+       +G+++  L ++LY+K+ + +  E  P    V+Y+SVT  DF ++D  V   P+ I+  ++ REQP+++W+++KD+IHG+SQVK  DTPFRKNA+FSTPI EY DQ  PY+ E YP M
Sbjct:   55 RHGHKGLLTTNLEAHPENVTTFRNSYTAPDKSGV-----RTVGKREQLLTQALYQKVSEDVHQEFNPPPPPVEYKSVTAKDF-WDDNFVPSMPEPIKDHSVEREQPMTFWSQHKDKIHGVSQVKTMDTPFRKNAAFSTPIEEYKDQPKPYEQEQYPDM 206          
BLAST of sperm-associated antigen 8 vs. TrEMBL
Match: A0A267EP14 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005129g1 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 9.195e-25
Identity = 60/153 (39.22%), Postives = 89/153 (58.17%), Query Frame = 1
Query:  295 RKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            R   K  +KGILS+ D     ++V H DYK   ++ Q   G +    E+ L ++  ++ E E     V     SVTK DFF  +   +     R  N   +QP+++WTE++DR  GL+QVKA+DTPFR+N +FS PIGEYW++  P++L+ YP
Sbjct:   38 RDILKHGNKGILSL-DRFQESDTVTHTDYKRHEVKSQCTQGARSRLQEQELLKQFEREAEEEFSGEAVEPVTASVTKTDFFSREFVSKPPAPTRNHNYEIDQPITFWTEHRDRATGLTQVKARDTPFRRNDAFSQPIGEYWNEPKPHELDKYP 189          
BLAST of sperm-associated antigen 8 vs. TrEMBL
Match: A0A267FQG4 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005129g2 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.116e-24
Identity = 59/153 (38.56%), Postives = 89/153 (58.17%), Query Frame = 1
Query:  295 RKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYP 753
            R   K  +KGIL++ D     ++V H DYK   ++ Q   G +    E+ L ++  ++ E E     V     SVTK DFF  +   +     R  N   +QP+++WTE++DR  GL+QVKA+DTPFR+N +FS PIGEYW++  P++L+ YP
Sbjct:   38 RDILKHGNKGILAL-DRFQESDTVTHTDYKRHEVKSQCTQGARSRLQEQELLKQFEREAEEEFSGEAVEPVTASVTKTDFFSREFVSKPPAPTRNHNYEIDQPITFWTEHRDRATGLTQVKARDTPFRRNDAFSQPIGEYWNEPKPHELDKYP 189          
BLAST of sperm-associated antigen 8 vs. Ensembl Cavefish
Match: spag8 (sperm associated antigen 8 [Source:NCBI gene;Acc:103045297])

HSP 1 Score: 69.707 bits (169), Expect = 3.957e-14
Identity = 53/167 (31.74%), Postives = 87/167 (52.10%), Query Frame = 1
Query:  268 RETKYLDK-DRKGF--KAAHKGILSV-----TDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYND-PPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDL 741
            R T+ LD  D +    +  H+GIL++     T + TT ++      KG  + ++   G +   LE+SL + I ++I +E  P   + +  SVT+ DF      PVR  P  +  +   +Q ++YW+E   +I G++ V    +PF+KNASFSTPI E  D  + + L
Sbjct:   25 RATELLDSSDSRSHINRHGHRGILTLDMTSKTQDETTVKATFTAP-KGPGIRQK---GLRAELLEKSLIKMISEQIHAELNPEPPAPELNSVTRADFTAGGFKPVRPAPS-KERDYRSDQAITYWSENHQKIQGVTAVGTTQSPFKKNASFSTPISERLDDPMDFTL 186          
BLAST of sperm-associated antigen 8 vs. Ensembl Cavefish
Match: spag8 (sperm associated antigen 8 [Source:NCBI gene;Acc:103045297])

HSP 1 Score: 69.707 bits (169), Expect = 3.957e-14
Identity = 53/167 (31.74%), Postives = 87/167 (52.10%), Query Frame = 1
Query:  268 RETKYLDK-DRKGF--KAAHKGILSV-----TDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYND-PPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDL 741
            R T+ LD  D +    +  H+GIL++     T + TT ++      KG  + ++   G +   LE+SL + I ++I +E  P   + +  SVT+ DF      PVR  P  +  +   +Q ++YW+E   +I G++ V    +PF+KNASFSTPI E  D  + + L
Sbjct:   25 RATELLDSSDSRSHINRHGHRGILTLDMTSKTQDETTVKATFTAP-KGPGIRQK---GLRAELLEKSLIKMISEQIHAELNPEPPAPELNSVTRADFTAGGFKPVRPAPS-KERDYRSDQAITYWSENHQKIQGVTAVGTTQSPFKKNASFSTPISERLDDPMDFTL 186          
BLAST of sperm-associated antigen 8 vs. Ensembl Nematostella
Match: EDO37651 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF62])

