Dynein heavy chain, axonemal

Overview
NameDynein heavy chain, axonemal
Smed IDSMED30026124
Length (bp)11416
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dynein heavy chain, axonemal (SMED30026124) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain, axonemal (SMED30026124) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain, axonemal (SMED30026124) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain, axonemal (SMED30026124) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026124

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 23

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026124SMESG000040510.1 SMESG000040507.1 SmedASXL_018112SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026124SMESG000040511.1 dd_Smed_v6_6557_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026124SMESG000040510.1 Contig16071uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026124SMESG000040510.1 Contig16071uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026124SMESG000040510.1 Contig16071newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026124SMESG000040510.1 Contig16071newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30026124SMESG000040511.1 Contig45841newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026124SMESG000040511.1 Contig45841uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026124SMESG000040511.1 SMED_23190_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 3760.3 bits (9750), Expect = 0.000e+0
Identity = 1870/3122 (59.90%), Postives = 2406/3122 (77.07%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVE-------------------------------VNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F + RF+   E+++  LP+QP +F +VI++ C E H  L   W+P CA+LF  ++  W H  PK +  +S  ++ +FA++AS MS QLR +V  SL D      IHK+GN+F   + E++F    L++++L+V+EP I++ PSF    +L+   +  I+++S  IP+++                                    E++G  L L TV   EKLV+ +L +T + F+ N VGP  YLNVYKKY +LL+N AE  + AFLKE H +     KI+A +  ++E++ + ++VPL++F LD   LN D+ +R   L++ L+ F+V+ NR+ N SIC +Y  I +KVSE+P +T+ LV++ EFL+++S   VF+L+ +  +A ERL FL+DYA +PY+              I ++FD + N + ++R+Q E DL  R  +FE RLE   + +E F+K+EVMT EEM+ NV+ L+EL   ++    + E +NKEE +L  E+S +P+L  M+KN  PY +LW TA +F IK++ W+ GP   LNA  I  +I  M +  +KLIK  +D P  +++A  VK KIDKFK ++P+L + CNPG+++RHW Q+S+I+G++IKPTE + L + L +G  K +EKLE IGAAA+KE+ LEK L +MK DW  + F   +YRD+  +IL A+DDIQMLLDDH+IK+QTM GSPFIKP E E + WE+KL+ + D +D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M+++VK+   LVA  Q  M ++L ++N LLE+IQKGLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFT+ LEI+GMIS+E ET+  + KIYPA AKGMVEKWL QVE +M+ S+++VI   IE+YV   R  WVL WPGQ+VICVS I+WT+EV++A+   N L D+L K N QI  IV+LVRG L+SG R+TLGALTVIDVHARDVV  +++ +VS +N F+W+SQLRYY    +V V  I+TE  YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE+EVLSVVAQQI SIQ AI + LK F+FEGTELSLNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+++F   + DN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ LAAAL D+ A   M+E+ V+Y IINPKAITMGQLYG FD VSHEW DGVLA  FRE A +  D RKW++FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM++KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S+++  LP  L ++H +L+ D+F WL+ PCL+F R +CK +++TS IH    + +L+ SLLDEIR        E +E    + +S+Q I+LWLQGLFLFS VW++  ++    R KFDVFFR L  G++  +P+PKS+KLTK+N FPER +IYDF F K++ G+W+ W   I +E   +   AK++E+IIPT ETARQ++FL  +L HE P++ VGPTGTGKS + NN+L+ LPK+ YL N INFSARTSANQTQDIIM+KLDRRRKG++GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHG+WFDKKDT++L ++D LL++AMGPPGGGRND++ R  RH N++ +N F D+ + +IF++IVDWHF  GFD +F R GK+LV +T  +Y+ A+ +FLPTP+KSHYVFNLRDFSRVI+GVLL PHT+L + EK +RLW+HEVYRVFYDRL  +EDR  FF++VK TT++CFK  IEK+L HLS +GK+VD+++R L FGDY    +D KIYDEIT LK L   ME +L+++N+ISKAPMSLVMF+FA+EHISR+CRVLKQD GH LLVGIGGSGRQSA +++ FM  +E++ IEIT+NY  N+WR+DLK+++++ G   K  VFLF+DNQIK ESF+EDI+MLLNTGDVPN++P+DEKA+I+EKMQ AAR +    G K++ TP++MYN+FIERV   +   LAMSPIGDAFRNRLRMFPSLINCCTIDWFQ+WP DALE+VANKFLED+E+D+N R  +V MCK++ ESV++LS ++ N LRR+NYVTPTSYLELI TFK LLN KR E+  ++NRYLTGL+KL+FA+ +V  MQ EL ALQP+LI+TS +T K++ K+E +T E + K+ ++ A++++ANV AA +Q IK++CE DLAEAMP L  A+A+LDTL   DI+LV+SM+NPP  +KLVME++CIM G KPERKPD S +GKMIEDYW  S K+LGD KFL+ LK +  D++ P  +K++RE++I  P+F P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L   +++L +K+A+L  V  +LQ L D  +E   +KK+LE+NIE+C++KL RAE+LI GLGGEK RWTEAA+ L  RY N+TGDVL+S+  VAYLG FTV +R      W  +C +  IP    F +   LG+P+KIRAW IAGLPVDSFSIDNGIIV+NS RW L IDP GQANKWIKNMEK+N+L++IK +D+N++R LEN++Q GTPVL+EN+GEEL+  +EPIL K  F+QQGV+Y+RLG+N+IEY++DFK YITTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK+ LKE+ED+ILEVLS S+GNILE+ETAI VLSSSK+LS+EISEKQ +A +T+ +ID+TR GYKPVAVH + +FFCISD+ANI+PMYQYSL WFINL++ S+ +S KSE+L  RI+Y+ DHFTLS+Y N+CRSLFE  KLLFSL + I ++K K ++ +E+W FLLTGG+ALDNPYPNPAP W+S+K W+E+VRAS LP + GL EH + N  +WK +YDS  P 
Sbjct:  362 FRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFFIPQLIMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQ--------------IEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALA-ENTLLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMD-TLPSSLTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIR------AVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDNHPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLHLPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHFGKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLSPTGKIVDDNIRSLFFGDYFKPESDQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQ----GEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPH 3456          

HSP 2 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 460/660 (69.70%), Postives = 546/660 (82.73%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LP  ++  QGL+K+++LRC+RPDK+VPAV+ FI +++G+ +I+ P FDL  S+NDS+CC+PLIFVLSP ADPM  LLKF +D G   ++  +ISLGQGQGPIAAKMI+ AI+DGTWVVLQNCHLA SWM +LEKICEE+I+PE+T+  FRLWLTSYPSE FPVSILQNG+KMTNEPPKGLRANLLRSYLNDPISD  FF  C     W  MLFGLCFFHA+VQERR FGPLGWNIPYEFNESDLRIS+ Q+QMFLNDY E+P +ALTYLTGECNYGGRVTDDKDRRLL+SLL +FY  +I E++ Y  +P   YY PP G+ Q YI+Y+R+LPI  +PEV+GLHENADITKDNQETNQLF G+LLTLPRQ+ G GKSP++ ++ELA DIL KLP +FDLE +MK YPV+Y ESMNTVLRQELIRFN+L  VVR +LINL +AIKG V+M++ELEEVFNSML+GKVP  WAAKSYPSLKPLG YV DL+ RL FF +WI+   P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GFEFE+T     T ++  PEDGA + GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +         Y+CPVYKTSARRGTLSTTGHSTN+VL+I+LP ++ Q HWINRGVASLCQLD+
Sbjct: 3460 LPGSWKFSQGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI-EEDYYSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTP--QETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 3101.23 bits (8039), Expect = 0.000e+0
Identity = 1618/3113 (51.98%), Postives = 2153/3113 (69.16%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEP-VKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFP--EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLK---DYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNS-----------FPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE--HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPD-TSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   R ++I E  +    ++   F+N+I R        L   W P    ++          LP   TG+S   +++FF   A+LM+ QL+++   S+ DFT+ I             D ++  + P  I+ L +    I ++P   +  D+ +  Y  ++++   +PRVE  L+   E + +   L+ +I NE +V ++ ++  +     +V P  +L +Y KY  L+  KAE +V  FL E H    +  +I  YQ L +E+    +      +F +    L   + KR D +   L++    +++E+N  +C  ++ I  K    P +T  L+ ++ ++++   T++  L++   ++   L FL++Y      D++LN ++F W   +  +F+     I+ + EQ +E L+LR  +F E LE   K  E+F       +++++R ++    L G++D   D++EQ N EE    W  S +P    +   L+PY RL+ TA++F      W +GP+H++N   +E DI    + ++KL K F+D+P A  +  KV+ K++ FK H+P++QVICNPG++ RHW+ MS I+G+ ++P+++S++  FL   L  ++++ E I  AA+KE+ LEK + KM  +W  ++F +  YR++G  IL+++D+IQMLLDDHIIK+QTM+GSPFIKP+EK+M+ WE KL+ + +I+D WLKVQATWLYLEPIFSS DI++QMPEEGR+F  VD TW+++M   +++   L       ML+RL  SN LLE I KGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI ++EFTE L+I  M S+EGE + ++  I  AKA+G VEKWL+++E VMINS+ KV  D+  +Y   +R  WV DWPGQ V+CVS I+WTKEV  AI  P G+K    YL  CN QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ ++ K  +S  + FEWLSQLRYY +   +    I+  L YG EYLGN+PRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G    +FEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENE ILLL++I DVNLPKFLS D+PLFEGI SDLFPGV LPK D++   +A+KDN     LQ   +F +KILQ+YEM++VRHG MIVGEPFGGKT AY+ LA AL DI   G M+E KV   ++NPK++TMGQLYGQFD VSHEW+DGVLA+ FR FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +MNLIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S++   LP  ++    + I  LF+ ++   ++FIR + K+L  TS+ + V  L  L    +D+  ++  ++E   +E            Y  L+G+FLFS +WS+G+S  +  R KF+   REL    +P+  + ++    +S +           FPE+ TIYD+ F  +  G W+ W+  + +E+  I  D   NEII+PT +T R +  ++L  TH+KP I VGPTGTGKSV I N+L+ +L K+ Y    INFSA+T+A QTQ+I+M+KLD+RRKGV+GPP  KR VVFVDD+NMPA+E YGAQPPIELLRQW+DH +W+D KD S + L+D  ++ AMGPPGGGRN V+ R +RHFN++ +NEF+D +M  IF+ I+ WH E  + F   F  L   +V+ TM +YK+A+ + LPTPAKSHY+FNLRDFSRVI+GV L         E + RLWVHEV RV+YDRL    DR    + ++    +    +  ++   L     G V  +D+R L+F D+     +D  Y EI  + NL   +E  L++YN+ISK PM+LV+F+FA+EHISR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+ +F +EI++ Y   EW +DLK +L K        VFLF+D QIK+ESF+ED+S LLN G++PNL+  DEK EI +KM+   R  +K   ++ D +PIA++N FI+  +  LH+VLAMSPIGDAFRNRLR FP+L+NCCTIDWFQ+WPEDAL+ VA++FLE+IEM E  R+  + MCK +H S   LS+ F   L+RYNYVTPTSYLELI TFK LL  KR+E++ +K RY  GLEKL+ AS +V  MQ+EL+AL P+L V S + D+++  +E+++VEV    +I+ A++  AN +A  S+ IKD+C+ADLA A+PIL  A+A+LDTL   DIT+V+SMK+PP  +KLVMEA+CI+ G K ++ PD T +GK IED+W  + +LLGD +FL  L  +  D++ P  +  +R+ YIP PDF P+ +RNASTA EGLCKW+IA+D YD  AKIVAPKK+KLA AE EL+I +  L +K+A L EV+ KL  L D L+  +Q+K +LE+ ++LC+KKL+RAEQLIGGLGGEK+RW+  A  L + Y N+TGD+L+S+ VVAYLG FT  +R +  + W   C    IPCS+   +M  LGE V IR WNIAGLP DSFSIDNGII+ N+ RWPL IDPQ QANKWIKNMEK+N L +IKL++ ++VRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY  DF+FYITT+LRNPHYLPE S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ A+NKR+LKE+ED+ILEVLSSS+GNILE+ETAI +LSSSK L+ EIS+KQ +AE T+ +ID TR GY+P+A+H SILFF ++D+ANI+PMYQYSL WFINLF++SIENSEKSE L  R++ L DHFT S+Y N+CRSLFE  KLLFS  + I LL  +  +N   WRFLLTGG+ LDNPY N    W+  K W E+ R  +LP+ K +R  F    D WK +YDS  P
Sbjct:  289 FKKLRLVDIKEFHNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNK--KKQLP---TGDSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLI---------AQPPDSVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNE-IVDAHKEKIKEVIMKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYS--FGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAI--PMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPN-ENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNL-LPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRE-----------TYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILRELME--SPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPWIKKL-KEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKT--KQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEP 3363          

HSP 2 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 398/647 (61.51%), Postives = 504/647 (77.90%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            +++++RC+RPDK++P +Q FI + LG+ FI+PPPFDL  +F DSNCC+PLIFVLSPGADPM ALLKF +DQGY  SK++S+SLGQGQGPIA KM+++A+++GTWVVLQNCHLATSWM +LEK+CEE+  PE+TH +FR+WLTSYPS +FPVS+LQNGVKMTNE PKGLRAN++RSYL DPISD +FF  C     +  +L+GLCFFHALVQERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFLN Y ELP EAL Y+TGECNYGGRVTDD DRR L S+L  F+N ++VE   Y F  SGIY+ PP G  + YIEY ++LP+ P PE++G++ NADITKD  ET  LF  ILLT  R A    KS ++ + E+A DIL KLP NFD+E  M+RYP  Y++SMNTVL QE+ RFNKL+  +R + +N+QKAIKGL VM+ +LEEV +S+L  K+P  W  KSYPSLKPLGSYVND + RL F   W E   P  FW+SGF+FTQ+FLTG  QN+ARKYTIPID +GF++E+       + K  PEDG  ++GLFL+GA W+++ K L ES PKIL++++P++WLKP K   I +  +Y+ P+YKTS RRG LSTTGHSTNFV+ + LP++  + HWI RGVA LCQL+
Sbjct: 3381 RMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELS-PESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVM---EDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 2973.73 bits (7708), Expect = 0.000e+0
Identity = 1549/3096 (50.03%), Postives = 2100/3096 (67.83%), Query Frame = 1
Query:  232 SWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVE---------VNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVY-KKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFN---------DNPGAQK-------------------VASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITV-PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFI-EYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLL-DEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE-HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHL-SLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDS-TPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            +W P+   LF  K  L             E + AF++ +++LMS QL++++  ++  F +              FD       P+  +EL   + K+ + P+F++L+D ++   + I ++ +++  +          VNL  E+             E ++   +D        N  G + +   Y +KY  LL+  A   +  F  E H      + I+ +  L  E+ LL   +  ++  LD   L   +  +      +L++    + R+ N  IC  ++ I     ++P  TE ++ +  ++ +A T  +  L    +E+  ++ + LD    P ED+ LN T+  WP  I+ +FD     I+N + + E +L  +  K    +E+ ++ +E+F   E   +E M++ V  + +LQ +I + ++ ++ +NKEE +  WE +++P L  +  N++PY + +   L +      W+ G F +LN  ++E D+ E ++ + K +K F              A+K                   + S V  +I  FK ++P + ++CNPG++ RHW Q+S+I+G+D+ P   ++L   L   L  +LE+ E I A A+KE  LEK +  M   W+++ F ++ YRD+GV ILS++D+IQ +LDD IIK+QTM+GSPFIKPFE E+K WED+L+ + + ID WLKVQA WLYLEPIF SEDI+ QMPEEGR+F  VD  W+++M    K+P  L AT    +L++L + N LLE+I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +LEF   L+I  M S+EGE + ++  I  + A+G VEKWL+QVE++M+ SV  VI  +  +Y  + R  WV +WPGQ+V+C+S ++WT E  E I+    GLK Y  +  +Q+++IV+LVRG L+   R TLGAL  IDVHARDVV +M K+ VS    F WL+QLRYY       V  I+  + Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI Q L  FVFEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++AR L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP+AD+  F     +      LQ  ++F++KI+Q YEM++VRHG M+VGEPF  KT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA+++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS +M+LIFE  DL QASPATVSRCGMIY+EP+QLGW P + S++   + P+C   ++  L+R LF WLI P L+  +  CK+LI TS  + VV L +LF  LL + + N P+                +++I +W+   F+FS +WSIG S    GR  FD F R +  G +   P P S+   +   F E+  +YD+ +E K+ G W  W   I   ++      KI +II+PT +T R T+ +DL +T+ KP++ VGPTGTGKSV + + L+  L KD+Y    IN SARTSANQ Q+IIM +LD+RRKGV+GPP  K+C++F+DD+NMPA EKYGAQPPIELLRQ+ D GHW+D KDTSK+ L+D  L++AMGPPGGGRN V+ R IRHFN+  +N F+D TM+RIF++IV ++   H F   +  +G  +V+ TM +YK+++ + LPTP KSHY FNLRDFSRVI+G LL+    + N   ++RL+VHEV RVFYDRL  ++DR   F + K    D FK +   I  HL   +  V +ED+R L+FGDYM      DD++Y EI ++ + +  ++  LD+YN   K  M+LV+F++ +EH+SR+CRVLKQ  G+ALLVG+GGSGRQS TR+A  MA   IF  EI+++YG NEWR+D+K LL   G   +  VFL +D QIK+E+F+EDI  +LNTG+VPN++ +DEK E++E ++  A     + G K D  +P+A++ +F+ R K NLH+V+A SPIGDAFRNRLR FPSLINCCTIDWFQ+WPEDALE VA KFLE +E+ E  ++ IV +CK +H S+  LSE FL+ L R+NYVT TSYLELI +F++LL  KR  ++  K RY+ GL+KL FA  +VG+MQ+EL  LQP+L     +   ++  +E ++V+VEAKR+ +  ++E A+ KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  DIT+V+SMKNPP  +KLVM AVC+M   KPE+  D S TG  I DYW  S KLLGD  FL  LK +  D++    ++K+R +Y+  P+FDP  V  AS+A EGLCKWI+A++ YD  AK+VAPKK +L+ A+K L  T++ L +K+A+L EVE  L++L     E  + K  LED +ELC KKL+RA QLIGGLGGEKSRW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR +  + W   C +  IPCSE F +   LG+PVKIRAWNIAGLP D+FSIDNG+IVNN  RWPL IDPQGQANKWIKN EK N+LS+IKL+D++++RTLEN IQFGTP+LLENVGEEL+P LEP+L +  F+Q G+D +RLG+ +IEY+ DFKFYITT+LRNPHY+PE++TKV LLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LK++E +ILE LSSS+GNILE+E+AI VL S+K++S EI++KQ IAE T+++I ++R GY+P+A H S+LFF I+D+ANIDPMYQYSL WF+NL++ SI +S KS+ LE R+ YLNDHFT ++Y NICRSLFE  KLLFS  +C  LL  + ++  +   FLLTGGV+L +   NP P W+ DK W E+ RASE P+ +GLR+HF  +  +W+ +YDS+ P
Sbjct:  262 TWYPKVINLFTKKEAL--------EGVKPEKLDAFYSCVSTLMSNQLKDLLRRTVEGFVKL-------------FDPKDQQRLPIFKIELTFDDDKMEFYPTFQDLEDNVLSLVERIAEALQNVQTIPSWLSGTSTPVNLDTEL------------PEHVLHWAVDTLKAAVHRNLEGARKHYETYVEKYNWLLDGTAVENIETFQTEDHTFDEYTEFIEKFLSLASEIMLLPQWIHYTMVRLDCEDLKTGLTNKAKAFANILLNDIASKYRKENECICSEFEAIKEHALKVPETTEEMMDLISYVEKARTVGIEELILRIQESKRQMSYFLDVFLFPQEDLALNATVLMWPRKINPIFDENDELIENAKHKKENELMAKREKLILEIEKESRRMEEFT--EFAELERMQQYVTDVRQLQKRIQESEEAVQFINKEEELFKWELTKYPELDKLKVNIEPYQKFFNFVLKWQRSEKRWMDGGFLDLNGESMEADVEEFSREIFKTLKFFQTKLKKELQEKRKAARKRSLEEEKIEEEPKDNATITMCSTVMEQIKAFKEYIPTVSILCNPGMRARHWKQISEIVGYDLTPDSGTTLRKVLKLNLTPYLEQFEVISAGASKEFSLEKAMNTMIGTWEDIAFHISLYRDTGVCILSSVDEIQAILDDQIIKTQTMRGSPFIKPFEHEIKAWEDRLIRIQETIDEWLKVQAQWLYLEPIFCSEDIMQQMPEEGRQFQTVDRHWRDIMKFCAKDPKVLAATSLTGLLEKLQNCNELLEKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFLPNLDIKAMYSSEGERVELIALISTSAARGAVEKWLIQVEDLMLRSVHDVIAAARLAYPESARRDWVREWPGQVVLCISQMFWTSETQEVISGGTEGLKKYYKELQNQLNEIVELVRGKLSKQTRTTLGALVTIDVHARDVVMDMIKMGVSHDTDFLWLAQLRYYWENENARVRIINCNVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQQKLVVFVFEGTELKLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNARPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKYPN-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGIKLPEADYHEFLECAHEACNVHNLQPVKFFLEKIIQTYEMMIVRHGFMLVGEPFAAKTKVLHVLADTLTLMNEHGYGEEEKVIYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFALSETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSPQMSLIFETMDLSQASPATVSRCGMIYLEPSQLGWEPLVSSWLNSLKGPLC-EPEYQALLRGLFAWLIPPSLNQRKKKCKELIPTSNSNVVVSLTRLFEVLLCNVVENDPT----------------SKHIRVWIMACFIFSLIWSIGGSCDTDGRRVFDTFIRLIILGKDDENPVPDSVGKWEC-PFDEKGLVYDYMYELKNKGRWVHWNELIKNTNLG-DKQIKIQDIIVPTMDTIRYTFLMDLSITYAKPLLFVGPTGTGKSVYVKDKLMNHLEKDQYFPFYINLSARTSANQVQNIIMARLDKRRKGVFGPPMGKKCIIFIDDMNMPALEKYGAQPPIELLRQFFDCGHWYDLKDTSKITLVDIELIAAMGPPGGGRNPVTPRCIRHFNICSINSFSDETMVRIFSSIVAFYLRTHEFPPEYFVIGNQIVNGTMEIYKQSVENLLPTPTKSHYTFNLRDFSRVIRGCLLIERDAVANKHTMIRLFVHEVLRVFYDRLINDDDRRWLFQLTKTVIKDHFKESFHSIFSHLRKQNAPVTEEDLRNLMFGDYMNPDLEGDDRVYIEIPNIHHFSDVVDQCLDEYNQTHKTRMNLVIFRYVLEHLSRICRVLKQSGGNALLVGLGGSGRQSLTRLATSMAKMHIFQPEISKSYGMNEWREDMKGLLRNVGMKGQKTVFLITDTQIKEEAFLEDIDSVLNTGEVPNIFAADEKQEVMEGVRPVA-----QAGNKHDELSPLALFAFFVNRCKDNLHVVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQSWPEDALERVAVKFLETLELTEVEQQEIVPICKHFHTSIMDLSERFLHELGRHNYVTATSYLELIGSFRQLLTQKRQAVMEAKQRYMNGLDKLAFAESQVGEMQMELVELQPKLEEAKIENANMMQVIEIESVQVEAKRQFVKLDEEIASGKAEEAQALKNECESDLAEAIPALEAALSALDTLKPADITIVKSMKNPPSGVKLVMAAVCVMKDIKPEKISDPSGTGGKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVTVMQKIRSEYLMNPEFDPPKVAKASSAAEGLCKWIMAMEVYDRVAKVVAPKKARLSEAQKSLAETMELLNQKRAELAEVEHHLENLQMTFLEKTEEKAALEDQVELCAKKLERASQLIGGLGGEKSRWAQAADDLQITYENLTGDVLVSAGVIAYLGAFTSGFRQTCTKDWSMLCKKKKIPCSEEFLLSKTLGDPVKIRAWNIAGLPTDTFSIDNGVIVNNCRRWPLMIDPQGQANKWIKNSEKENQLSVIKLSDSDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLRQTFKQGGIDCIRLGEVIIEYSFDFKFYITTKLRNPHYMPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKDIEKKILETLSSSEGNILEDESAIKVLDSAKMMSNEITKKQQIAEKTELKIAESREGYRPIAKHSSVLFFSIADLANIDPMYQYSLTWFVNLYINSIHDSNKSKILEKRLRYLNDHFTYNLYCNICRSLFEKDKLLFSFLLCANLLLARKEIEYQELMFLLTGGVSLKSAEKNPDPTWLQDKSWEEICRASEFPAFRGLRQHFCEHIYEWREIYDSKEP 3297          