HSP 1 Score: 93.9745 bits (232), Expect = 2.011e-23
Identity = 55/145 (37.93%), Postives = 86/145 (59.31%), Query Frame = 1
Query:  307 KAAHKGILSVTD---EPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLP 732
            K  H+G+L+ TD   EP    +V H      PL  +  +G ++  +   L +++ ++++ E  P    V+Y+SVT  DF     P+ ++P + P ++ +EQP ++W+E    +HG+SQVK KDTPFRKNA+FSTPI EY D   P
Sbjct:   43 KFGHRGVLT-TDFEAEPEKLTTVRHSYRSPEPLGIRT-IGVREQMMREELMKQVSEEVQQEFNPPPPEVEYKSVTHKDFNKEFTPIVKEPTM-PHDLCKEQPATFWSERSTEVHGISQVKTKDTPFRKNAAFSTPIDEYRDAPKP 184          
BLAST of sperm-associated antigen 8 vs. Ensembl Medaka
Match: spag8 (sperm associated antigen 8 [Source:NCBI gene;Acc:101162226])

HSP 1 Score: 50.8322 bits (120), Expect = 1.951e-7
Identity = 43/161 (26.71%), Postives = 79/161 (49.07%), Query Frame = 1
Query:  268 RETKYLDKDRKGFKAAHKGILSVTDEP---TTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNM---VREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLP 732
            R TK  D  ++  K +HKG+ +V  E    TT  S  ++     P       G ++  LE+ + + IR+++++E        ++ S T  DF     P  E  + +   +     EQ +++W+E   ++ G++ V+ +  PFR++A FSTP+ E  D+  P
Sbjct:   28 RSTK--DSRQRTEKDSHKGVFAVDPEAKMETTTTSKANYVAPEGPGGR--LRGTRRELLEKQIVQMIREEMQAEMNTPTPETEFCSTTHRDFCI---PGYEPSRPKAAQIHDYKTEQAITFWSENYQQVQGVTPVQNQKAPFRRSALFSTPLSERLDEIEP 181          
BLAST of sperm-associated antigen 8 vs. Planmine SMEST
Match: SMESG000072188.1 (SMESG000072188.1)

HSP 1 Score: 340.887 bits (873), Expect = 1.162e-119
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 1
Query:  268 RETKYLDKDRKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 759
            RETKYLDKDRKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM
Sbjct:   26 RETKYLDKDRKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 189          

HSP 2 Score: 55.0694 bits (131), Expect = 5.532e-9
Identity = 24/25 (96.00%), Postives = 24/25 (96.00%), Query Frame = 3
Query:  111 MCDIKTETPKLNSDSKCLIDNWFEE 185
            MCDIKTE PKLNSDSKCLIDNWFEE
Sbjct:    1 MCDIKTERPKLNSDSKCLIDNWFEE 25          
BLAST of sperm-associated antigen 8 vs. Planmine SMEST
Match: SMESG000072188.1 (SMESG000072188.1)

HSP 1 Score: 340.887 bits (873), Expect = 1.352e-119
Identity = 164/164 (100.00%), Postives = 164/164 (100.00%), Query Frame = 1
Query:  268 RETKYLDKDRKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 759
            RETKYLDKDRKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM
Sbjct:   30 RETKYLDKDRKGFKAAHKGILSVTDEPTTFESVMHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRSVTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKDTPFRKNASFSTPIGEYWDQTLPYDLENYPKM 193          

HSP 2 Score: 63.929 bits (154), Expect = 4.095e-12
Identity = 28/29 (96.55%), Postives = 28/29 (96.55%), Query Frame = 3
Query:   99 MINPMCDIKTETPKLNSDSKCLIDNWFEE 185
            MINPMCDIKTE PKLNSDSKCLIDNWFEE
Sbjct:    1 MINPMCDIKTERPKLNSDSKCLIDNWFEE 29          
The following BLAST results are available for this feature:
BLAST of sperm-associated antigen 8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SPAG87.927e-1531.13sperm associated antigen 8 [Source:HGNC Symbol;Acc... [more]
SPAG88.202e-1531.13sperm associated antigen 8 [Source:HGNC Symbol;Acc... [more]
SPAG81.500e-1331.13sperm associated antigen 8 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spag81.810e-1233.64sperm associated antigen 8 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Spag85.507e-1833.55sperm associated antigen 8 [Source:MGI Symbol;Acc:... [more]
Spag84.832e-1536.94sperm associated antigen 8 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of sperm-associated antigen 8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q3V0Q6|SPAG8_MOUSE3.852e-1733.55Sperm-associated antigen 8 OS=Mus musculus OX=1009... [more]
sp|Q99932|SPAG8_HUMAN3.807e-1431.13Sperm-associated antigen 8 OS=Homo sapiens OX=9606... [more]
back to top
BLAST of sperm-associated antigen 8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4A5575.808e-2942.68Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A1S3K1N91.618e-2841.83sperm-associated antigen 8 OS=Lingula unguis OX=75... [more]
C3ZA117.324e-2541.77Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A267EP149.195e-2539.22Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FQG42.116e-2438.56Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
spag83.957e-1431.74sperm associated antigen 8 [Source:NCBI gene;Acc:1... [more]
spag83.957e-1431.74sperm associated antigen 8 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO376512.011e-2337.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of sperm-associated antigen 8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spag81.951e-726.71sperm associated antigen 8 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of sperm-associated antigen 8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000072188.11.162e-119100.00SMESG000072188.1[more]
SMESG000072188.11.352e-119100.00SMESG000072188.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026127 ID=SMED30026127|Name=sperm-associated antigen 8|organism=Schmidtea mediterranea sexual|type=transcript|length=851bp
ATTTTGGACAAGATAGTGAAATATTAATAATTTTTAAAATCACTTTTAGA
ATTATTTCAAAGTTATTATTTGATATTAGTAAATCTTTTTTTGAAAGAAT
GATTAACCCTATGTGTGATATAAAAACTGAAACACCGAAACTGAATTCAG
ATTCAAAATGTTTAATAGATAATTGGTTTGAGGAGGTTTATTGTTTTGTA
CATAGATAAAATTTACAATTTTTTGGATGTTATTCATGTTGAAATAATTT
ATTTACTTGTATTTTAGCGAGAAACAAAATATTTAGATAAAGATAGAAAA
GGTTTCAAAGCTGCCCACAAGGGAATTTTGTCTGTTACTGATGAACCAAC
AACATTCGAATCAGTAATGCATCACGATTACAAGGGCTTACCACTGGAGG
AACAGTTGTATTTAGGTCAAAAACAATTTGAATTAGAGCGTTCATTGTAT
GAAAAAATTAGAAAGAAAATAGAATCGGAGGCAGAACCAATGGATGTTTC
TGTTGACTATAGATCTGTCACAAAAGTTGATTTCTTTTACAATGATCCGC
CGGTCAGAGAGAAACCTAAAATCCGACCTTGCAATATGGTCCGTGAGCAG
CCAGTCTCATATTGGACAGAGTACAAAGATAGGATTCATGGTTTAAGTCA
AGTAAAAGCGAAAGATACACCTTTTAGAAAAAATGCTTCCTTTTCCACTC
CCATTGGTGAATATTGGGATCAGACATTACCCTATGACTTGGAGAATTAT
CCCAAAATGTGATTGAACTGTTTGAAAACAAACGCTTGATTACAGTGAAT
ATTTTCAATCCACCTGTTTTATCTTAAGGCTAAATTAAGAATCGGAATCG
G
back to top

protein sequence of SMED30026127-orf-1

>SMED30026127-orf-1 ID=SMED30026127-orf-1|Name=SMED30026127-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=132bp
MHHDYKGLPLEEQLYLGQKQFELERSLYEKIRKKIESEAEPMDVSVDYRS
VTKVDFFYNDPPVREKPKIRPCNMVREQPVSYWTEYKDRIHGLSQVKAKD
TPFRKNASFSTPIGEYWDQTLPYDLENYPKM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR026124Sperm-assoc_Ag8
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR026124Sperm-associated antigen 8PANTHERPTHR15510FAMILY NOT NAMEDcoord: 15..130