HSP 2 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 397/655 (60.61%), Postives = 499/655 (76.18%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNS-RWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTL-PRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L  L K+I+LRC+RPDKI PA+ +++TD LG+ F++PPPFDL  S+ DSNC  PLIFVLSPGADPM +LLKF  D+  + +K  +ISLGQGQGPIAAKMI  AI++GTWV LQNCHLA SWM  LEKICE+    E  + +FRLWLTSYPS  FPV+ILQNGVKMTNEPP GLR NLL+SYL DP+SD +FF GC      W  +LFG+CFFHALVQER+KFGPLGWNIPY FNESDLRIS+RQ+Q+F+N+Y  +P EA++YLTGECNYGGRVTDD DRRLL+++L  FYN  IVE   Y FSPSG Y++PP GT + YIE+I+ LP   +PE++GLHEN DI+KD Q+T  LF  +LLT    + +G   S +  + E+  DIL KLP +FD+EM +++YPV Y ESMNTVL QE+ RFN LI  +R+TL +L+KAIKG+VVM++ LE +  S+L+GKVP  WA +SYPSLKPLGSY+ D + RLNF  DW  +  P  FW+SGF+FTQ+FLTG +QN+ARKYT PID +G+EFE+   D S      PEDG  ++GL+L+GARWD+E+ +L E  PK+LF+ +PIIW+KP +   I +S  Y+CP+YKTS R+GTLSTTGHSTNFV+ + L  +    HWI RGVA LCQLDD
Sbjct: 3310 LNELQKIIILRCLRPDKITPAITNYVTDKLGKKFVEPPPFDLTKSYLDSNCTIPLIFVLSPGADPMASLLKFANDKSMSGNKFQAISLGQGQGPIAAKMIKAAIEEGTWVCLQNCHLAVSWMPMLEKICEDFT-SETCNSSFRLWLTSYPSSKFPVTILQNGVKMTNEPPTGLRLNLLQSYLTDPVSDPEFFKGCRGKELAWEKLLFGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFINEYDTIPFEAISYLTGECNYGGRVTDDWDRRLLLTMLADFYNLYIVENPHYKFSPSGNYFAPPKGTYEDYIEFIKKLPFTQHPEIFGLHENVDISKDLQQTKTLFESLLLTQGGSKQTGASGSTDQILLEITKDILNKLPSDFDIEMALRKYPVRYEESMNTVLVQEMERFNNLIITIRNTLRDLEKAIKGVVVMDSALEALSGSLLVGKVPEIWAKRSYPSLKPLGSYITDFLARLNFLQDWYNSGKPCVFWLSGFFFTQAFLTGAMQNYARKYTTPIDLLGYEFEVIPSDTS---DTSPEDGVYIHGLYLDGARWDRESGLLAEQYPKLLFDLMPIIWIKPTQKSRIIKSDAYVCPLYKTSERKGTLSTTGHSTNFVIAMLLKTDQPTRHWIKRGVALLCQLDD 3960          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 2331.21 bits (6040), Expect = 0.000e+0
Identity = 1296/3082 (42.05%), Postives = 1887/3082 (61.23%), Query Frame = 1
Query:  325 VKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHK----NGNNFGVEFDEL-----QFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEM--RGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLK--ERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXX---FMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLM--------FLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFK-KKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXX----XXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLN--EDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKK--SGGNWQE----------WVNTIDRES-MSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKL-HLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIV-DWHFEHGFDGVFN---------------RLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT---DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAI---VIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGD-FKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            ++     +  ++   LR +V  SL  F++FI        N  +  V  D+L     +    PL I++L +    + Y    ++ +  L+  +   + ++  +P++E  +  ++   G  L L +V  +E LV               +  + Y   Y+KY  L NN    ++ +FLK  +  GLLA + +      L+++  L        +   F ++T  +   + K+   L   ++    +   +   SIC  +  I+ K+ E P   E L  ++E+++      V       EE + ++M        FL + ++  + D  + +   +WP  I    ++   +     E+  +   +    F+E+LE +   +  F    E+    E+   V+    ++ Q+ DC+      N  E + +   + +  L+ M+K   PY  LW TA D+   +++W+  P   ++A  +E ++VE  K MHK +KQF D P  Q+VA  ++ +I++FK ++P++Q + NPG++ RHW+ +S+ I  +++P    +    L   L  H+E + ++   A KE+ +E+ L KM+++W  + F +  Y+ +   IL + D+   LLDDHI+ +Q M  SP+ KPFE+ +  WE+KL    ++++ WL  Q +WLYLEPIFSSEDI  Q+P E +++  ++  WK++M  + +N   +       ML  L D N +L+ +QKGL++YLE KR  FPRF+FLS+DELLEILS+TKDP  VQPHL+KCFE I RL F E LEI  M SAEGE + +   IYP+     VE WL +VE  M  SV  +I  +I +Y    R +WVL+WPGQ+ I     YWT EV EA+   N       +   Q+ D+V LVRG L+  +R  L AL VI+VHA+DVV  + +  V SVN F+W+SQLRYY    ++++  ++ E  YG EYLGN+ RLVITPLTDRCY TL  AL L  GGAP GPAGTGKTET KDL KA+A Q VVFNCSD LD+ AMGKFFKGLA AGAWACFDEFNRI++EVLSVVAQQI +IQ A  Q ++RF+FEG E+ L P+C +FITMNPGYAGR ELPDNLK LFR VAMMVPDYA+I EISLYS GF +A  LA KI  T++L SEQLSSQ HYD+GMRAVK+V++AAGNL+++ P + NE ++ L+AI DVN+PKFL +D+ LF GI+SDLFP +     D+ I   A+++      L+  E F+ K +Q+YE  +VRHGLM+VG    GK+         + +     +  G M E  V+Y ++NPK+ITMGQLYG+FD ++HEWTDG+ +   R  A+  D  +KW MFDGPVDA+WIENMNTVLDDNKKLCL SGEII+++  M ++FE  DL  ASPATVSRCGM+Y+EP+ LG  PF+E ++  +LP  L   E+H    + LF   ++  + F+R + K++I ++  +  + L KL          +  +++  +++ S +     + I  W    F+FS +WS+G++   SGR+ F  + R        L  + + + L     FPE   ++D+  E    SG N  E          WV  +D  +  ++ PD     II+PT +T + ++ LD+ LT++KPV+ +GPTGTGK++ I++ L++     Y+++ + FSARTSANQTQD I +KLD+RRKGV+GPP  +  + F+DDLNMPA E YGAQPPIELLRQW+DHG W+D+K      +L+D   + AMGPPGGGRN V+ R++RHFN L   E ++ +  RIF+TI+ +W      DG+                    + LV +T+ VY    +  LPTPAKSHY FNLRD S+V +G+L+     + +  +L+RLW HE  RVF DRL  EEDR  +FD +     + ++    K+               + +++GD+M+   D K Y+ ITS   + + +E +++DYN I+ A + LV+F  AM HI R+ R L+Q  G+ALL+G+GGSGR S TR+A+ MA++E F IE+++NYG +EWRDD+K++L+KAG    P+ FLFSD QIK ESF+EDI+ +LN+GD+PNLY +DE+ +I+  M+    I+E+     +  T   +   +  RV+ N+H+VL MSPIG+ FR RLR FPSL+NCCTIDWF  WP +AL+ VA  FL +I   E+++E I   + +C + H+SV +   E+L  L R+NYVTP SYLEL+  F  L+  K+ EL T KNR  +GL+KL   S++V KMQ +L+++ P L   +  T   + +++ DT   E  R  +  E+  AN KA ++Q I DD + DL EA+P L  A+ASL  L +ND+T VR+M+ PP  +KLV+EAVCIM G KP++ P    G  ++DYW     LL D   FL+ L  F  D++    IK + + YI   +F P  +   S AC  +C+W+ A+ KY + AK V PK+  L  A+ +L +T + L E K +L EVE  +  +  +  E   +K+ELE   E C ++L RA +LI GL  EK RW E  + L     NI+GDVL++A  VAYLG FT  +R  + + W K+     +P +    ++  LG PVKIR+W IAGLP D+ S++NG+I   S RW   IDPQ QANKWIKNMEK N L + KL+D +F+R++EN+I+FG P LLENVGEEL+P LEP+L K  ++QQG   L+LGD VI Y++DF+ YITT+L NPHY PEISTK+ L+NF ++P GLEDQLLG V A+E+P+LEE KN LII +A  +++LK++EDQIL  LSSS+GN +++   I VL +SK+ + EI  K  IAE T+ +ID TR  Y PVA+   ILFFC+SD+AN+DPMYQYSL WF+N+FL  I NSE++++L+ RI  +N + T S+Y N+CRSLFE HKL+F+  +C+ ++  + K+N   WR+LL+GG ++     NPAP+W+SD+ W +++  S LP+       F  +  +++ ++DS  P
Sbjct:  596 LRKLMELVKYMLQDTLRFLVQDSLASFSQFISDTCCSVLNCTDDMVWGDDLINSPYRPRKNPLFIMDLVLDSSGVHYSTPLEQFEASLLNLFDKGILATHAVPQLEKLVMEDIFISGDPL-LESVGLHEPLVEELRATIASAVSKAMIPLQAYAKEYRKYLELNNN----DIASFLKTYQTQGLLAQEVREVVLTHLREKEILDSSLPSSIIIGPFYINTDNVKQSLSKKRKALATSVLDILAKNLHKEVDSICEEFRSISRKIYEKPNSIEELAELREWMKGIPERLV-----GLEERIVKVMDDYQVMDEFLYNLSSDDFNDKWIAS---NWPSKILGQIELVQQQHVEDEEKFRKIQIMDQNNFQEKLEGLQLVVAGFSIHVEISRAHEIANEVR---RVKKQLKDCQQLAMLYNNRERIFSLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVVEAFKTMHKCVKQFKDMPACQEVALDIRARIEEFKPYIPLIQGLRNPGMRIRHWETLSNQININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSTILFNVLPYKATDTYILKSPDEASQLLDDHIVMTQNMSFSPYKKPFEQRINSWENKLKLTQEVLEEWLNCQRSWLYLEPIFSSEDINQQLPVESKRYQTMERIWKKIMKNAYENREVINVCSDLRMLDSLRDCNKILDLVQKGLSEYLETKRSAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVQLCFSIYPSSN---VEDWLREVERSMKASVHDIIEKAIRAYPTMPRTQWVLNWPGQVTIAGCQTYWTMEVAEALEAGNLRSQLFPQLCQQLSDLVALVRGKLSRMQRAVLSALIVIEVHAKDVVSKLIQENVVSVNDFQWISQLRYYWTNNDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMITEISLYSFGFNEASVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENP-SMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEDTDYGILDEAIREACRNSNLKDVEGFLTKCIQLYETTVVRHGLMLVGPTGSGKSTCYRVLAAAMTSLKGQPSISGGMYE-AVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSFIRAGAITSDTNKKWYMFDGPVDAIWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFIECWLR-KLPPLLKPYEEHF---KALFVSFLEESISFVRSSVKEVIASTNCNLTMSLLKLLDCFFKPFLPREGLKKIPSEKLSRI----VELIEPW----FIFSLIWSVGATGDSSGRTSFSHWLR--------LKMENEQLTLL----FPEEGLVFDYRLEDAGISGTNDSEDEEEEYKQVAWVKWMDSSAPFTMVPDTNYCNIIVPTMDTVQMSHLLDMLLTNKKPVLCIGPTGTGKTLTISDKLLKNLALDYISHFLTFSARTSANQTQDFIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKIIGAFKNLVDINFVCAMGPPGGGRNTVTPRLMRHFNYLSFAEMDEVSKKRIFSTILGNW-----LDGLLGEKSYRERVPGAPHIAHFTEPLVEATIMVYATITSQLLPTPAKSHYTFNLRDLSKVFQGMLMADPAKVEDQVQLLRLWYHENCRVFRDRLVNEEDR-SWFDQLLKRCMEQWEVTFNKVC------------PFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYIEDYNQINTAKLKLVLFMDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWRDDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNLYTADEQDQIVSTMR--PYIQEQG----LQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATVFLNEIPELESSQEEIQGLIQVCVYIHQSVSKKCIEYLAELTRHNYVTPKSYLELLHIFSILIGQKKLELKTAKNRMKSGLDKLLRTSEDVAKMQEDLESMHPLLEEAAKDTMLTMEQIKVDTAIAEETRNSVQTEEIKANEKAKKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGTKVDDYWEPGKGLLQDPGHFLESLFKFDKDNIGDVVIKAI-QPYIDNEEFQPATIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALLEAQDDLGVTQRILDEAKQRLREVEDGIATMQAKYRECITKKEELELKCEQCEQRLGRAGKLINGLSDEKVRWQETVENLQYMLNNISGDVLVAAGFVAYLGPFTGQYRTVLYDSWVKQLRSHNVPHTSEPTLIGTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQSQANKWIKNMEKDNGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNTVLKLGDTVIPYHEDFRMYITTKLPNPHYTPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIISNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAIRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRISNINRYLTYSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQSEWRYLLSGG-SISIMTENPAPDWLSDRAWRDILALSNLPTFSSFSSDFVKHLSEFRVIFDSLEP 3606          

HSP 2 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 328/653 (50.23%), Postives = 449/653 (68.76%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYS-PPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            L    KL+VLRC+R DK+  A+Q F+  NL   FI+P   +L   F DSN  +PLIFVLSPG DP   L KF E+  + + K+++ISLGQGQGP A  M+  +I+ G WV  QNCHLA SWM +LE++ E I  P+  H++FRLWLTS PS  FPVSILQNG KMT EPP+G+RANLL+SY +       F + C+    + ++L  LC FH    ERRKFGPLG+NIPYEF + DLRI + Q++MFL++Y ++P + L Y  GE NYGGRVTDD DRR ++++L+ FYN D++  E + +S SGIY+  PP      Y+ YI+SLP+N  PE++GLH+NA+IT    ET  L   I+   P+ +S   +  E+ ++++  +IL K+PE  +L+ +M +YPV+Y ESMNTVL QE+IR+N+L+ V+  TL +L KA+KGLVVM+++LE +  S+    VP  W+AK+YPSLKPL S+V DL+QRL+F   WI++ +P+ FWISGF+F Q+FLTG LQNFARK+ I ID + F+F++  F+  +++  RP+ G  ++GLFLEGARWD E   L ES PK L+  + +IWL P           YLCP+YKT  R GTLSTTGHSTN+V+ +++P +  Q HWI RGVA +C LD
Sbjct: 3619 LDQFQKLLVLRCLRGDKVTNAMQDFVATNLEPRFIEPQTANLSVVFKDSNSTTPLIFVLSPGTDPAADLYKFAEEMKF-SKKLSAISLGQGQGPRAEAMMRSSIERGKWVFFQNCHLAPSWMPALERLIEHIN-PDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVRANLLKSYSS---LGEDFLNSCHKVMEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYDDIPYKVLKYTAGEINYGGRVTDDWDRRCIMNILEDFYNPDVLSPE-HSYSASGIYHQIPPTYDLHGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALLGTIIQLQPKSSSAGSQGREEIVEDVTQNILLKVPEPINLQWVMAKYPVLYEESMNTVLVQEVIRYNRLLQVITQTLQDLLKALKGLVVMSSQLELMAASLYNNTVPELWSAKAYPSLKPLSSWVMDLLQRLDFLQAWIQDGIPAVFWISGFFFPQAFLTGTLQNFARKFVISIDTISFDFKVM-FEAPSELTQRPQVGCYIHGLFLEGARWDPEAFQLAESQPKELYTEMAVIWLLPTPNRKAQDQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPTHQPQRHWIKRGVALICALD 4264          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1978.76 bits (5125), Expect = 0.000e+0
Identity = 1155/3002 (38.47%), Postives = 1742/3002 (58.03%), Query Frame = 1
Query:  481 PLMIVELKVAEPKIIYQPSFKELKDLLI----RCYQFIVQSSEHIPRVEVNLFP----------EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPY--EDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLH--KHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDS-GVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFT----------------EQL---EIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVL-DWPGQIVICVSCIYWTKEVTEAITVPN-----GLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY-DRGGEVWVCQIS-TELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEY--KVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDR-YLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEM-DENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPY-PNPAPNWMSDKLWSEMVRASE-LPSIKGLREH 9315
            P+ + EL +    ++++PS ++  D ++     C   ++     +P    + F           +  G    L  V  ++K   + + +  +T +      + Y   ++K+         L+++A   +   +    ++++ Y     +   LR +  + L ++DTR L   +     +  E+L      ++++   +I     D   K+  +PT T   V    FL E    E     E+    V ++  L++   +P   ED  +  T+      + N  D +    ++  +Q    L   L +    + E+    +D +  ++   ++  R +  L+ LQ  + D + +  Q    +     E S+F  L  +   L     LW +  ++      WLK  F  L+   +   + +  K + +L K    N     V  ++K K++K K  LPV+  + NP ++ RHW  +   +   +   E    ++ L+  LH     +++++I   A+ E  LE  L K+++ WK  +F +  +RDS  V IL   DDIQ+LLDD  I   T+  S ++ P +  +  W+ +L   N  ++ WL  Q  WLYLE IF++ DI  Q+P E + F  VD +WKE+M +  + P+ L A  Q  +L+   ++N+LL++IQK L  YLE KR+ FPRF+FLSNDELLEIL++T++PQ VQPHL+KCF+ I +LEF                 E++   +I+ M+S EGE +S+   +   KA+G VE+WL +VE  M  S++++   +I  Y    R  WV+   P Q+++ VS I W +++TE +   +      LK++      +++ +  +V+G+L    R  L AL  IDVHARD+V  + + +V +V +F+W  QLRYY D   +  V +++ ++  YG EYLG  PRLVITPLTDRCY  LM AL+L+LGGAP GPAGTGKTET KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ +I+ A A  L RF+FEG E+ L  TC  FITMNPGYAGR ELPDNLK LFR  AMMVP+YALI E+ LYS GF  ++ LA K+   Y+LCSEQLS Q HYD+GMRAVKSVL  AG+L+++ PD  NE ++L++A+ D NLPKFL+ D  LF GIISDLFPGV +P+ D+ I  S + D + ++ LQ     + K++Q YE +LVRHG+M+VG   GGKT  Y+ LA  L ++   G    +   V   ++NPK+ITMG+LYG+ + ++ EW DG++A+  R       +  KW++ DGPVDA+WIENMNTVLDDNK LCL + E I+++ +++++FE  DL  ASPATVSRCGM++++P +L W P+++++++  +   L E+  + I +LF+  +D  L FI   C + I   +I  V  L  L  SL   I  +  V  A   E + +  I  Q         F+F ++WS+G +L E+    FD F R      NP    P S  L   +            F+ K    W+  + T        + D    E+++PT +T R  Y ++  L  +  V+  G TG GKSV+    L ++ +   Y+   +NFSA+TS+ +TQ+II +KL+R+RK + G P  KR V+FVDDLNMP  ++YG+QPPIELLRQ+ D G ++D+       + D  ++SA  PPGGGRN V+ R IRHF++L +   +++++ +IF  I++  F   F     +    +V +++ +Y K     LPTPAKSHYVFNLRD S+ ++G+L      +    ++ RL+ HE  RVF+DRL   ED+  +F ++    A+           H  ++  +     + +IFGD++       D+IYD++  ++  A  ++ +LDDYN  +   + LV FQ A+EH+SR+ R+++Q+ G+ALLVG+GG+G+QS TR+AA +  ++   IE++R Y  + + +DL++L   AG + K +VFLF+D QI  E F+EDI+ +LN+G+VPNL+  DE    LE++  A R   K+ G   +     ++ YFI +V+Q LHIVL MSP+G+AFR+R RMFPSL+NCCTIDWF  WP +AL  V+  F   ++  +E  +E + +MC   H SV  ++E + N LRR  Y TPTSYLELI  +  +L+ KR ++I+ ++R   GL KL   +  V KM+++L AL+P L+  S   + L+ K+  D    +  R  +  ++  A VKA E+Q I DD + DL EA+P L  A  +LD+L + DI+ +R    PP L+  VMEA+ I+L  KP+              W S+ +LLGD  FL RL  +  +++ PQ + KL +KYI  PDF P+ V   S AC+ +C W+ A+D Y    K+V PK+ KL  A+ EL+IT+  L EK+A L +VE ++Q L D+ D+    K+ L   + L   +L RA +L   L  E+ RW E+ +   E   NITG+V ++AA VAY G FT  +R S++E W + C  + IP   SF +++ILG+P +IR WN  GLP D  S +NGI+V    RWPL IDPQ QAN+WI+N E  + L IIKLTD+NF+R LENSI+ G PVLLE + E L+P LEPIL K IF   G   +RLGD+ I+Y+K+F+FY+TT++ NPHYLPE+  KV ++NF +T  GLEDQLL  V   EKP LEE++  LI+    +K +LK +E++IL +L +S+GNIL+NE  I+ L  SK+ S  I  +   AE T+  I+  R  Y+PVA  GS+++F I+ ++ IDPMYQYSL +F  LF  +IE S K+E+L+ R++ L +   L+ Y N+ R LFE HKL++S  +C+ +++ +  ++D  W F L G   L+    P P   W+    W       E  P   GL ++
Sbjct:  511 PMFLTELMLTVQSLLFEPSLEDFLDGILGAVNHCQNTVLSVPNLVPDSYFDAFTSPYINNKLEGKTCGTGPSLAAVFEDDKNFHTIISQIKETIQAAFESARIYAATFEKFQIFFKENESLDLQALKLQEPDINFFSEQLEKYHKQHKDAVALRPTRNVGLLLIDTRLLREKLIPSPLRCLEVLNFMLPRQSKKKVDAIIFEAQDAEYKLEFVPTTTTEYVHSLLFLDEIQ--ERIESLEDEGNIVTQMYKLMEQYQVPTPPEDFAVFATMKPSIVAVRNAIDKSVGDRESSIKQFCVHLGSDLEELNNEVNEVKLQAQDPQILDISADQDKIRLI--LNNLQSVLADLQKRAFQYKSYQKNFKVEVSKFEALEEVSAELKLKQLLWDSFSEWDKLQQEWLKSKFDCLDPEVLNGQVSKYAKFVTQLEKGLPPN----SVVPQLKYKVEKMKEKLPVIIDLRNPTLKARHWAAIEQTVDATLVDAEIPLTLERLS-QLHVFDFGQEIQDISGQASGEAALEAILKKVEDSWKTTEFVILPHRDSKDVFILGGTDDIQVLLDDSTINVATLASSRYLGPLKTRVDEWQKQLALFNQTLEEWLTCQRNWLYLESIFNAPDIQRQLPAEAKMFLQVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKRVIFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDSISKLEFALMPPAEGKIPGIDGEPEKVYTNDILAMLSPEGERVSLGKGL---KARGNVEEWLGKVEEAMFTSLRRLCKAAIADYQGKLRTDWVVAGHPSQVILTVSQIMWCRDLTECLETEHSNHIQALKNFEKVNFERLNALAAIVQGSLPKLHRNILTALITIDVHARDIVTELVQSKVETVESFDWQRQLRYYWDIDLDNCVARMALSQYTYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKLSRFMFEGREIKLVMTCAAFITMNPGYAGRTELPDNLKALFRPFAMMVPNYALIAEVILYSEGFESSKILARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPDL-NEDVVLIRALQDSNLPKFLTDDALLFSGIISDLFPGVQIPEHDYGILQSTIVDVMNRQNLQPEMCMVRKVIQFYETMLVRHGVMLVGPTGGGKTTVYRILAETLGNLQKLGIENSFYQAVKTYVLNPKSITMGELYGEVNNLTLEWKDGLMALSVRAAVNDTSEDHKWIISDGPVDALWIENMNTVLDDNKMLCLANSERIKLTPQIHMLFEVQDLRVASPATVSRCGMVFVDPEELKWMPYVKTWMK-GISKKLTEETQEYILNLFQRYVDEGLHFINKKCSQAIPQVDISKVTTLCCLLESL---ILGKDGVNLA--MEQTKLNTILCQT--------FVFCYLWSLGGNLTENYYDSFDTFIRTQFDD-NPDARLPNSGDLWSIH----------MDFDTKRLDPWERIIPT-----FKYNRDVPFFEMLVPTTDTVRYGYLMEKLLAVKHSVLFTGITGVGKSVIAKGLLNKIQESAGYVPVYLNFSAQTSSARTQEIIESKLERKRKNILGAPGNKRIVIFVDDLNMPRLDRYGSQPPIELLRQYQDFGGFYDRNKLFWKEIQDVTIISACAPPGGGRNPVTPRFIRHFSMLCLPMPSEHSLKQIFQAILN-GFLSDFPPAVKQTASSIVEASVEIYNKMSVDLLPTPAKSHYVFNLRDLSKCVQGILQCDPGTIREEIQIFRLFCHECQRVFHDRLINNEDK-HYFHVILTEMAN----------KHFGIAIDLEYFLNKPIIFGDFIKFGADKADRIYDDMPDIEKTANVLQDYLDDYNLTNPKEVKLVFFQDAIEHVSRIARMIRQERGNALLVGVGGTGKQSLTRLAAHICGYKCLQIELSRGYNYDSFHEDLRKLYKMAGVEDKNMVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEKDE----LEQVLAATRPRAKEVGIS-EGNRDEVFQYFISKVRQKLHIVLCMSPVGEAFRSRCRMFPSLVNCCTIDWFVQWPREALLSVSKTFFSQVDAGNEELKEKLPLMCVNVHLSVSSMAERYYNELRRRYYTTPTSYLELINLYLSMLSEKRKQIISARDRVKNGLTKLLETNILVDKMKLDLSALEPVLLAKSEDVEALMEKLAVDQESADQVRNTVQEDEATAKVKAEETQAIADDAQRDLDEALPALDAANKALDSLDKADISEIRVFTKPPDLVMTVMEAISILLNAKPD--------------WPSAKQLLGDSNFLKRLLEYDKENIKPQILAKL-QKYINNPDFVPEKVEKVSKACKSMCMWVRAMDLYSRVVKVVEPKRQKLRAAQAELDITMATLREKQALLRQVEDQIQALQDEYDKGVNEKESLAKTMALTKARLVRAGKLTAALEDEQVRWEESIQKFEEEISNITGNVFIAAACVAYYGAFTAQYRQSLIECWIQDCQSLEIPIDPSFSLINILGDPYEIRQWNTDGLPRDLISTENGILVTQGRRWPLMIDPQDQANRWIRNKESKSGLKIIKLTDSNFLRILENSIRLGLPVLLEELKETLDPALEPILLKQIFISGGRLLIRLGDSDIDYDKNFRFYMTTKMPNPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPRLEEQRIKLIVRINTDKNQLKTIEEKILRMLFTSEGNILDNEELIDTLQDSKITSGAIKTRLEEAESTEQMINVAREKYRPVATQGSVMYFVIASLSEIDPMYQYSLKYFKQLFNTTIETSVKTENLQQRLDVLLEQTLLTAYVNVSRGLFEQHKLIYSFMLCVEMMRQQGTLSDAEWNFFLRGSAGLEKERPPKPEAPWLPTATWFACCDLEESFPVFHGLTQN 3437          

HSP 2 Score: 598.201 bits (1541), Expect = 1.194e-170
Identity = 296/678 (43.66%), Postives = 449/678 (66.22%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKN-FRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASG-EGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSE----SMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEI--TSFDNSTDIKV-----------------RPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L    KLI+++C + +K+V A+  F+ +NLG+ FI+ PP DL + + D +C +PL+F+LS G+DPM A  +F  + GY + ++ SISLGQGQGPIA KM+  A++ G WV LQNCHLA SWM ++E++ +    P++  K+ FRL+L+S PS  FPV++LQN VK+TNEPPKGLRAN+ R++     S   FF+      +W  ++FG+CFFHA++QER+KFGPLGWNI YEFN+SD   ++  ++++  +  ++P +AL Y+TGE  YGGRVTD  D+R L ++L+ F++ + +E E Y +S SGIY++P   + Q + +YI +LP+  +PE++G+HENA++    +ET+ L + IL   PR ++G EGKS ++ +QEL   +  ++PE  ++E   +   V   +    S+ TVL QE+ RFN L+ ++ ++L  L KAI G VVM+ E+E+V+NS L  +VP  W+  +YPSLKPLGS+V DLI R +F   W++   P ++WISGF+F Q FLTG LQN ARKY +PIDE+ F++ +  T  D +  I+                   PEDG  V+G+F++ +RWD +  ++ ++LP  +   +P++  +P +       + Y CP+YKT AR GTLSTTGHSTNFV+ + LP+  S+++WI +G A LCQL +
Sbjct: 3488 LSSFHKLILIKCCKEEKVVFALTDFVIENLGKQFIETPPVDLPTLYQDMSCNTPLVFILSTGSDPMGAFQRFARESGY-SERVQSISLGQGQGPIAEKMVKDAMKSGNWVFLQNCHLAVSWMLAMEELIKTFTDPDSAIKDTFRLFLSSMPSNTFPVTVLQNSVKVTNEPPKGLRANIRRAFTEMTPS---FFEENILGKKWRQIIFGICFFHAIIQERKKFGPLGWNICYEFNDSDRECALLNLKLYCKE-GKIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPETLE-EDYKYSESGIYFAPMADSLQEFKDYIENLPLIDDPEIFGMHENANLVFQYKETSTLINTILEVQPRSSTGGEGKSNDEIVQELVASVQTRVPEKLEMEGASESLFVKDLQGRLNSLTTVLGQEVDRFNNLLKLIHTSLETLNKAIAGFVVMSEEMEKVYNSFLNNQVPALWSNTAYPSLKPLGSWVKDLILRTSFVDLWLKRGQPKSYWISGFFFPQGFLTGTLQNHARKYNLPIDELSFKYSVIPTYRDQAAVIEAAKTVQFGQELPMDMELPSPEDGVLVHGMFMDASRWDDKEMVIEDALPGQMNPVLPVVHFEPQQNYK-PSPTLYHCPLYKTGARAGTLSTTGHSTNFVVTVLLPSKRSKDYWIAKGSALLCQLSE 4158          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 709/2632 (26.94%), Postives = 1264/2632 (48.02%), Query Frame = 1
Query: 1420 EEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNK------IMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPT-EESSLMDFLTYG--LHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSIL----------SALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLE-IIGMISAEGET--LSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDY--LIKCNSQIDDIVKLVRGNLASGERIT---LGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNP---GYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDR-RKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKF--DVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLT-----HEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIM---TKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPG-GGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVK--LTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKR---EIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPD-FDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAP-------KKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWI-KNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALL 9147
            EEM + +QF+ E + Q     D  E++ KE      E  +  ++  + +++  +   W   L + + N+        EL+ ++ E  IV  +K       + K +++         ++ ++   ++ FK     L+      +   HW +M   +G     T E+    D L+    + ++ ++L+++ + A  E  +   + ++     + +F L +Y+ S    L          ++L D Q LL       Q++K SP+   F  +  +WE +L  ++  +    ++Q  W+YLEPIF        +P E  +F  VD  ++ ++ +  K+   +    ++ + K L      L   QK LN +LE+KR  FPRF+F+ +D+LLEIL ++ +PQ +Q H+KK F+GI+R++F+   E II M+S+EGET  LS   +I P      VE WL ++ + M  ++K +   ++     +     +  +P Q V+C++     +EV  + ++ N L     L    SQ+ + +K    N+   ++++   L +L +  +H  DVV+ +   Q  S+N++ W  QLR+Y   G + + Q+S+E  Y  EY GN  +LV TPLTD+CY TL  A+ + LGG P GPAGTGKTE+ K LA  + +Q +VFNC +G+D  +MG+ F G+ + GAW CFDEFNR++  VLS V+ QIQ+IQ AI        F G  + +NP   +F+T+NP   GY GRQ++PDNLK LFR+V M  PD  LI    LYS GFVDA ALA KIV+ ++L  + LS Q HYD+G+RA+K VL   G LR+   + +NE+ L+++A+    L K    D   F  +I D+F  V      F+     +     +  ++  +  ++K+ Q+YE +  R G+++VG    GK+  ++ L  +L       T +  KV     NPKA+   +L G  D  + EW+DG++ +  RE  V +D     W++ DG +D  W+E +N+VLDDN+ L + SGE IQ  + +N +FE   L+ ASPATVSR GMIY+    +  +  + S++     +   ED   L  D+  W+ +    F R  C K + + +I  +     L + L         ++ ++T+          Q + L   G            ++    R +F   V F+ ++       P PK+I                 C++++  G     ++  D  S +++ +    E + P  +TA    + D+  +     + +  ++ G TG GK  L+ +     P+ +  +  +  SA++S++    +I     +       V+ P      ++F+  +N+PA +KYG    + LL+Q + +  +FD  +   + + +   + +M P G G    +S+R+      + +N  + + +  I+ T +    E     V  R  +++ +  +++Y K  ++F PT +   ++F+ RD +  +  V L+ H  L  G KL  +   E  R+F DRL  E D+LKF +I++  +  +   +T I K   +++    V  E   GL        D  ++++     LAK +  F  +  + +    S + F  A      + RVL    GH  L G  G GR+ + R+ A M + ++F   +T N+   ++ ++LK  + +A  + + +V +  D+Q+++  F++ I+ LL +G+VP L+   E   ++  +  AA  +   TG        A+  +   R++  +H+VL +    + F+  +   P+++  C + +   +  ++L  +       I+M+         +   +++ +  L E           + P  Y + ++ F +LL +KR  L     R   G+ KL  A  EV KMQ +       L    A+ D+ L  + +     E ++   E + A  E  NV+  E    K   +  L E  P++ +A  ++ ++K   ++ +RS++ PP  ++ +++AV + +G             +++  W +  K L      D + NF A+ +  +  KK+      + + F+    + AS A   L  W+ A  +Y    + +AP           L  AEK++E   K L      + E++ K + L  +  + +      +D I +       A  L+  L GE  RW    +   E    +    L+++A + YLG  +   R S+++     C    +P   +FK +       +   W   GLP D  S++NG I+  S   PL ID  GQ + ++ K +EKS      K    + +  +E +I+FG  ++++++  E +  L PIL+K +  Q     +  G   I++N DFK Y  TR       P    ++ ++NF  T   L  QLL +    EKPELEE+ + L+ ++   K +L+ LE  +L+ L+SSQGN+LEN   ++ L+ SK  ++ I++    +E    E+   ++ Y P+++  S LFF  S++   +PMY YS+N  ++LF  +I++ E      TR+E L     L+V+ +I R +F   +L+F++    A +
Sbjct: 1035 EEMLKAIQFIKEKRVQWQQLSDGREKIEKECGQFGLEPPKMDIIDEIDEDIKQFEDNW---LIYEMFNN--------ELDTMSQEEWIVFRSKTYLFDEFLQKWMEKLKGTGSQTHMSVRLMKDVEHFKEVSSALKFCRGDVLSADHWHEMFRFLGLPRGTTIEKLKFADLLSVSKNIIENTDQLKQLNSRAQGEVAIRDAIQELTLWAAQTEFTLADYKHSNGQNLKIIKEWKESINSLKDSQALL-------QSLKSSPYYSQFTDKTAVWETRLADLDVFLAQMNEIQRKWIYLEPIFGR----GALPSEASRFSRVDSEYRAILNDVSKDARLVSLCSRQSLKKSLEQIVDQLNRCQKALNQFLEQKRTAFPRFYFIGDDDLLEILGQSTNPQVIQTHMKKLFQGINRVQFSSTGETIISMVSSEGETVPLSKAVRIVP-----QVESWLQELSDEMRRTLKDLTAQAVADAQPS-----LAKYPSQ-VLCLA-----EEVKFSASIENNLNGSSDLNSFKSQLLEKLK-AYTNMKVDDKVSDLKLKSLILDLIHHIDVVDQLLTNQAKSINSWTWQRQLRFYLVNGGIVLRQVSSEFEYTYEYQGNYAKLVHTPLTDKCYLTLTQAMYMGLGGNPYGPAGTGKTESVKALAALMGRQVLVFNCDEGIDVTSMGRIFTGIVECGAWGCFDEFNRLDSTVLSAVSMQIQTIQGAIKSRAGSCTFGGKNVQVNPNSAIFVTLNPAGKGYGGRQKMPDNLKQLFRAVVMGKPDNELISSTILYSEGFVDATALARKIVSVFQLSRQMLSKQQHYDWGLRALKVVLGGCGALRRTQTN-KNETDLVVQALLLNTLSKLTFSDSERFNSLIDDIFSNVTKEMTKFEELVEPLGVAAQEMGIKLGDKQMEKVFQLYEQMRQRIGVVVVGAAGSGKSTIWKILQRSLIL-----TKKPLKVTQ--FNPKAVNRSKLLGNMDMDTREWSDGIITMAARE--VTKDTSVHHWIVCDGDIDPEWVEALNSVLDDNRLLTMPSGERIQFGSNVNFLFETDSLQFASPATVSRMGMIYISEEDVTPKDIVASWL-----VKTTED---LHADMPSWIEE---HFWR--CLKWVRSHKISGITSFAILKNGL-------THLKASKTK---------TQFLVLLFNGFL---------PTVTPENRQEFAKGVVFQGMS------VPDPKNI-----------------CYDERIDG----IMSYTDDVSQNVTKEEVEREDLRPFVQTADTQRYSDIIGSWLQSGNRESFLITGTTGCGKQQLLKHCFQNDPESQLAS--LYCSAQSSSSHLLQLIQQNCVQASNPTGRVWRPKDRPNMILFLKGINLPAPDKYGTNELLALLQQLLTYQGFFD-HNLEWVSIENIQFVGSMNPIGDGAAVSISNRLFSLLRCVSLNTTDSSQLTSIYRTYLTPILEE----VGERNSEIIANRMVDIYNKVQSNFRPTDSVV-FLFSPRDLTNWV--VSLLRH-ELDQG-KLEAVICFEARRIFADRLPTENDKLKFEEILRNVIPISQANETVIFKEKVYVTTGTVVPGESNTGLPLTPINMSD--FNQL-----LAKSINRFAFEIANFNCPLTSQLAFFCAC-----IDRVLTGPGGHLFLPGRPGFGRRDSVRLVAHMHNIQVFSPPVTANFSAKQFDNELKNAITQAVTNNEHVVLILEDHQLRKNIFLQAINSLLASGNVPGLFTQQELDGLVALVSEAAN-QASFTG--------ALQQFLAHRIRSLVHVVLILEVEANDFKINITENPAILKHCNVIFADRFDRNSLVEIPK-----IQMESQGITTTDAILTGFNDVLVNLPEHL--------SIQPIKYRQFVENFFQLLGYKRLTLSVRLERLKGGVSKLNEARDEVAKMQKKAGKKSKLLAEKQAEADEALKAITESMSGAEDQKLSMEQLKAATEKENVRIEEQ---KAKIDEQLKEVQPLIDEARRAVGSIKSESLSEIRSLRAPPEAVRDILQAVLLFMG-------------ILDTSWEAMRKFLSKSGVKDDIMNFDANRITNEIHKKVTALVKQKSNSFEEANAKRASAAAAPLAAWVKANLEYSKILEKIAPLEGEKNKLVKNLKKAEKQMENLSKGLQSVDEVVGELKRKFEVLMKEATQIKVDLDREQDTIRI-------AGTLVESLSGEFERWKIQIETFGEEQSKMELCSLITSAFITYLGGCSEKDRKSLLKSM---CKMFNMP--PTFKPLSFASLETEQLNWKTKGLPADQLSLENGSILFTSCHAPLIIDRSGQVSLFLSKFLEKS---ETFKAAQPDLMTQIELAIRFGKTIIIDDIV-EFDSALIPILRKDLSSQGPRQVISFGGKSIDFNPDFKIYFCTRDEKVDIRPNSYVQLNIVNFTTTISALSAQLLDVAIHLEKPELEERSSSLLRDAELKKLELEGLEQLLLQQLASSQGNLLENTALLDSLNKSKESAEIITKSIVESEQLHKELTTQKDIYVPLSLFTSSLFFSFSNLQFHNPMYNYSVNTIMHLFGKTIKSCEDKSS--TRVETLARQMQLTVFYHISRGIFRQDRLMFAVAFINATM 3472          

HSP 2 Score: 181.03 bits (458), Expect = 1.479e-44
Identity = 165/623 (26.48%), Postives = 281/623 (45.10%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRIS---VRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYI-RSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQR----LNFFH---DWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYL-----CPVYKTSAR 11233
            K++ ++ ++P+++   +  F+   L    I+PP F+L   F +S    P++F+L+ GADP   L +F            SIS+GQGQ   A + I ++   G W+ L N HL    + S+ K    +  P   H+NFRLWLT+     FP  +LQ  +K+T EPP G+R NLLR+Y           D    N      +F L + HAL+QERR F P GW   YEF  SD+R++   V Q+     D+ E     L ++     YGGR+ +D D ++L S L + +  + +          GI         Q YI +I +S+P    P ++GL EN   +    E ++  S I                D I ++   + KKL ++ DL        +  ++ ++ VL  E I    LI  +  ++ ++ K++K   + +  +++   S++  + P+ W +       P   Y+N ++++    L  F         + P  F  S  ++   FL  + Q  +R+  IP+D++            T  ++  +    V GL L+GA +D  + +   ++    ++  PI++L        + SST        PVY +S R
Sbjct: 3559 KVLFIQAVKPERLYNCLMDFVLKTLNIPSINPPAFELKHIFQESESTEPILFILADGADPSQELSEFASSMNV---PYHSISMGQGQEIAAYEAIRESASKGEWLCLNNLHLMLQAVPSIFKHLS-LTTP---HENFRLWLTTEGDARFPSMMLQQSLKITFEPPPGVRNNLLRTYTQ--------IDRSTKNVITCQSIFVLAWLHALLQERRTFIPQGWTKFYEFGASDVRVAKSFVEQLTANKADW-EFVRGILKFVI----YGGRIENDFDFKVLDSYLNVLFCDEKINGRAGSQLVKGIDLLATTN-VQEYIGHISKSVPSVDEPYLFGLPENIKYSWQIVEADRTISSIRTLALGDTKNALSDQSDKISQIV-SLWKKLCQSDDLPKRELPTAIRSADPISEVLCLETINALSLIKQLHRSIGHVAKSMKTPSLASPAVQKTIQSLVFQQTPDEWDSMWAGPSDP-ADYLNVVVKKTRGTLQLFESSKSSSLLSSPIDF--SDLFYPNIFLNALRQTTSRQIKIPLDQLILS------SAWTPSQLPAKQCVQVQGLLLQGATFD--SFLRETTVSSAAYSQAPIVFLAWTS----ESSSTITGEQIQVPVYSSSER 4144          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 546.199 bits (1406), Expect = 3.243e-155
Identity = 340/951 (35.75%), Postives = 525/951 (55.21%), Query Frame = 1
Query: 1825 GIQERHWDQMSDIIGFDIKPTEESSLMDFLTYG------LHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFS-SEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVAT---GQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQ-LEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDS--------IESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY---DRGGEVWVCQI---STELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFV-FEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQ----KMPDTENESI----LLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIF---FSAVKDN----LTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYG---IINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREF---AVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIY 4536
             ++ERHW QM       +K    +  +  LT G      + +H   +++I   A  E  LE+ L +M+E W+  + EL  Y++    ++   DD+   L +H      MK SP+ K FE+  + W++KL  +N + DVW+ VQ  W+YLE +FS S +I   +P E  +F  +      +M +   +P  L      G + +L+RL D   +L +IQK L +YLE++R  FPRF+F+ +++LLEI+  +KD  R+Q HLKK F GI  ++  E+   I    S EGE + +V  +     +  +  WL  +E  M +++ + +  S        I++        W+  +P Q++   + I+W  E+ + +    G ++        ++ +   V        R  + AL    VH RD    +  +++ + N F WL  +R+Y    +   V  C +   +++  YG EYLG   RLV TPLTDRCY T+  AL   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D++AMG+   GL Q GAW CFDEFNR+E  +LS V+QQIQ+IQ A+  G    V   G  L++N    +FITMNPGY+GR  LPDNLK LFRS+AM  PD  LI ++ L+S GF  A  LA+KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+++    KM     E +    +L++++ +  +PK +++DI L   ++SD+FPG+              S V D      +  + +    ++DK+LQ+Y++  + HGLM+VG    GKT A++ L            ++ ++   G   +I+ KA++   LYG  DP + EWTDG+   + R+       + DRR+W++FDG VD  W+EN+N+VLDDNK L L +GE + +   + +IFE ADL+ A+ ATVSRCGM++
Sbjct: 1374 ALKERHWHQM-------MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLK---------ALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 2302          

HSP 2 Score: 531.176 bits (1367), Expect = 1.251e-150
Identity = 360/1413 (25.48%), Postives = 697/1413 (49.33%), Query Frame = 1
Query: 5044 FEKKSGGNWQEW---VNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYL-ANNINFSARTSANQTQDIIMTKLD------RRRKGVYGPPPE--KRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGG-GRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNR-----------LGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGV--LLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDV-RGLIFGDYMTDDKIYDEITSLKN-LAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENT--------------------REAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSE--DLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTM 9132
            +E +  G+WQ W   V T++ ES  ++      ++++PT +T R    L  +L   KP+++ GP G+GK++ +   L  L   + +   N+NFS+ T    T ++++   D      R   GV   P +  +  V+F D++N+PA +KYG Q  I  LRQ ++   ++   D S + L     + A  PP   GR+ ++SR +RH  ++ V+     ++ +I+             G FNR           L   L ++ ++VY  +   F     + HYV++ R+ +R ++G+   + P  +L + E+L+RLW HE  R+F DRL  EE+R ++ D +  TTA+ +  N  ++           DE + R L++  +++ + +      L++ ++ R++ F ++     +  + LV+F   ++H+ R+ R+ +Q  GH LL+G  G+G+ + +R  A++    +F +++   Y   ++ +D++ +L +AGC  + L F+  ++ +    F+E ++ LL  G+VP L+  DE   ++ +++  A    ++ G  +DS    +Y +F ++V +NLH+V  M+P G   R R    P+L N C ++WF  W E+AL  V ++    +++D                       R+A+V      H++V++ +E       R    TP  +L+ IK F  L + KR++L   K     GL K+    ++V ++Q  LK    EL       +  L ++  D  + E +++     Q++   +  +  E K   E DLA+  P + +A  ++  +K++ +  V+SM +PP  +KL +EA+CI+LGE             +   W +  +++    F+ R+  F  + + P+ +K++ EKYI  PD++   V  AS AC  + KW  A   Y      V P + +L   E+E     ++      ++ E+E  +    ++  +   + + ++ ++    +K++R+ +L+  L  E+ RW+  +   S++  ++ GD L+S+A +AY G +    R+ +   W    +   +        ++ L        W +  LPVD    +N I+++  NR+PL IDP GQA ++I        +      D +F + LE++++FG  +L+++V E  +PIL P+L + + R  G   + +GD  I+ +  F+ ++ TR     + P+I ++V  +NF +T   L  Q L  V   E+P++++K+N L+    +   +L+ LE  +L  L+ S+G IL++ + I  L   K  + E+++K    +    E+D     Y+ ++   S ++  +  +  I  +Y YSL++ + +F   ++  E S   D   R+  +      +V+R + R +    K+L +L +
Sbjct: 2479 YEVQLSGDWQPWLSKVPTMEIESHRVAA----ADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTL---LAALRSQQEMEVVNVNFSSST----TPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIY-------------GTFNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRGISEAITPLESL-SAEQLVRLWAHEAIRLFQDRLVTEEER-EWTDKLVDTTAERYFGNACRL-----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGFYEE-----ELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGA----QRQGLILDSHD-ELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGEN------------VGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQM-EKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL 3829          

HSP 3 Score: 171.014 bits (432), Expect = 1.571e-41
Identity = 139/567 (24.51%), Postives = 250/567 (44.09%), Query Frame = 2
Query: 9404 GLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPF-DLLSSF-NDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASK-IASISLGQGQG-PIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTE---------LPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKY---PFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPED-------SIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLN--FFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDI 11029
             ++ LIV+  +RPD+++ +    ++      F+      D+LS   N+ +   P++   + G D    +    ED     ++ + SI++G  +G   A   +  A + G WV+L+N HLA SW+  LEK    +      H  FRL+LT+      P SIL+    +  EP  GL+ANLLRS  + P    +      + SR   +   +C+ HALVQER ++ PLGW+  YEF+++DLR++   +   ++   +         LP   L  L  +C YGG++ +  D+ LL  +L+  + A   E++      +      ++P        I ++  L     P   GL  NA+     +    +   +L     + +      E+        + ELA   L+ LP+     + M+R      + +     +E+   ++L+  +R  L  +    +     NNE   +  S+  G+VP  W   + P    +  ++ DL +RL         +N    TFW+ G +  ++++T   Q  A+  T  ++++     I   D STD+
Sbjct: 3935 AMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKI----EDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM----KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIP--PQRLTKAPTERSR---LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI---VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTD-STDV 4484          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 546.199 bits (1406), Expect = 3.243e-155
Identity = 340/951 (35.75%), Postives = 525/951 (55.21%), Query Frame = 1
Query: 1825 GIQERHWDQMSDIIGFDIKPTEESSLMDFLTYG------LHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFS-SEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVAT---GQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQ-LEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDS--------IESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY---DRGGEVWVCQI---STELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFV-FEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQ----KMPDTENESI----LLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIF---FSAVKDN----LTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYG---IINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREF---AVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIY 4536
             ++ERHW QM       +K    +  +  LT G      + +H   +++I   A  E  LE+ L +M+E W+  + EL  Y++    ++   DD+   L +H      MK SP+ K FE+  + W++KL  +N + DVW+ VQ  W+YLE +FS S +I   +P E  +F  +      +M +   +P  L      G + +L+RL D   +L +IQK L +YLE++R  FPRF+F+ +++LLEI+  +KD  R+Q HLKK F GI  ++  E+   I    S EGE + +V  +     +  +  WL  +E  M +++ + +  S        I++        W+  +P Q++   + I+W  E+ + +    G ++        ++ +   V        R  + AL    VH RD    +  +++ + N F WL  +R+Y    +   V  C +   +++  YG EYLG   RLV TPLTDRCY T+  AL   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D++AMG+   GL Q GAW CFDEFNR+E  +LS V+QQIQ+IQ A+  G    V   G  L++N    +FITMNPGY+GR  LPDNLK LFRS+AM  PD  LI ++ L+S GF  A  LA+KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+++    KM     E +    +L++++ +  +PK +++DI L   ++SD+FPG+              S V D      +  + +    ++DK+LQ+Y++  + HGLM+VG    GKT A++ L            ++ ++   G   +I+ KA++   LYG  DP + EWTDG+   + R+       + DRR+W++FDG VD  W+EN+N+VLDDNK L L +GE + +   + +IFE ADL+ A+ ATVSRCGM++
Sbjct: 1374 ALKERHWHQM-------MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLK---------ALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 2302          

HSP 2 Score: 531.176 bits (1367), Expect = 1.251e-150
Identity = 360/1413 (25.48%), Postives = 697/1413 (49.33%), Query Frame = 1
Query: 5044 FEKKSGGNWQEW---VNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYL-ANNINFSARTSANQTQDIIMTKLD------RRRKGVYGPPPE--KRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGG-GRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNR-----------LGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGV--LLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDV-RGLIFGDYMTDDKIYDEITSLKN-LAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENT--------------------REAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSE--DLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTM 9132
            +E +  G+WQ W   V T++ ES  ++      ++++PT +T R    L  +L   KP+++ GP G+GK++ +   L  L   + +   N+NFS+ T    T ++++   D      R   GV   P +  +  V+F D++N+PA +KYG Q  I  LRQ ++   ++   D S + L     + A  PP   GR+ ++SR +RH  ++ V+     ++ +I+             G FNR           L   L ++ ++VY  +   F     + HYV++ R+ +R ++G+   + P  +L + E+L+RLW HE  R+F DRL  EE+R ++ D +  TTA+ +  N  ++           DE + R L++  +++ + +      L++ ++ R++ F ++     +  + LV+F   ++H+ R+ R+ +Q  GH LL+G  G+G+ + +R  A++    +F +++   Y   ++ +D++ +L +AGC  + L F+  ++ +    F+E ++ LL  G+VP L+  DE   ++ +++  A    ++ G  +DS    +Y +F ++V +NLH+V  M+P G   R R    P+L N C ++WF  W E+AL  V ++    +++D                       R+A+V      H++V++ +E       R    TP  +L+ IK F  L + KR++L   K     GL K+    ++V ++Q  LK    EL       +  L ++  D  + E +++     Q++   +  +  E K   E DLA+  P + +A  ++  +K++ +  V+SM +PP  +KL +EA+CI+LGE             +   W +  +++    F+ R+  F  + + P+ +K++ EKYI  PD++   V  AS AC  + KW  A   Y      V P + +L   E+E     ++      ++ E+E  +    ++  +   + + ++ ++    +K++R+ +L+  L  E+ RW+  +   S++  ++ GD L+S+A +AY G +    R+ +   W    +   +        ++ L        W +  LPVD    +N I+++  NR+PL IDP GQA ++I        +      D +F + LE++++FG  +L+++V E  +PIL P+L + + R  G   + +GD  I+ +  F+ ++ TR     + P+I ++V  +NF +T   L  Q L  V   E+P++++K+N L+    +   +L+ LE  +L  L+ S+G IL++ + I  L   K  + E+++K    +    E+D     Y+ ++   S ++  +  +  I  +Y YSL++ + +F   ++  E S   D   R+  +      +V+R + R +    K+L +L +
Sbjct: 2479 YEVQLSGDWQPWLSKVPTMEIESHRVAA----ADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTL---LAALRSQQEMEVVNVNFSSST----TPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIY-------------GTFNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRGISEAITPLESL-SAEQLVRLWAHEAIRLFQDRLVTEEER-EWTDKLVDTTAERYFGNACRL-----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGFYEE-----ELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGA----QRQGLILDSHD-ELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGEN------------VGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQM-EKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL 3829          

HSP 3 Score: 171.014 bits (432), Expect = 1.571e-41
Identity = 139/567 (24.51%), Postives = 250/567 (44.09%), Query Frame = 2
Query: 9404 GLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPF-DLLSSF-NDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASK-IASISLGQGQG-PIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTE---------LPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKY---PFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPED-------SIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLN--FFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDI 11029
             ++ LIV+  +RPD+++ +    ++      F+      D+LS   N+ +   P++   + G D    +    ED     ++ + SI++G  +G   A   +  A + G WV+L+N HLA SW+  LEK    +      H  FRL+LT+      P SIL+    +  EP  GL+ANLLRS  + P    +      + SR   +   +C+ HALVQER ++ PLGW+  YEF+++DLR++   +   ++   +         LP   L  L  +C YGG++ +  D+ LL  +L+  + A   E++      +      ++P        I ++  L     P   GL  NA+     +    +   +L     + +      E+        + ELA   L+ LP+     + M+R      + +     +E+   ++L+  +R  L  +    +     NNE   +  S+  G+VP  W   + P    +  ++ DL +RL         +N    TFW+ G +  ++++T   Q  A+  T  ++++     I   D STD+
Sbjct: 3935 AMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKI----EDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM----KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIP--PQRLTKAPTERSR---LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI---VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTD-STDV 4484          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 545.428 bits (1404), Expect = 4.089e-155
Identity = 340/951 (35.75%), Postives = 525/951 (55.21%), Query Frame = 1
Query: 1825 GIQERHWDQMSDIIGFDIKPTEESSLMDFLTYG------LHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFS-SEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVAT---GQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQ-LEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDS--------IESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY---DRGGEVWVCQI---STELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFV-FEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQ----KMPDTENESI----LLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIF---FSAVKDN----LTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYG---IINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREF---AVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIY 4536
             ++ERHW QM       +K    +  +  LT G      + +H   +++I   A  E  LE+ L +M+E W+  + EL  Y++    ++   DD+   L +H      MK SP+ K FE+  + W++KL  +N + DVW+ VQ  W+YLE +FS S +I   +P E  +F  +      +M +   +P  L      G + +L+RL D   +L +IQK L +YLE++R  FPRF+F+ +++LLEI+  +KD  R+Q HLKK F GI  ++  E+   I    S EGE + +V  +     +  +  WL  +E  M +++ + +  S        I++        W+  +P Q++   + I+W  E+ + +    G ++        ++ +   V        R  + AL    VH RD    +  +++ + N F WL  +R+Y    +   V  C +   +++  YG EYLG   RLV TPLTDRCY T+  AL   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D++AMG+   GL Q GAW CFDEFNR+E  +LS V+QQIQ+IQ A+  G    V   G  L++N    +FITMNPGY+GR  LPDNLK LFRS+AM  PD  LI ++ L+S GF  A  LA+KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+++    KM     E +    +L++++ +  +PK +++DI L   ++SD+FPG+              S V D      +  + +    ++DK+LQ+Y++  + HGLM+VG    GKT A++ L            ++ ++   G   +I+ KA++   LYG  DP + EWTDG+   + R+       + DRR+W++FDG VD  W+EN+N+VLDDNK L L +GE + +   + +IFE ADL+ A+ ATVSRCGM++
Sbjct:  442 ALKERHWHQM-------MKEMRVNWNLSDLTLGQVWDADILRHEHTIKKILLVAQGEMALEEFLREMREYWQNYEVELVNYQNK-TRLIKGWDDLFNKLKEHQNSLSAMKLSPYYKQFEESAQSWDEKLNKINAMFDVWIDVQRRWVYLEGLFSGSAEISTLLPFESSRFATITTDVLALMKKVAASPRILDVVNMQGAQRLLERLAD---MLAKIQKALGEYLERERSSFPRFYFVGDEDLLEIMGNSKDITRIQKHLKKMFAGITAIDINEEDRSITAFHSREGEKVDLVKIVSTKDVR--INDWLQALEAEMKHTLARQLAASLTHFSKMNIQTMTTDDYVEWLDKFPAQVITLTAEIWWCDEMEKTLADGKGAENVEQAVVKTLELLADSVLKEQPPIRRKKMEALITELVHKRDTCRKLVSMKIRAANDFGWLQCMRFYFDPKQVDPVRCCVVKMANSQFFYGFEYLGIQERLVRTPLTDRCYLTMTQALHSRLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRILVGLCQVGAWGCFDEFNRLEERMLSAVSQQIQTIQEAVRAGGDMSVDLVGKRLNVNSNIGIFITMNPGYSGRSNLPDNLKQLFRSLAMTQPDRQLIAQVMLFSQGFRTAETLANKIVPLFILCKEQLSDQCHYDFGLRALKYVLVSAGNIKRDKLDKMGSAALEDVAEQQMLIQSVCETLVPKLVNEDIALLFSLLSDVFPGIHYTANQMRELRQQLSTVCDEHLLIYSDVQGEMGSMWLDKVLQLYQITNLNHGLMLVGSSGSGKTMAWKVLLK---------ALERWENVEGVAHVIDAKAMSKDSLYGVMDPNTREWTDGLFTSVIRKIIDNVRGEADRRQWIIFDGDVDPEWVENLNSVLDDNKLLTLPNGERLSIPPNVRIIFEVADLKYATLATVSRCGMVW 1370          

HSP 2 Score: 531.561 bits (1368), Expect = 6.582e-151
Identity = 360/1413 (25.48%), Postives = 697/1413 (49.33%), Query Frame = 1
Query: 5044 FEKKSGGNWQEW---VNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYL-ANNINFSARTSANQTQDIIMTKLD------RRRKGVYGPPPE--KRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGG-GRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNR-----------LGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGV--LLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDV-RGLIFGDYMTDDKIYDEITSLKN-LAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENT--------------------REAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSE--DLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTM 9132
            +E +  G+WQ W   V T++ ES  ++      ++++PT +T R    L  +L   KP+++ GP G+GK++ +   L  L   + +   N+NFS+ T    T ++++   D      R   GV   P +  +  V+F D++N+PA +KYG Q  I  LRQ ++   ++   D S + L     + A  PP   GR+ ++SR +RH  ++ V+     ++ +I+             G FNR           L   L ++ ++VY  +   F     + HYV++ R+ +R ++G+   + P  +L + E+L+RLW HE  R+F DRL  EE+R ++ D +  TTA+ +  N  ++           DE + R L++  +++ + +      L++ ++ R++ F ++     +  + LV+F   ++H+ R+ R+ +Q  GH LL+G  G+G+ + +R  A++    +F +++   Y   ++ +D++ +L +AGC  + L F+  ++ +    F+E ++ LL  G+VP L+  DE   ++ +++  A    ++ G  +DS    +Y +F ++V +NLH+V  M+P G   R R    P+L N C ++WF  W E+AL  V ++    +++D                       R+A+V      H++V++ +E       R    TP  +L+ IK F  L + KR++L   K     GL K+    ++V ++Q  LK    EL       +  L ++  D  + E +++     Q++   +  +  E K   E DLA+  P + +A  ++  +K++ +  V+SM +PP  +KL +EA+CI+LGE             +   W +  +++    F+ R+  F  + + P+ +K++ EKYI  PD++   V  AS AC  + KW  A   Y      V P + +L   E+E     ++      ++ E+E  +    ++  +   + + ++ ++    +K++R+ +L+  L  E+ RW+  +   S++  ++ GD L+S+A +AY G +    R+ +   W    +   +        ++ L        W +  LPVD    +N I+++  NR+PL IDP GQA ++I        +      D +F + LE++++FG  +L+++V E  +PIL P+L + + R  G   + +GD  I+ +  F+ ++ TR     + P+I ++V  +NF +T   L  Q L  V   E+P++++K+N L+    +   +L+ LE  +L  L+ S+G IL++ + I  L   K  + E+++K    +    E+D     Y+ ++   S ++  +  +  I  +Y YSL++ + +F   ++  E S   D   R+  +      +V+R + R +    K+L +L +
Sbjct: 1547 YEVQLSGDWQPWLSKVPTMEIESHRVAA----ADLVVPTIDTVRHEMLLAAWLAEHKPLVLCGPPGSGKTMTL---LAALRSQQEMEVVNVNFSSST----TPELLLRTFDHYCEYRRTPNGVVLAPVQLSQWLVIFCDEINLPAPDKYGTQRVISFLRQLVELNGFYRTSDHSWVSLERIQFVGACNPPTDPGRHPMTSRFLRHVPIVYVDYPGQTSLQQIY-------------GTFNRAMLKMTPAVRGLADQLTNAMVDVYLASQEHF-TQDDQPHYVYSPRELTRWVRGISEAITPLESL-SAEQLVRLWAHEAIRLFQDRLVTEEER-EWTDKLVDTTAERYFGNACRL-----------DEALKRPLLYSCWLSRNYVPVTREELQDYVSARLKGFYEE-----ELDVKLVLFDQMLDHVLRIDRIYRQSQGHLLLIGTAGAGKTTLSRFVAWLNGLSVFQLKVHSKYTAADFDEDMRTVLRRAGCRNEKLCFIMDESNMLDTGFLERLNTLLANGEVPGLFEGDEHTTLMTQIKEGA----QRQGLILDSHD-ELYKWFTQQVMRNLHVVFTMNPSGSGLRERASTSPALFNRCVLNWFGDWSENALYQVGSELTRTMDLDRTDYEGSVRLTPSCELVPSQPTYRDAVVNTLCLVHKTVQKFNEMETKKGHRVMACTPRHFLDFIKQFMSLFHEKRSDLEEEKIHLNIGLNKISETEEQVKELQKSLKLKSNELQEKKEAANLKLKEMLGDQQKAEEEKKFSEQLQKELAEQLKQMAEKKTFVENDLAQVEPAVAEAQTAVQGIKKSQLVEVKSMSSPPVTVKLTLEAICILLGEN------------VGTDWKAIRQVMMKDDFMTRILQFDTELLTPEILKQM-EKYIQNPDWEFDKVNRASVACGPMVKWARAQLLYSTMLHKVEPLRNELKRLEQEAAKKTQEGKVVDVRITELEESIGKYKEEYAQLIGQAENIKQDLLSVQEKVNRSTELLSSLRSERDRWSSGSAGFSQQMDSLVGDALLSSAFLAYAGYYDQMLRDEIFHKWFNHVVNAGLHFRHDLARIEYLSTVDDRLQWQLNSLPVDDLCTENAIMLHRFNRYPLIIDPSGQAVEYIMKQFAGKNIQKTSFLDESFRKNLESALRFGNSLLVQDV-EAYDPILNPVLNREVKRAGGRVLITIGDQDIDLSPSFQIFMITRDSTVEFSPDICSRVTFVNFTVTSSSLASQCLNQVLRSERPDVDKKRNDLLKLQGEFAVRLRHLEKALLAALNESKGKILDDNSVIETLEKLKNEAAEVAQKSAETDKVMAEVDAVSAQYQRLSTACSHIYHTLQQLNEIHFLYHYSLDFLVEIFTHVLKTPELSSTTDYAKRLRIITTSLFQTVFRRVSRGMLHTDKVLLALLL 2897          

HSP 3 Score: 171.4 bits (433), Expect = 1.072e-41
Identity = 139/567 (24.51%), Postives = 250/567 (44.09%), Query Frame = 2
Query: 9404 GLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPF-DLLSSF-NDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASK-IASISLGQGQG-PIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTE---------LPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKY---PFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPED-------SIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLN--FFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDI 11029
             ++ LIV+  +RPD+++ +    ++      F+      D+LS   N+ +   P++   + G D    +    ED     ++ + SI++G  +G   A   +  A + G WV+L+N HLA SW+  LEK    +      H  FRL+LT+      P SIL+    +  EP  GL+ANLLRS  + P    +      + SR   +   +C+ HALVQER ++ PLGW+  YEF+++DLR++   +   ++   +         LP   L  L  +C YGG++ +  D+ LL  +L+  + A   E++      +      ++P        I ++  L     P   GL  NA+     +    +   +L     + +      E+        + ELA   L+ LP+     + M+R      + +     +E+   ++L+  +R  L  +    +     NNE   +  S+  G+VP  W   + P    +  ++ DL +RL         +N    TFW+ G +  ++++T   Q  A+  T  ++++     I   D STD+
Sbjct: 3003 AMNSLIVVHALRPDRLMASAHRVVSTAFDDHFMQQDKVVDILSIVDNEVSPSEPVLLCSATGYDASGKI----EDLAVETNRQLTSIAIGSAEGFNQADSALGTATKSGRWVLLKNVHLAPSWLAQLEKRLHSM----KPHAQFRLFLTAEIHPKLPSSILRASRVVVFEPATGLKANLLRSLSSIP--PQRLTKAPTERSR---LYLLVCWLHALVQERLRYTPLGWSTAYEFSDADLRVACDTLDAAVDAVAQGRPNVEPERLPWTTLRTLLSQCIYGGKIDNQFDQVLLDCVLENLFTAKSFEQDHVLIPKYDGDDSLFTPNMSKKDQMIGWVEELKNEQLPAWLGLPNNAEKVLLTKRGESMLRNMLKVTDEELAFNEDGKEEVKPQWMAQLGELAKQWLQLLPKEI---VKMRRTVENIKDPLFRFFEREVNLGSQLLKDIRRDLNEISAVCRAEKKQNNETRALAASLQKGEVPTGWKRYTVPREVTVMDWMTDLNERLKQLIRIGGADNLKRETFWLGGTFSPEAYITATRQQVAQANTWSLEQLNLHIHIGRTD-STDV 3552          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 259.61 bits (662), Expect = 2.070e-68
Identity = 145/388 (37.37%), Postives = 238/388 (61.34%), Query Frame = 1
Query: 6952 TPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKC---IEMTIPC 8106
            T    L+++ T  KL   KR E+     +Y  G+EK++ A ++V  MQ EL  LQP+L+ TS +T  L++ +E++T++VE  RE++AA +  AN  A ++Q +K + EA+LA A+P L  A+ +L+T+ Q+D++ +++M+ PPY ++L MEAVCI+LG KP  K     G+++ DYW S  KLL D  FL ++++F+ D+V+ + +K +REKY+ + +FDP+ V+  S A EGLC+W++A+D Y+  +KIV PK+ +L  AE  ++  LKQL  K+  L +V  KLQ L+DQ  +  Q+K+ELE  I  C  +++RAE+L+  L GEK +W      ++          + S+  +   G   +  R   +    +     +E+TIPC
Sbjct: 2096 TRAEKLKMVSTITKLAKKKREEVRKTMTKYEKGMEKMKRAEEQVAGMQGELLRLQPQLVRTSIETSMLMSTIEKETIDVENAREVVAANENKANEAATKAQSLKAESEAELASAIPALESAVEALETMTQSDVSSLKTMRFPPYAVRLCMEAVCILLGVKPA-KITNEIGEVVNDYWVSGQKLLSDIHFLAKIRSFARDTVSKKTVKLIREKYLSKEEFDPENVKQCSLAAEGLCRWVLAIDMYNQISKIVEPKRERLRKAEVLVKQHLKQLEVKRKALLKVTEKLQGLSDQFSQMCQKKQELESQISSCEVRMERAERLVQALSGEKDKWKNKITYITHEDSLSVPYSVGSSLALHVFGKLPIDQREKELRKTMRSLFPRLEVTIPC 2482          

HSP 2 Score: 140.584 bits (353), Expect = 2.134e-32
Identity = 130/543 (23.94%), Postives = 242/543 (44.57%), Query Frame = 1
Query: 1759 KVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLE----EIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIE--SYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAM 3369
            K++  + +F+  LPVL  I    +++RHW  +       +K      + + L     +  +K E++GA A KE  LE ++ KMK  W    F        G  +L+   ++QM    H+ +SQT+  SP        ++ W D L+++N  + ++ +    W  +E +FS+EDI  QMP E R F  + + W  +  +  +    L    Q D++++L    S LE     ++ G + YL KKR  FPR F LS++ +L ++ ++++P   + ++   F  +   +   ++EII  +S + ET+S+V  +    +K  VEKW+ ++++ +  +++  I   IE  +Y ++     +L+ P Q+      I +T ++  ++   N L     +    I D    V       E   L  L  I   +  +V  +   QV  ++ + W SQLRYY     V++   +    Y  E  G    ++   L D   +  +        G   G          + +A A+ K   + +    +D K +
Sbjct:  680 KIEIVLAEFEKLLPVLGAISCQAMKDRHWKMILQDSETSVKVEGNPLVSELLEMNFIEKADKFEQVGAQAEKERVLETSIEKMKSQWVTATF----VTHQGGELLTTELNVQM--QAHLARSQTILSSPHAFSILDHIRHWLDTLLNLNTFVHLYKQCDTRWRKIEGVFSTEDIAYQMPHEFRTFKKISLRWLHINNQITEERPIL---EQMDLVQQLNLELSELEVLFGRMENGFHAYLRKKRAVFPRLFALSDELVLSLICDSREPANCKSYIPLLFPSLTTFDQNTKMEIIS-VSTKLETISLVKPVNVNLSKRHVEKWMHELDSQIKYTLRTRIRLLIEKMNYKLSP-VETILNEPIQVAAVYLKIAFTWQMENSMK-QNSLTILASELKICIRDCQHAVLHKHDRWE--FLPVLYHIYKSSTHLVNKLMNEQVIFIDDYRWTSQLRYYWHLENVFIRVGTVSTRYDYEVQG-VDCMIDNQLVDEAVKYFICMNHFGFNGFVNG----MDVNLARQIAGALGKPFAICDTEQEIDCKML 1203          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 2770.34 bits (7180), Expect = 0.000e+0
Identity = 1470/3037 (48.40%), Postives = 2019/3037 (66.48%), Query Frame = 1
Query:  325 VKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTR-RLNIDIFKRCDKLR-ELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKK-KEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITV---PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINP-----LYPKPKSI---KLTKSNSF--PERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE-HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDE-DVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            VK FF  +A+LM+ QL ++   SL ++ +FI  + + N  G E          +M+ +    E  I + PSF +++  L+R    I+ S + +PR+E  L+ ++   +    T    E +V    +      ++  +GP+  L  +  + +L+N      V  F++           +  Y++ +D ++    +V    F    R +    +   C +L+ +LL     ++   I R + + YD I  K   +P DT  L+ ++ ++  A    V  ++   +  +  +++L+D+      +IK N+  F W   + ++F+     I  +  + +E L+ R+  F   L+   + ++ +    ++  +   ++    LD+   ++    + ++Q+N+EE+   W+ SQ+P+       L PY  L+    DF  K D W+       +   I+ D+    +I+ KL KQ  D+P   ++   VK +I+ F+ H+P++  + NPG++ RHW+ +S+IIGF IK + E +L   + Y L +++ K E I  +A KE+ LE+ +AKM  +W+ ++F ++ YRDSG   L+A+DDIQ+LLDD IIK+QTMK SP+IKPFE ++  WE KL+ + +I+D WL+VQATW+YLEPIFSS DI  QMPEEGR+F  VD  WKE+M +  ++P  +V      M  +L  + SLLE IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQ HLKKCFEGI  L FTE+L++  M S+E E +++V  I  +KA+G VEKWLL++E  M  SV   ++++  SY+   R  WVL WPGQ V  +S  YWT E+TE          L  YL KC  QI+ IV LVRG+L +  RITLGAL V+DVHARDV+  +   QV  +  F+WL QLRYY     +    I+  LPYG EYLGNTPRLV+TPLTDRCYRTL +AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQI +IQ  I  G    VFEGT L+L+PTC +FITMNPGYAGR ELPDNLK LFRSVAMMVPDYALI EI LYS GF+ A+ L+ KIVATYRLCSEQLS+Q HYDYGMRAVKSVL AAG L+ +  D ENE IL+L++I DVNLPKFL+QDIPLF+GI SDLFPG  LP+AD+ +F    +    ++  Q   + ++K+ Q+YEMI+VRHGLM+VG PFGGKT  Y+ LA AL  +       E K  Y +INPKAITMGQLYGQFD VSHEW+DG+LA+ +R FA++    RKWL+FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SN  NL+FEP DLE ASPATVSRCGMIY+EP+ LGW P + S+ +  LP   +    QLI  L        L  +R + K++  TS+ + +V L   F   +D+ R++  V       D D +   AQ      +G+FLFS +WS+G SL    R KF++ FR L     P      Y  P+ +    L K   F  P++ +++D+ + K+  G W+ W + ++  +  I  D  +N+III T E+ R    LDL   H KP+++VGPTGTGKSV + +Y++ ++    Y    I+FSA+TSANQTQDIIM+KLD+RRKGV+GPP   R V+FVDD++MP KE YGAQPPIELLR  +DH  W+D+K+   + LID  ++ AMGPP  G N V+ R  R FNV+ +++FN++ +  IF+ IV WH +  GF   F+     +V +T+ +Y  A  + LPTPAKSHY+FNLRDFSRVI+GVLL       +   + RLWVHEV RV+ DRL  + DR   F+ +  T   CF T+  ++ G L    K + E D R LI+ D+     D K Y E+  L+ L + +E +L +YN++SK PM+LV+F+FA+EH+SR+CR++KQ   HALL+G+GGSGRQS TR+A+ + D+E+F +EITR YG  E+ +D+K +L K G      VFLF+D QIK ESF+EDIS LLN+G+VPNL+ ++EK E+ EKM    +  +K    + D +P+A++N+F+   K  LHIVLAMSPIGDA RNR+R FPS++NCCTIDWFQ+WPEDAL  V+ +FL   ++    R   + MC  +H S ++LS +F + L RYNYVTPTSYLELI+TFK LL+ KRN +   +NRYLTG+ +L+ A+++V  MQ +L AL+P+L   S    + +AKV  D+   E +REI+  ++  A  +AA +QEIKD+C+A L EA+PIL  A+A+L+TL   DI +V++MK+PP  +++VMEAVCI+   KP++ P+ S    +EDYW  S ++L D KFLD L NF  D++  + +KKL ++ +    FDP  +++ASTACEGLC+W+IA+ KYD  AKIVAPKK+ LA AE      +K L EK A L +VEA L  +   LDE  ++   L    E CTKKL RA++LI GLGGE++RW+E AKML   + ++TGDVL+S+ VV+YLG FT+ FR   +  W  KC+   + C+  F++  +LGEPV+IR WNI GLP D+FSI++ I++ N+ RWPL IDPQGQANKWIKN EK+N+L +I+L   ++ R +EN+IQFG PVLLEN+GEEL+P+LE +LQKT+F+Q G   ++LGD+VIEYN  F+FY+TT+LRNPHYLPE++ KV LLNFMIT QGL+DQLLGI  A+E+P+LE +KN LI++ ADNKR LKE EDQILEVLSS++ NILE+ETA+ +LSS+K L+ +ISEKQ I E T+ +ID  R  Y P+A H +ILFF I ++ANIDPMYQYSL WF+NL++ SI+N+EK +D+  R+  L +HFT S+Y NICRSLFE  KLLFSL + I ++K  N++++  W FLLTGGV L+NPY NP   W+  + W E+ R + L + KGLRE F  N+ +WK  +DS+SP+
Sbjct:  351 VKRFFNCVAALMTQQLEDICIRSLKEYADFICDYGHSNP-GFEIS--------VMLAD----EDTIQFNPSFSKVQSELLRVIDSIMLSIQMLPRIESKLYTDLIVSKKIFLTPTVPESIVQETKNRICAMLEEQRIGPELRLQDFDPFIDLINGSDAERVGNFMESDATFEQYADMVYEYKEKEDRIAKEVWAVIRMGFYEFHRDKFITHLESLCRQLQLDLLARMVTDQQARITR-LGKEYDAIAKKALTVPKDTAELMQLKAYVVHAEENLVPEMEARLKVNMSEILWLMDHTLYSPLEIKNNSNSFQWYLKLPSIFEQHRAIIAEKVIEYQELLKKRIELFRRELQNYYEQVQTYDTWGDIKQLSRYKKRAGVLDQ---RLVQAMETIDQINEEETSYGWDLSQYPMRKKAHDQLKPYKTLFDAGQDFMDKWDLWMHSQVGSFDPDEIDGDVSNFYRIIQKLDKQMGDHPITMQLIQDVKAQIEAFREHMPIINTLGNPGMKARHWELVSEIIGFPIKVSPELTLEKIIEYQLDEYVPKFEAISESATKENNLERAMAKMVNEWEGVEFSISPYRDSGTFKLAAVDDIQILLDDQIIKTQTMKSSPYIKPFEADIIKWEAKLMLLQEILDEWLRVQATWMYLEPIFSSPDIQQQMPEEGRRFSAVDKIWKELMKQVSQDPKVMVVVQIDKMNDKLKKAYSLLEVIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQIHLKKCFEGIATLNFTEELDVTAMRSSEREEVTLVDVISTSKARGQVEKWLLELEIDMKKSVHHKVSEAFYSYLKMLRHVWVLTWPGQCVQSISLTYWTLEITECFESEEPKENLAKYLQKCVLQINKIVDLVRGDLNTQNRITLGALVVLDVHARDVLAEIVANQVEDLQDFQWLCQLRYYWEDNNLDTRMINCSLPYGYEYLGNTPRLVVTPLTDRCYRTLFAALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRGINSGSPTLVFEGTTLTLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALISEIELYSYGFLTAKPLSVKIVATYRLCSEQLSTQCHYDYGMRAVKSVLKAAGALKLRYRD-ENEDILVLRSIKDVNLPKFLNQDIPLFQGITSDLFPGTVLPEADYVLFNKCTQMACERQNKQCTPFVLEKVQQLYEMIVVRHGLMLVGYPFGGKTTTYRVLAEALECMEKTDG-SENKAIYTVINPKAITMGQLYGQFDAVSHEWSDGILAVNYRIFAISDSPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSNTTNLVFEPMDLEVASPATVSRCGMIYLEPSSLGWEPLVASW-KNTLPAAFHTVSKQLISMLISRFCPILLFILRKSLKEIAPTSDANLMVSLMNFFECFIDDFRDEKYVANV---SDLDFR---AQT-----EGIFLFSCIWSLGGSLDADSREKFNIIFRALMEKTFPQSLYDTYGVPEDLYVESLAKPFIFPIPKQGSVFDYRYIKEGKGKWKPWQDDVN-SAPPIPRDIPVNQIIIQTNESVRIGAVLDLLNRHGKPIMLVGPTGTGKSVYVIDYMLKKMDLSFYKPLLISFSAQTSANQTQDIIMSKLDKRRKGVFGPPLNSRFVIFVDDVSMPLKENYGAQPPIELLRMMLDHMMWYDRKNIVPMKLIDLQMIVAMGPPSTG-NTVTPRFQRFFNVISIDDFNNDILNTIFSKIVLWHLDTRGFSKEFDPCIDEIVGATLTIYNDAKLNLLPTPAKSHYLFNLRDFSRVIQGVLLSVPEATEDVNSMRRLWVHEVLRVYGDRLVEDADRSWLFENICSTVKSCFNTDPSRLFGRLVEKDKSLQESDFRQLIYCDFTNPKADTKNYVEVQDLEELRRVVEAYLVEYNNMSKKPMNLVLFRFAIEHLSRICRIIKQPRSHALLIGVGGSGRQSLTRLASHICDYELFQVEITRLYGPYEYHEDIKAILRKIGASEMHGVFLFTDVQIKDESFLEDISNLLNSGEVPNLFTNEEKIEVQEKMAQIDKQRDKAV--QTDGSPVALFNFFVTTCKDQLHIVLAMSPIGDALRNRIRKFPSIVNCCTIDWFQSWPEDALLAVSTRFLASEDLTALERRTAIDMCMEFHTSTQELSAKFFSRLHRYNYVTPTSYLELIQTFKALLSQKRNNITNNRNRYLTGISQLDIAAQQVAVMQEQLIALEPKLKEASEIVAEQVAKVTADSKLAEEQREIVKLDESAAKEQAAVAQEIKDECDAKLGEALPILESALAALNTLTTADIAVVKTMKSPPIGVRIVMEAVCILKDVKPDKVPNPSGLGTVEDYWGPSKRVLSDMKFLDSLLNFDKDNIPVEVMKKLAQRILSNEAFDPDKIKSASTACEGLCRWVIALTKYDVVAKIVAPKKLALAEAEATYNAAMKTLNEKLAMLAKVEANLAAIQKILDEQLRQYGILLAEHEACTKKLQRAQELISGLGGERTRWSETAKMLQASFKSVTGDVLISSGVVSYLGPFTIDFRVDQIRKWVTKCLNFGVTCTADFQLAVVLGEPVEIRFWNICGLPTDAFSIESAIMMKNARRWPLMIDPQGQANKWIKNYEKNNKLCVIRLNQADYTRVMENAIQFGLPVLLENIGEELDPVLESVLQKTLFKQGGALCIKLGDSVIEYNHSFRFYMTTKLRNPHYLPEVAVKVTLLNFMITTQGLQDQLLGITVARERPDLEAEKNNLIVQGADNKRMLKETEDQILEVLSSAE-NILEDETAVQILSSAKALANDISEKQVITEATEKQIDIARLSYVPIAEHSTILFFTIVELANIDPMYQYSLVWFVNLYMSSIDNTEKVDDIAARLLDLRNHFTYSLYVNICRSLFERDKLLFSLILNINMMKHDNRIDNAEWMFLLTGGVGLENPYKNPT-TWLGVQNWDELCRLTNLTNFKGLREDFNENSAQWKPFFDSKSPQ 3350          

HSP 2 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 358/657 (54.49%), Postives = 476/657 (72.45%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEK-YPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLT------LPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVR-PEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDL---PNNLSQNHWINRGVASLCQL 11350
            KL++LR  RPDK+VPAV +F++  LG+ F+DPP FDL++SF DS+CC PLIF+L+PG+DP   LLKF EDQG+  +++ S+SLGQGQGPIA KMID+ ++ G WVVLQNCHLA S+M  LEKICE ++ P+ TH +FRLWLTSYP++ FPV +LQNG+KMTNEPPKGLR+N+LRS ++DPISD ++++ C     +  +++ LCFFHA++QERR FGP+GWNIPYEFNE+DLRIS+ Q++MFLN Y  +  +AL YLTGECNYGGRVTDD DRR L ++L  FY   +++ E  Y    +G+YY P      +Y+ + R LP    P ++G H NADI KD +ET+ L S  LLT             +  +PE+ +  +A DIL KLP+ FD +  + +YP +Y +SMNTVL QE++RFN L++ +R++LI L+K IKGLVVM+  +E V+ S+LI K+P  WA KSYPSLKPLGSYV D ++RL F   W ++  PSTFW+SGF+FTQ+FLTG  QN+ARKY I ID + F++E+ + +      +  PEDG  VYG+FLEGARWD+  K L ES P+ LF+++P+IWLKP K V +     YLCP+YKT+ RRG LSTTGHSTNFV+ + L   PN    +HWI RG A LCQL
Sbjct: 3368 KLLLLRVFRPDKLVPAVLNFVSGELGERFVDPPQFDLMASFADSHCCVPLIFILTPGSDPTATLLKFAEDQGFGTNRLFSLSLGQGQGPIAMKMIDEGVKMGNWVVLQNCHLAASFMPLLEKICENLL-PDATHPDFRLWLTSYPADHFPVVVLQNGIKMTNEPPKGLRSNILRSMISDPISDPEWYESCTQPRIFKQLIYSLCFFHAVIQERRYFGPIGWNIPYEFNETDLRISLMQLRMFLNQYETVNYDALRYLTGECNYGGRVTDDWDRRTLKTILDKFYCPAVIDLETPYYLDETGLYYVPVFKEVDLYLNFTRDLPQISAPAIFGFHANADIMKDQKETDMLLSHTLLTQDTSASSDDSGGSKALTPEEVVTNVATDILDKLPKLFDRDAALLKYPTLYHQSMNTVLVQEMVRFNVLLNTIRTSLITLRKGIKGLVVMSPAVEAVYKSVLIAKIPAMWAGKSYPSLKPLGSYVTDFLRRLEFLQHWFDHGAPSTFWLSGFFFTQAFLTGAQQNYARKYVISIDLLAFDYEVLTVEEPQRQGLSGPEDGVFVYGIFLEGARWDRTGKYLAESRPRELFDTMPLIWLKPLKRVDLPERHNYLCPMYKTAERRGVLSTTGHSTNFVVAMLLLCNPNT-PVSHWIIRGTALLCQL 4022          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 2744.92 bits (7114), Expect = 0.000e+0
Identity = 1488/3201 (46.49%), Postives = 2065/3201 (64.51%), Query Frame = 1
Query:  127 ININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNF-----------------------GVEFDELQFTDTP-------LMIVELKVAEP----------------------------KIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLF---PEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLN-VYKKYGNLLNNKAELEVRAFLKERH--GLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKE---VMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY---DRGGEVWVC--QISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXX--XGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYEL-PICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMS--ISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNI----EKILGHLSLSG-KVVDEDVRGLIFGDYMTDD---KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLED----------------------------------IEMDENTREAIVIMC-KFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            +++ +L+    P+     +  I++ C ++  +L   WLPRCA L  + R  W  L+P             F  I S MS  L ++++ S+N   + +   K GN                         G  FD       P       + + +   A+P                            K+   P  +EL  +    ++ I+     IPR+E  +    PE +G   FL  +  +        ++  Q  K N  G   YL  VYK Y  L        V+    E +   L A+++ +   Q + D    LR  +PL+LFMLD R + + +     ++ + ++ F    N   NR+IC   ++++ K  E P +T  +VA+Q ++ +     +F +K+E +  ++R++FLL +  +  +++ LN+  F  P  +  V D++  R+   R+  E  LR R ++FE+ L +  ++++ F+ +E   V+T+EE++  V  +D L   I++   + + +N EE++L  + S FP+LA +I+ ++P  +LW+T+ +F      W+   F  LNA  +   +  M+KIM+KL +Q   NP A++ A +++ KI+KF+ +LPVL  IC  G+++RHWDQ+S I+G  + P    +L D +   +   L +LEEI  AA KE+ L   L  M+ DW+++ FE+ +YRDS   IL++LDDIQ LLDDHI+++Q MK SPFI     +   WE +L+ + +IID W +VQ TW+YLEPIFSSEDI+ QMP EGR F  VD  W+++M  ++K+   + AT   +ML+  T +   LE + KGLN YLE+KRL+F RFFFLSNDELLEILSETKDP RVQPHL+KCFEGI  L F + +EI+ M+S E E +++V KI P  A G+VE WL +VE VM++SVK+ + ++ E Y + +R  WV+ WPGQ+V  +SC+ WT EV EAI     L  YL K N QI D+V+LVR +L +G RI + AL V+DVH RDVV+ +   +++++  F+W+SQLRYY   +   E WVC   + T++ YG EYLGN PRLV+TPLTDRCYRTLM ALKL LGGAPEGPAGTGKTETCKDLAKAVAK+CVVFNCSDGLDYKA+GKFFKGLAQ+GAWACFDEFNRIELEVLSVVAQQI +IQ AI + + +F FE T L L+PTC++FITMNPGYAGR ELPDNLKVLFR+VAMMVPDYA+IGEI+LYS GF  AR L+ KIV  Y+LCSEQLSSQ HYDYGMRAVKSVL A+ +LR+   D     I+L +AI DVNLPKFL QDI LF GI  DLFPGV+LP          +  NL  R LQ   W+++KILQIYEM+LVRHGLMIVG   GGKT AYQ LA  L +++   + T++E+ V + IINPKAITMGQLYG+FDPVSHEW DGVLA  FRE        R W+MFDGPVDAVWIEN+NTVLDDNKKLCLMSGEI+QM+  MN++FEPADLEQASPATVSRCGMIYMEP+QLGWR   +SFI   +  + L + ++ L  D+ EWL+   L+F+   CK+++E S I+      + F   L++ +                     Q    W Q +FLF F W+  S+L   G+  FD   R++  G N  +PKPK   L +   FPE+L   D+ F++    NW  W  + D  S +     +A+I+E+I+PT ET   +Y+ +  ++    ++VVGPTGTGKS +I + L+ +PK   L N INFSARTSA   QD IM+KLDRRRKGV+GP   K+C VF DD+ MP+K+ YG+Q P+ELLR W+DHG+W D  DT+K+ L+D  L+ AMG  GG  N +  R+ RH  V+ V+ F D+T++RIFTTI DWHF  G+      L + L  + ++VY+ AI SFLPTPAKSHY F+LRD +RV +G+++VP   + + EKL RLW HE YRVFYDRL  ++DR    D + +   D  K+N+    E+  G     G K+ D D+R L +G+YM  D   K YDE  + + L K M+ +L +YNS S  PM LVMF+FA+EH+SRV RVL+   G+ L+VG+GGSGR+S+ R+AA++AD  +  ++++++Y   +WRDDLK++L+ A  +    VFLFSD Q   E ++EDI+ +LNTGD+PNLY  ++KA I+E M N A    K+ G+ +D+ P  +Y Y+I+R+++ LHI LA SPIGD+F+ R+R++PSLINCCTIDW+  WPE+AL  V   F+                                    +E ++   EA ++ C  ++H+SV   SE+    L R NYVTP++YLEL+K F+     K +E+  L++RY TGLEKL+FA+ +VG+MQ  L  LQP+L V S +TD+++  +E++T E E K+E++ A++  AN  AA +Q IKDDCE DLAEA+P +  A+ +L+TLK  DI +V+SMKNPPY +KL MEAVC++ G KP+RKPD S G M+EDYW  S+++L D KFLD LK F  D++ P  IK++REKYI + DF P+ ++ AS ACEG+C+W+ A+D YD  A+IV PKK  LA AE EL   +++L  K+A+L  +  KLQ L D   E  + KK LED I+ C KKL+RAE+L+GGLGGEK+RW+EAAK L E   NI GDVL++    AYLG FT  +R ++++ W+  C    IP SE+F +   LG P+ IRAW++AGLP D+FS++NGIIV NS+R+ L IDPQ QANKWIKNMEK+N L +IK +D N+++ LE +I FG PVL+ENVGE+L+  L PIL+K + + +G  +++ GD +IEYN +F+ YITT LRNP Y PE+   V +LNFMIT QGL +QLL IV A E+P+L+EKK  LIIESA N+  L  +E +ILEVLS+S+GN+LE+E AIN+LSSSK+LS++I EKQ IA  T++EID  R  Y PV+ H +ILFFCIS++AN+DPMYQYSL+WF+NLF+ +I  + KS+ L  R++ LND+FT S+Y N+CRSLFE  KL+ SL MC+ +L  + +V      F LTGG+      PNP   W+ DK W+ + +A++L  +K L +  +  +D+W + YD+ +P+
Sbjct:  546 VDLGQLLLAQRPLDADTVQVFIEKSCADVRDLLLNDWLPRCADLMNEMRGTWKDLVPMSGKYGGR-AAMLFRCIHSAMSRHLNSLISKSINYLFKVLCAFKGGNRIEKYSMFDAKLKRIPLMTLIASVVGAHFDHEPINMGPGVRPASNIYVYDEDDADPFQQPQVNQFVENVPDIDDVAQFELDHSNKLYIYPYMQELPRIFTEHFKSILAVGYEIPRLEFVMSGGEPETKG---FLHFIDEDHVDFLELCEKVEQIVKVNWQGVHVYLKPVYKYYFGLFQKLILPMVQKVWTENNLPELGAVQELLKKLQAVSDTTYYLRDFIPLNLFMLDNRHVKLSLRMYVREIYDFIIDFYKALNWNENRAICEELEEMSMKAGERPEETPEVVALQNYINDCREMRIFAIKDEIKNVLKRVVFLLTHTYLSSDELHLNSRTFILPGELEEVLDLSAARLAVVRDNLELALRERRMEFEKLLAQEKRTMDGFRIREIRDVLTLEELKERVDTVDLLFTTIENLSREAKAINTEETLLQIDVSAFPLLAEIIEKMEPIEKLWKTSYEFEKDYLIWMFERFECLNADGVREQVENMHKIMYKLSRQLAYNPVAKRAAEQMRMKIEKFRVYLPVLDSICRHGLEKRHWDQISKILGRKVNPKLFPTLKDMIDVDIMSILPQLEEIANAAGKEYDLNNGLRIMQADWRDVMFEVLQYRDSDTHILASLDDIQTLLDDHIMRTQAMKRSPFITALGSKADDWEARLLLIQNIIDAWTQVQITWMYLEPIFSSEDIMRQMPLEGRNFKAVDKLWRKIMKHTLKDRHVMAATEYPEMLEVFTKAIEDLETVTKGLNTYLEQKRLFFARFFFLSNDELLEILSETKDPMRVQPHLRKCFEGIGSLTFDDNMEIVEMVSDEEERVALVRKINPQLANGLVEMWLKEVEMVMLDSVKEQMREAWEDYAMVERISWVVSWPGQVVQGISCMAWTYEVEEAIETKE-LPAYLEKSNLQIADLVQLVRTDLQAGVRIAVEALIVLDVHDRDVVKYLTDCRITNIQDFDWISQLRYYWKVNEKNEDWVCVSMVVTDVEYGMEYLGNLPRLVVTPLTDRCYRTLMGALKLCLGGAPEGPAGTGKTETCKDLAKAVAKKCVVFNCSDGLDYKALGKFFKGLAQSGAWACFDEFNRIELEVLSVVAQQILTIQRAIGRKVVKFFFEDTMLKLDPTCSIFITMNPGYAGRTELPDNLKVLFRTVAMMVPDYAMIGEITLYSNGFDMARNLSQKIVQAYKLCSEQLSSQSHYDYGMRAVKSVLLASASLRRLYVDLPEPEIVL-RAIVDVNLPKFLEQDISLFIGIYMDLFPGVELPMPQRGDILKWLHINLADRNLQATPWYLEKILQIYEMLLVRHGLMIVGGSMGGKTTAYQVLAQTLRNVSTDEEATLKEFPVTFRIINPKAITMGQLYGRFDPVSHEWYDGVLAKTFREQVQGPKGERAWVMFDGPVDAVWIENLNTVLDDNKKLCLMSGEIMQMTKLMNMMFEPADLEQASPATVSRCGMIYMEPSQLGWRALHKSFINVLVNKVGLGDIYMTLFEDMTEWLVPAALEFLPQ-CKQMLELSPIYQYQTFSRFFLHFLEKHK---------------------QFNQAWFQQMFLFCFAWAYCSALTGQGQKTFDALLRKVIYGSNENFPKPKYFSLNRGQMFPEKLLFLDYRFDEAE--NWWTWQKSDDSASTTSNFPENAQISELIVPTKETGYISYWQEFCISKSYAMLVVGPTGTGKSAIITSNLLAMPKFANLVNVINFSARTSAQMVQDTIMSKLDRRRKGVFGPSLGKKCTVFCDDVAMPSKDTYGSQAPLELLRTWLDHGYWSDLVDTTKIELVDMTLMCAMGTLGGS-NFIFPRLYRHMFVVAVDSFEDSTIVRIFTTIGDWHFSKGYPEKVALLSRGLSEAMVSVYRDAIRSFLPTPAKSHYSFSLRDITRVFQGIVMVPPKRMPDPEKLGRLWAHETYRVFYDRLVDQQDR----DRLLVMAVDACKSNLRFPLEQAFGERIEPGEKLTDNDLRNLFYGNYMEPDAEPKFYDEGDTYEKLEKLMKYYLREYNSFSSTPMDLVMFRFAIEHVSRVSRVLQMPRGNILMVGMGGSGRRSSARLAAYIADCRLMTVQVSKSYTITDWRDDLKKILMSASFNLNHTVFLFSDAQATDEGYVEDINGILNTGDLPNLYQLEDKATIMENMANVA----KQLGKILDTLPSEVYAYYIDRIREQLHIALAFSPIGDSFKERIRVYPSLINCCTIDWYMPWPEEALSRVGVYFVSSMNLNRPHGEETQEPVQSKDAADPDEEEVRRETVGVEREQTQLEADLVDCVMYFHQSVVDASEKCYLELNRRNYVTPSAYLELLKAFRTFYTRKLDEITRLRDRYTTGLEKLDFAAGQVGEMQTNLYDLQPKLKVLSEETDRIMVNIERETAEAEKKKEVVGADEAAANEAAAAAQAIKDDCETDLAEAIPAMEAALEALNTLKPADIFIVKSMKNPPYGVKLTMEAVCVIRGIKPDRKPDPS-GHMVEDYWGPSMRMLSDMKFLDSLKTFDKDNIPPPIIKRIREKYIADRDFVPEKIKAASMACEGICRWVRAMDVYDKVARIVMPKKAALAEAEGELSQQMEKLNAKRAELQVILDKLQKLNDFFAEKSREKKRLEDEIDNCEKKLNRAEKLLGGLGGEKTRWSEAAKNLHESISNIVGDVLLAGGCTAYLGYFTTEYRVNILDDWNALCKRKHIPSSETFSLATTLGHPMTIRAWSLAGLPADNFSVENGIIVTNSSRYSLLIDPQVQANKWIKNMEKNNNLKVIKQSDANYMQVLELAITFGQPVLIENVGEKLDSNLTPILEKNVIKHKGGLFIKSGDQMIEYNPNFRLYITTCLRNPRYPPEVMVMVTVLNFMITEQGLREQLLAIVVAHERPDLQEKKEQLIIESARNRDALYTIESKILEVLSTSEGNVLEDENAINILSSSKILSEDIQEKQVIAVATEIEIDAARQQYIPVSKHSAILFFCISELANVDPMYQYSLSWFLNLFVNTILKAPKSDQLSERLKNLNDYFTKSIYTNVCRSLFEKDKLVISLVMCLGILVSQGRVEKAALLFFLTGGIGYKTIPPNPLGAWLPDKSWASVCKAADLEGLKNLPQMMETYSDEWHNFYDASNPD 3706          

HSP 2 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 359/666 (53.90%), Postives = 473/666 (71.02%), Query Frame = 2
Query: 9416 LIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGC-----NDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLT-----LPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKP--NKLVAIDRSST-------YLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LIV++ +RPDK+VPAV++FIT NL ++F++PPPFDL +SF DS+   PL+F+LS G+DPM +L  F + +     K+ +ISLGQGQGP A KMI +A + G WVVLQNCH+A SWM  LE+IC +  + +  + ++RLW TSYPS  FPVS+LQN VKMTNEPPKGLRAN+ RS+ +DP+  +KFF        + N  W   +F L FFHA+VQERR+FGPLGWNIPYEFNESDL+IS+ Q++MF+N    +P     YLTGECNYGGRVTDDKDRRL++SLL + YN + +E++ Y  S SG Y  P   T    IEY+ S P++P+PEVYGLHENADI ++ +ETN L SG+LLT        +AS  G + ED    +   +LK+LPE F+++ + K YPV+Y+ SMNTVLRQELIRFN+L+S +R +L+N+ KA+ G + M  ELE    SM+IGK+P  W  KSYPSLKPLGSYV+DL+ RL FF +WI+N  P  +WISGFYFTQSF+TGVLQN++RK    ID +  EF +T F+    +   P+ GA + G+F+EGARW+++ K + ES  K+LF+++P+I+L+P    L  + RS+        Y CPVYKTS RRG LSTTGHSTNFV+ + L  +    HWINRG A LCQLDD
Sbjct: 3723 LIVIKSLRPDKLVPAVRAFITRNLDRSFVEPPPFDLAASFADSSPKIPLVFLLSAGSDPMASLFMFAKQRNM-YDKLKTISLGQGQGPRAEKMIMEAARHGQWVVLQNCHVAISWMGDLERICNDTTLTDGANHDYRLWCTSYPSAVFPVSVLQNSVKMTNEPPKGLRANMHRSFTSDPLMRDKFFTNAFLFSDSANKCWLRGVFALVFFHAVVQERREFGPLGWNIPYEFNESDLKISLLQLKMFINQSQSIPFRGHVYLTGECNYGGRVTDDKDRRLILSLLNMIYNPNTIEEDNYALSQSGTYRVPLSPTRLNSIEYVSSFPLSPHPEVYGLHENADINRNVKETNALISGVLLTQTDLMASVKASSSGGAKEDPAIAICKQVLKQLPEEFNIDEVSKTYPVIYTNSMNTVLRQELIRFNRLLSYIRKSLVNVGKAVVGQIAMIPELERTHASMVIGKLPADWLKKSYPSLKPLGSYVSDLLARLAFFQEWIDNGEPMVYWISGFYFTQSFITGVLQNYSRKNRFQIDMILIEFAVTKFE--VQVPGTPDIGAYIRGIFIEGARWNRKTKEVDESFSKVLFDTLPVIYLRPVLKALEDLPRSTAGGEPETIYDCPVYKTSERRGVLSTTGHSTNFVMYLQLRCSRKPMHWINRGTACLCQLDD 4385          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 2403.63 bits (6228), Expect = 0.000e+0
Identity = 1260/2844 (44.30%), Postives = 1827/2844 (64.24%), Query Frame = 1
Query: 1003 VEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDE---LQGQIDDCK---DQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFN--------DNPGAQ-----------------KVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNG-----LKDYLIKCNSQIDDIVKLVRG-NLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQE---YKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKP-KSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE---HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK----VVDEDVRGLIFGDYMTDDKI-----YDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEM-DENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            + E+ +    IC  ++ I  +  EIP  TE L+   E++      ++  L +  +  ++    +++   +      L     +W   I+++ D   +       Q E+         +E ++++   I++   K +  +++M R  +F D    LQ  ID  K   D +  +NKEE +     +++P L  +   + P++ L +  +++      W  GPF  L    +E    +  K   K  K +         DNP  +                 ++ + +   I  F   + ++  +CNP +++RHW +MS+I GFD+ P   ++L   L  GL   L++ E I   A KE QL   L  M ++W+   F    Y+++GV ILS+LDDIQ LLDDHI+K+  M+GS F+KP E+E++ W +K++ +N+ +D W KVQA +LYL PIFSS+DI+AQMPEEGR F IV+ T+   M   ++ P  +       +L+ L  +N LLE+I  G+++YLEKKRLYFPRFFFL+NDE+LEILSETKDP RV PHL KCFEGI+ LEF     ++ MIS++ ET+  + ++  A A G VEKWL+ VE+ M+ +V+     S   Y   KR  WVL+WP   V+ +S +YW   V   +    G     + ++  + + +++DIV LVR   +++  RIT+ +L VIDVHA+DV E++ K +VSS   F+WL+Q+RYY    + WV  I+  +P+ NEYLGN+ RLVITPLTDRCYRTL+ A +L+L GAPEGPAGTGKTET KDLAKA+A QC VFNCSDGLDYKAMGKFFKGLA  GAWACFDEFNRIELEVLSVVAQQI  I  A+     +F+FEGTEL+LNP C + ITMNPGYAGR ELPDNLKVLFRSVAMMVPDYA+IGEISLYS GFVDAR LA KIV TYRLCSEQLSSQ+HYDYGMRAVK+VL+A GN++++ PD E E ILLL+++ DVNLPKFLS D+PLFEGIISD+FPG+ LP  D+ +  S  K    +  L+    F+ K++Q YEMI+VRHG M+VGEP  GK++  Q LA  L+ +      +      V  GI+NPK+ITM QLYG FDP+S+EWTDG++A +FR+FA+     RKW++FDGPVDAVWIENMNTVLDDNKKLCL SGE+I MSN+M+++FE  DL QASPATVSRCGMIYMEP+ LGWR F +S+++   P   +E+ +  +  L +WL+ PC  F+R  C + I+  E + ++    LF   + E     ++EE    ED        + +  + Q   LF+ +W +G  L  + R KFDVF ++L    +P  P+P   +++T     P    + D+ F  K  G W+ W +   R  +  +       +I+PT +TAR  + L + + H+K +++VGPTGTGK+V + NYL+ +L K+ +    I F+   SANQ QD++++KL + ++G+YGPP   + V+FVDD+NMP KE YGAQPP+ELLRQ+ D+GH +D KD+SK+++ + L+++A G PGG R DV +R + HFNV  +N F+D++M RIF  +    F    HG D VF    ++ VS+T ++YK   +    TP+KSHY+FNLRD SRV+ G  LV   ++ + +  +R+W HE  RVFYDRL  + DR   FD +       FK  +E +     + G        E    ++FG Y  +D +     Y+E+ S++       T LDDYNS  +  M + +F FA++H++R+CR++      AL++G+GGSGRQS T++A  M     F  EIT+NYG N+W DD+K +L +AG   K   FL ++NQIK E F++DI  LLN G+VPN++P DEK E+LE ++ AA    +   R ID + + ++++F++R KQ LH++L+ SPIGDA R R+R++PSL+NCCTIDW+ +WPE+AL+M+A   L D+ +  E+ + AI+  C+++H +  + +  F     R+ Y T  S++ELI++F+ L+  K++E +  K RY+ GL+ L  A+  +  MQ +L ALQP+L+  +  + K++ ++ ++T+   A  E +  ++E A+V+A  +Q +K DCE DLA+A+P+L DA+A+L+TLK  DITLV+SMKNPP +IKLVM AVC++ G  PER PD ++GKM++DYW  S +LLG+  FL  LK F  D++  + +K++ +++IP  DFDPK+V  AS+A +GLC+WIIA+  YD  AK+VAPKK KLA AEKE   T++ LA+K+A    +E K+  L  +LD+     ++ E++ E C  KL RAE LIGGLGGEKSRW +AA+ L E Y ++ GDVL+S  ++AYL    + +R+  V+ W KK  ++ IPCS  + + D+LG  V I+ W + GLP D FS +N II  NS+R+ L IDPQ QAN W+KNME+ NRL+ +K   +N+++ +  ++++GTPV++ENV EEL   L+PIL +  F Q G+ ++ LG++V+  N +F+ Y+T  LRNPH+LPE   KV ++NF +T   L DQLL IV AKE+P+L+E +  L  E+A NK  L++ E+ IL+ LS+  G+ILENE AI +L+ SK LS++I EKQ  A+ T  +I+  R  YKPVAVH SIL++ I+D+ NIDPMYQ+SLNW+INL++ SIE + KS+DL  RI++L D FT ++Y N+CRS+FE  KLL+S  +   +L G  +V    +  L+T      N  PNP P W+++ +W  ++R  EL  ++G+ +HF+++   W+++YD  SPE
Sbjct:  495 IREHIKAEVDICDEFEKIKYRALEIPKSTEELLESAEYMIHVKKDKIAELTDRIQYCLQVGTNIVELTEMSKYHFDLTIKTINWIKDINDICDYNAS-------QQEQFKFTFEEHLQEVIKKLNSDIDELLPK-LTVIDDMSRPDKFRDSYIILQNFIDQLKTFDDYVAWINKEEKLFKVALTEYPKLDIIKTFVYPFAELMKCCIEWQRYLSVWNDGPFEYLEPQFVERTTDDYLKEFQKNQKYYRVKIKQDLIDNPVCKFKGQTEDPDPAKHPVPLRLCTSMIQSIKDFTTGVFIVNTMCNPALRKRHWKEMSEIAGFDVTPDAGTTLRKILNSGLDPILDQFEIISIGANKELQLWNALQAMIKEWETRVFPYGPYKETGVQILSSLDDIQALLDDHILKTLVMRGSAFMKPCEEEVRAWYEKIMRVNETLDQWGKVQANYLYLLPIFSSKDIVAQMPEEGRLFVIVEQTYTRNMGLVLRQPLVMETAPVSGLLESLQKANELLEDIATGVSNYLEKKRLYFPRFFFLANDEMLEILSETKDPLRVLPHLSKCFEGINSLEFDAAKNVLAMISSDKETIEFIEQVSTAAAGGSVEKWLIGVEDEMLKAVRYQNELSFAHYPKVKRHEWVLEWPQMTVLAISQVYWASRVHGCLRRTFGGNMTIMMNFFQELSKELNDIVTLVRSPKISNLNRITIKSLIVIDVHAKDVSEDLIKNKVSSEFDFQWLAQMRYYWEDDKTWVRIINATVPFANEYLGNSDRLVITPLTDRCYRTLVGAYQLHLNGAPEGPAGTGKTETTKDLAKALAVQCKVFNCSDGLDYKAMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILLIIQAVRSNATKFMFEGTELTLNPACYVCITMNPGYAGRSELPDNLKVLFRSVAMMVPDYAMIGEISLYSYGFVDARKLAVKIVTTYRLCSEQLSSQNHYDYGMRAVKTVLSACGNIKKQYPD-EVEDILLLRSLIDVNLPKFLSFDVPLFEGIISDIFPGIKLPHIDYSLVESEFKRVCLEEVLEPAPSFLLKVIQTYEMIIVRHGFMLVGEPLAGKSKTLQVLAKVLSALKIKAPQKSNYFQHVQMGIMNPKSITMNQLYGSFDPISYEWTDGLVAKIFRDFAMTPTPDRKWVIFDGPVDAVWIENMNTVLDDNKKLCLTSGEVITMSNEMSMVFEVMDLAQASPATVSRCGMIYMEPSTLGWRAFAKSWLKKADPRWADEEGVPYVMALMQWLLPPCQTFVRRFCSQFIKPGEFNCMLTTFDLFDMQIAE-----AIEE--NPEDYQ------KYLQTYFQAAILFALIWGVGGVLDTASREKFDVFLKKL-WDTDPPPPEPLGKMEITP----PTEGLLVDYVFLYKQRGAWRYWPDLAKRMDVEETKTG----VIVPTVDTARYIHLLKMHVEHKKRMLLVGPTGTGKTVYVQNYLMNKLDKEVFETGFITFTVMISANQCQDLLISKLQKWKRGIYGPPKGMQSVLFVDDMNMPVKEVYGAQPPLELLRQFFDYGHVYDLKDSSKVYIHNVLIMAACGLPGGSRQDVYARFLNHFNVYSINTFSDDSMFRIFLNVALNGFRRAGHGQD-VFVVTNQI-VSATQSIYKSVQSEIRATPSKSHYIFNLRDISRVVTGCTLVRKESVSDKKIFVRVWYHEAMRVFYDRLVDDVDRKWMFDKLNECLKANFKDKVETVFERYCVQGPDEAVFTMEAASNILFGVYFDEDSVPDERRYEEVPSVEVFLNLALTSLDDYNSTRRNKMDITLFTFALQHLNRICRIISIQGASALIIGLGGSGRQSLTKLATNMVQTSFFQPEITKNYGANDWHDDIKAILKEAGGMNKHTTFLITENQIKMELFLQDIDCLLNQGEVPNIFPIDEKQEVLEMVRLAA----QGGNRNIDVSALQVFSFFVDRCKQKLHMILSFSPIGDALRTRVRLYPSLVNCCTIDWYDSWPEEALQMIAKMSLVDVNVPSEDIKLAIMDTCQYFHTTAARSTRAFCQMTGRHIYQTNASFIELIRSFQTLIERKQSETMLAKMRYIGGLDTLAQAAAAISIMQRDLNALQPKLVALAESSRKMMLEINKETLAASAAAEQVKRDEEVASVQAEAAQVLKQDCERDLAKAIPVLEDALAALNTLKPADITLVKSMKNPPPVIKLVMAAVCVIKGIPPERIPDPASGKMVQDYWGPSKRLLGEMNFLPGLKEFDKDNIPTEIVKRIHKEFIPNKDFDPKVVAKASSAAKGLCQWIIAMMMYDEVAKVVAPKKAKLAGAEKEYADTMEFLAQKRALALALEEKVALLNIELDKANAEMQKTEEHAESCRNKLLRAEALIGGLGGEKSRWNKAAEDLQELYDHLPGDVLISCGIIAYLSAVNLQYRSECVKDWFKKVTDLKIPCSSHYSITDVLGLEVTIQNWQLDGLPNDEFSSENAIISANSSRYSLFIDPQAQANNWLKNMERKNRLNCVKFNQSNYMKVIAEALEYGTPVIIENVQEELEVPLDPILMRQTFVQGGIKHISLGESVVPVNPNFRLYMTCNLRNPHFLPETFNKVTVINFALTQNALMDQLLSIVVAKERPDLQELRITLTTEAAANKGALRDAENMILKTLSAG-GDILENEAAIQILADSKGLSKDIVEKQEAAKETVAKIEAFRLNYKPVAVHSSILYYSITDLPNIDPMYQFSLNWYINLYMYSIETANKSKDLPRRIKFLVDGFTRNLYNNVCRSIFEKDKLLYSFILTARILLGTGQVEMRHFAHLVTNAKESTNIPPNPDPTWITETVWLNVLRLEELKELRGIVDHFKSHLHAWQAIYDHSSPE 3300          

HSP 2 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 323/656 (49.24%), Postives = 441/656 (67.23%), Query Frame = 2
Query: 9404 GLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSR-WHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYI-RSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGE---GKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
              +K+IVL+ +RPD +  AV+ FI +++G  ++ PP FD+  S+ DS   +PL+F+LSPGADP+ +LL F E  G   +   SISLGQGQGPIA  +I  A + G WV LQNCHLA SWM  LE + E +    NT  NFR+WLT+YP+  FPV+ILQNGVKMTNEPP GL+ NL+RSY ++PI+D +F+ GC    R +  +L+G+CFFHA+VQERRK+GPLGWNI Y FNESDL+ISV Q+ M LN Y  +P +A++YLT ECNYGGRVTD+ DRRL++++L  F NA  V   +Y F+    Y  P     +  + Y+  +LP    PEVYGLH N+ IT+D Q T  L   ++L L  +A+G    G S E  I +    I +++P + D+E   ++YPV Y+ESMNTV+ QE+ RF KL   +R+T  +L   IKG++VM  +LE V  +M   ++P  W +KSYP LKPLGSYV DL +RLN+ HDW  +  P TFW+SGF+FTQ+FLTG +QNFARKY IPID + F++++   +  T     P+DG    GL+LEGARW+     L E  PK+L  ++P+I+ +P  LV +   S Y CP+YKT+ R+GTLSTTGHSTN+V+ + L  ++  +HW+ R VA +CQ  D
Sbjct: 3314 AFEKIIVLKALRPDSVFLAVRLFIAESIGDQYVTPPEFDISKSYADSTALTPLVFILSPGADPLGSLLAFAEKMGQEET-FQSISLGQGQGPIATALIKNAQEMGYWVCLQNCHLAASWMPYLEYLWENMDT-FNTTPNFRIWLTAYPTPQFPVTILQNGVKMTNEPPTGLKENLMRSYNSEPINDYEFYTGCAKQDRAFTRLLYGICFFHAVVQERRKYGPLGWNIAYGFNESDLQISVLQLSMLLNQYDHVPYDAISYLTSECNYGGRVTDNWDRRLIVTILADFCNAQAVTDNRYRFASDDRYILPRKTEHREILRYLDENLPSLAPPEVYGLHANSGITRDLQTTKTLLDSMILLLGSEAAGSAGAGVSVEQVILDTIKQIEREMPADMDIEAAAEKYPVDYNESMNTVVVQEMERFLKLQKEIRTTCRDLAMGIKGIIVMTPDLENVMTAMKFNRIPTKWMSKSYPCLKPLGSYVQDLYKRLNWLHDWHHHGKPPTFWLSGFFFTQAFLTGAMQNFARKYKIPIDTLTFDYDVLKVETKTS---PPDDGVYCNGLYLEGARWEWRENTLVEQFPKVLIYAMPVIFFRPVGLVDVVEGSRYRCPLYKTAERKGTLSTTGHSTNYVVPLLLNTHVKASHWVKRSVALICQTSD 3964          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 1771.9 bits (4588), Expect = 0.000e+0
Identity = 1005/2648 (37.95%), Postives = 1539/2648 (58.12%), Query Frame = 1
Query: 1447 LDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFD--------IKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDS-GVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQL----------EIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTE--------AITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQE---YKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAP-MSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKID-STPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMV 9273
            LD +  +++ C++  ++    +     + + +  +A+   ++     L+RT  D+      W+   F+ LN +    D+VE+N    K   QF        +   ++   + FK  LPV+  + NP ++ RHW ++ D++           I+  E+    D +  G     E L +I + A  E QLE  L  ++  WKE +  +  + D+  V IL+  +++Q +LDD  +   T+  S F+ P + ++  W + +       + W+  Q  W+YLE IF+S DI  Q+P E + F  VD ++KE + ++ K    L      D+ K L ++N LL+ I +GL  YLE KR+ FPRF+FLSNDELLEIL++T+ PQ VQPHL+KCF+ I+RLEF  +           +I+  +S EGE L     +   KA+G VE+WL +VE  M  S K+ +    + Y   +R  W  D P Q+V+ VS + W  ++           + +   +  + IKC   +  +  L R N++S  R  L AL  IDVHA+D V  + + +V   + F WL  LR+Y  D    V+    +  +PY  EYLG    LV+TPLTDRCY  LM A +++LGGAP GPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYK MG+FF GLAQ GAW CFDEFNRI++EVLSV+AQQ+ +I+ A A  +KRF+FEG E+ +N +C +FITMNPGYAGR ELPDNLK LFR ++MMVPDYALI E+ LYS GF D + LA K+V  Y+LCS+QLS Q+HYD+GMRAVKSVL  AG L++  P+ + E I L+ A+ D N+PKFL+ D  LF GI+SDLFPGV+LP +      ++++  L ++ LQ     I K LQ+YE + VR G+M+VG P GG                 +  +Q+     V    +NPKA+TM +LYG  D  + EW DG+L +  R     +D+  +W+M DGPVDAVWIEN+NTVLDDNK LCL + E I+++  ++++FE  DL QASPATVSRCGM+Y++P  LGW P ++++ E ++   L     +    LF    D  L   R   K+ + T  IH V+  +      L+  + + +V+ +   E+   ++++          +F ++ +W+I S+L ++ +  F+  +              K+I    + + P   T++++  + +   +W  W++ + +      P+    ++ +PT +T +  Y  DL      PV+V G TG GK+VL  + + RL +   +   +NFSA+TS+N+TQ++I   L++R+K   G P  K  +VF+DD+NMP  + YGA P IELLRQ++D   ++D++      ++D +L  A  PPGGGRN ++ R +RHF +  + + N+ T+ +IF  I+   F   F      L + +V++ ++VY +     LPTP KSHY+FNLRD S+ I+G+L   + +     +++RL+ HE  RVF+DRL   ED+  F  ++K    D F             +  V++++   ++FGD+M      +++IYDEI     L   +  ++ DYNS++    M L++FQ AMEH  R+ R+L+ D G+ LLVG+ G G+QS TR+A+ + ++  + IE+ RNY  N + +DL+ L   AG D +P+ FL  D+QI +E F+EDI+ +LN+G+VPNL+  DE  +I+   ++          RK D  T   +Y +FI RV+ NLH+V++MSP+GDAFR R RMFPSL+NC TIDWF +WP +AL  VA   L  I      R ++     F H++V   S +F   ++R+ Y TP+SYLEL+K ++ LL  K  E+I  + R   GL KL   ++ +  M  EL+ + P+L   SA    L+  + ++T + +A ++ +  ++ +A  KAA +Q I +D   DL  AMP LR+A  +L  L + DI  ++S   PP L++  MEAVCI+LG KP               W S+  ++ D  F+ RL  +  + +    +KK++ KYI   DF P      S   + +  W+I++DK+    K+V PK  +   AE EL+  +  L +K+ +L  VEAK+Q L D L+E Q+  + ++DN++L   +++RA +L   L  E+ RW E  K L+     + GDVL++AA VAYLG F+  +R  +   W  KC E  IP S  F ++ +LG+P ++R WN+ GLP D+ SI+NGI    + RW L IDPQ QAN+WI+NME++N L +IK+TD+  +R LEN+++ G PVLLE + E ++P L PILQ+  +R +G  YL+LGD VI+Y+ +FK Y+TT+L NPHYLPE+   V L+NF++T  GLEDQLL  + A E P +E ++N L+++   +K++L  LED++L++L +S+GNIL++E  +  L+ +K  S  I+ +    E T+  I  +R  Y+ +A  G+IL+F ++ +A IDPMYQYSL +F  +F   +      + +E RI  L      +++ NI R LFENHK++FS  + +++ + + +V +E + FL  G V        PA   MS   W   +
Sbjct:  789 LDSMLERLNKCRETADEFLGYQKEFQIDLTMYDEMASGFYDIRMRQNLYRTWSDWEESLAEWIVSDFNTLNVV----DMVELNSKTIKNCMQFQKYLPENNIVPVLQKSAEAFKEKLPVIGYLRNPNLRARHWAEIEDLLNRKFFQEKDILIQTYEDVHAFDDVAIG-----EALMQISSQATGEVQLENMLKGIETTWKETELSIVPHHDAKDVFILAGTEELQAVLDDSNVNINTIAASKFVGPIKSKVDEWINAMDQFAKTFESWMDCQGAWIYLEAIFASADIQRQLPHEAKMFFTVDKSFKETVRQAKKVALALPTMSSVDVHKVLVENNRLLDLISRGLEAYLEVKRVVFPRFYFLSNDELLEILAQTRIPQAVQPHLRKCFDAIYRLEFGSKEGGDGKMVATNDIVAFLSPEGEKLQFGKGL---KARGAVEEWLSKVEEAMFVSCKRYMRFGYQCYPAKEREDWFQDHPNQVVLTVSQVQWAADIHRIYEGKERNPLNILEKMAKFEIKCLKDLGALAALTRKNISSLLRKILCALITIDVHAKDSVRMLIEKEVCKASDFNWLKMLRFYWADETETVYSRMAAANIPYYYEYLGAGGVLVLTPLTDRCYLCLMGAFQMDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKMMGRFFSGLAQCGAWCCFDEFNRIDIEVLSVIAQQLITIRTAKAMRVKRFIFEGREIKINRSCCVFITMNPGYAGRTELPDNLKALFRPISMMVPDYALISEVILYSEGFEDPKILARKMVQMYQLCSQQLSQQNHYDFGMRAVKSVLVMAGALKRASPN-QREDITLIAALRDSNIPKFLADDAVLFRGILSDLFPGVELPDSQHPHLEASLRLGLRQKNLQAVPTTIRKCLQLYETMCVRWGVMLVG-PTGGGKSVVLHALEFALSHLFENEVQDPNFRPVVIQTMNPKAVTMNELYGYVDLKTLEWQDGLLGLAVRTATTVEDEIHQWIMCDGPVDAVWIENLNTVLDDNKMLCLANSERIKLTAWIHMLFEVQDLLQASPATVSRCGMVYVDPGDLGWIPLIDTWREVDMKHKLPAPLAEFCYQLFVGYFDKALKIER---KRAVYT--IHQVLGSKVRLCCELNSAQFE-AVKWSAMSEEQGKELVTK---------IFAWAVLWAIASNLKDAEKVSFEEQW-------------SKAIAQHPNMTLPN-FTLWNYRIDLEKM-DWGSWIDIMAK--FVFDPETSYYDMQVPTVDTTKYGYVSDLLFKRGMPVMVTGDTGVGKTVLAISCMKRLSQGNVIPVILNFSAQTSSNRTQEMIEGPLEKRKKTQLGAPVGKTVIVFIDDVNMPKLDTYGASPAIELLRQFLDFKGFYDREKLYWKEILDVVLGCACAPPGGGRNPLTPRFVRHFALFSLPKPNEETLTQIFNGILR-GFLQTFSSAVRALSEPMVNACVDVYMRVATVMLPTPDKSHYIFNLRDLSKCIQGILQASNLHYNQENQILRLFYHETTRVFHDRLINIEDKNIFKALMKEVCMDHF-------------NRPVINDNEPPILFGDFMVFGKPKNERIYDEIRDHTKLESVLNDYIADYNSVAVGKQMKLILFQDAMEHTVRLARLLRSDRGNGLLVGVAGMGKQSLTRLASHVNEYNCWQIEMRRNYDLNAFHEDLRVLYRIAGIDNQPVTFLLIDSQIVEEEFLEDINNILNSGEVPNLFEGDEFEKIILDARDGC-----NENRKDDPCTRDDIYKFFINRVRNNLHVVMSMSPVGDAFRRRCRMFPSLVNCTTIDWFTSWPTEALYSVALGLLTKIAPKMEDRISLASTTVFMHKTVEDASVKFYKEMKRHYYTTPSSYLELLKLYQNLLKIKNMEIIAKRKRIANGLNKLLETNEVIAVMGKELEVMVPQLDEKSAMMKSLVDNLTKETKQADAVKQSVLEDEMNAKEKAAVAQAISEDAGKDLEIAMPALREAEEALKGLTKADINELKSFTTPPALVQFCMEAVCILLGVKPT--------------WASAKAIMADINFIKRLFEYDKEHMKEDTLKKVK-KYIDHKDFVPAKFEKVSKVAKSMSMWVISMDKFSKVYKVVEPKIKRKEAAEAELKEVMTVLRQKQKELAAVEAKIQGLRDSLEEKQREFQVIQDNVDLTYGRINRAGRLTSALSDEQVRWRETVKSLTGDLACVPGDVLVAAACVAYLGAFSHEYRRDMSALWVSKCREHKIPSSPEFNLLKVLGDPYEMRQWNVDGLPKDNISIENGIYATRALRWALMIDPQEQANRWIRNMERANNLQVIKMTDSTMMRVLENAVRQGYPVLLEEINETIDPSLRPILQRETYRFEGRTYLKLGDMVIDYDDNFKLYMTTKLPNPHYLPEVCINVTLVNFLVTESGLEDQLLADIVAIELPAMEIQRNDLVVKINSDKQQLLALEDKVLKLLFNSEGNILDDEELVETLNDAKETSLIIAARLIDTEETEKVITASRERYRILASRGAILYFVVAGLAEIDPMYQYSLKYFTQVFCNVLRLDHPPQSVEVRISTLMTDELRAIFDNISRGLFENHKIIFSFLLALSVERQEGRVTEEEFLFLSRGPVGNIRTKIQPAKIKMSQIEWDSCI 3356          

HSP 2 Score: 488.804 bits (1257), Expect = 8.802e-138
Identity = 270/676 (39.94%), Postives = 403/676 (59.62%), Query Frame = 2
Query: 9392 RLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSS-FNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIP-ENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYT--ELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPP-DGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSI-QELADDILKKLPENFDLEMIMKRYPVMYSE----SMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEI------------TSFDNSTDIKVRPEDGAC------VYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVA 11335
            + L+   KL+ +   R  + +  V  ++   +G+ F +      LSS + D++  +PLIFVLS G+DPM+  LKF     +   K  SISLGQGQGP+A  +I+++++ G WV LQNCHLATS+M++LE I   + +     H +FRL+L+S P + FP+S+LQN VK+TNEPPKG++AN+  + L D   D  FF+    N  W  ++FGLC FHA++ ERRKFGPLGWNI YEF+ESD    ++ +  F++     E+P EA+ Y+ G+  +GGRVTD  D R L ++L IF +  I++ + Y +     YY  P   T   Y  Y++  P+  +PE++G+++NA+I    +ET    + +LL  PR A+ EG++ E+ I Q+    I K L      E I     V+ ++    S+  VL QE+ RFN  + ++  +L+NL KAIKGLVVM+ ELE VF ++L  +VP  WA +S+ S+KPL SY++D  +R++F   W EN  P ++WISGF+F QSFLTGVLQ +AR+  +PID +  +F++               +N +D K+      C      V+G+F+E ARWD     L ++    LF+ +P++  KP   + I  +  Y  P+YKT  R G LSTTGHSTNF+L + L ++     WI RG A
Sbjct: 3403 KRLRVFHKLMFISAFRKPRFLLNVVCYLQSTVGKYFTEASGGTQLSSVYLDTSAVTPLIFVLSTGSDPMSGFLKFTTQMQFT-DKYYSISLGQGQGPLAENLIEKSLRLGHWVFLQNCHLATSFMQTLETIVRNLTLGITKAHVDFRLYLSSMPIQTFPISVLQNSVKITNEPPKGIKANVFGA-LTDLKQD--FFEQHIQNGNWRAIVFGLCMFHAVLLERRKFGPLGWNITYEFSESDRECGLKTLDFFIDREVLDEIPWEAILYINGDITWGGRVTDYWDLRCLRTILTIFSSKRIIQPD-YKYCRGDSYYRDPRKKTLTEYSAYVQGFPVLEDPEIFGMNQNANIVFQTKETAFFINTLLLGQPRSAADEGQAMENEIAQQTIARIQKALATKIKREPIHDTLSVLDAKGQVPSLTIVLVQEIDRFNIALGIIHDSLVNLSKAIKGLVVMSEELENVFKALLSNQVPASWAKRSFLSIKPLPSYISDFQRRIDFIQQWAENGAPRSYWISGFFFPQSFLTGVLQTYARRRVLPIDSLKIDFDVFERELVQQDFFEMHTNNMSDQKLYGNLPECTDAIINVHGIFIEAARWDLSKGGLCDANFGELFSRMPVVRFKP--CLEISPTVRYEAPLYKTQQRSGVLSTTGHSTNFILAVLLRSHNDPEFWIMRGTA 4071          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 1679.84 bits (4349), Expect = 0.000e+0
Identity = 1000/2692 (37.15%), Postives = 1536/2692 (57.06%), Query Frame = 1
Query: 1429 RRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFL-TYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRD---MLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTE------QLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESY--VITKRGRWVLDWPGQIVICVSCIYWTKEVTEAI---TVPNGLKDYLIKCNSQIDDIVKLV---RGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY-DRGGEVWVC-QISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKL-MRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILG-HLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSI-SKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEM--------DENTREAIVI------------MCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALD--NPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            R  ++FL  +  +I+DC    E L ++ ++ N  Q +   L  +   +     +W    ++    + W KG F ++N   +E+  + + K    L K+F D     ++       +D F+  LP++  + NP ++ERHW+++ D+I  +     ++  ++ +         E +++I   A  E Q+E ++  +   WK+  FE+  Y D G+  +  ++D   LL++H+++   MK + F++PF   +  WE  L  +++ ++  L VQ  WLYLE IF  +DI  Q+PEE ++F  +   ++ + ++  +  + + AT  R    +L R +  +  LE IQ+ L  YLE KR  FPRF+F+SND+LLEIL  +K P  VQ HLKK F+ +++LE         + +  GM S +GE +  +  IY     G  E+WL QVE  M+  +K+++  +  S   ++  R +W+  WPGQ+V+  + I WT E T ++   ++ +  K        QI  + KL    R +L    R+ +  L  +++H RDV+E M K        FEW SQLR+Y  R  E+ V  Q +TE  YG EY GN+ RLVITPLTDRCY TL +AL L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLDYK++GK F GLAQ+G W CFDEFNRI +EVLSVVAQQI SI  A++      +FEG  + L  T  +FITMNPGYAGR ELPDNLK +FR ++MMVPD  +I E  L+S GF + R LA K+   Y L  +QLS Q+HYD+G+R++ ++L  AG  R+++P+T  E I+ L A+ D+N+ +  + D+PLF GI+SD+FPGV LP  D+  F  A+ +   +  LQ     + K+++++E    RH +MI+G+    K+  ++TL      + +        V    +NPKA+ + +LYG+++  + EW DGVL+ + R     ++  +KWL+FDGPVDAVWIENMN+V+DDNK L L++ E I M  +++L+FE  DL  ASPATVSRCGM+Y +    GW+PF+ S+++  L I   ++    +R  F++++   LDF R  CK+ + T+E++ VV L KL      ++     +     +E +           LW    F+F  VWSI SS+ E  R + D F REL                   + FP + T++D+ F   +   +  W + +   S     ++   +II+PTG+T R  Y +   L  E PV++VG  GTGK+    + +    K+++    +N SA+T+A   Q+ I  + ++R K  + P   KR + F+DD NMPAK+ YG+QPP+EL+RQWID+ +WF++K   K+++ +TLL++AMGPPGGGR  +SSR    F +L +   +  T+IRIF T++    E  +      +   +   T+N+Y   I+  LPTP KSHY+FNLRD S+V +G LL     L N +   +RLWVHE +RVF DRL  + D+  F +             I  ILG H  ++   +        FGD+      Y+++  +  L   M+  L++YN+      M+LV F+ A+EHI R+ RV+ Q  GH L +GIGGSGRQ  T++AAF+ +  +F IE+T+ Y   ++R+DLK L    G   +  +F+FS +QI + SF+E  + +L+TG++ NL+ SDE  E+  +++  A    KK G  +  T  A+Y+YFI  V+  LH+ L  SPIG+ FR+ +R +P+L++  T +WF+ WP++AL  VA+ FL    +        DE  RE++VI            +    H SV ++SE     ++RYNYVT  +YL+L+  FKKLL  KR E+ T  NR   GL K+    ++V  M  ELKA   ++ + + + +  ++ +E    E   ++E + AE            E+     ADL   MP++  A+ +LD L + DI+ V+S   PP  I+ VMEAV I+LG++P               W ++ K+L +  FL+ LKNF  D ++ + +K++   Y   P+ +P  V   S AC+ L +WI+A++ Y    +IVAPK+ KL  A K LE     LA  K +L+E++  +++L  QL+E      EL    E   K+L+RA  L+  L GE+ RW E    L   +  + GD L+S A ++YLG F   +R  ++  W     ++ IP +   K+   L + V IR WNI GLP D  S +NG+IV   +RWPL IDPQ QAN WIKNME+ N+L  +     +++R LE +++ G PVLL+NVGE L+  + PIL+++   Q G   L+  D  I YN  F+FYITT++ NPHY PEIS+K  ++NF +   GLE QLLGI+  KEKP LEE+K+ L++  A NKR L +L+++IL +L+ S+G++L+++   + L  S+  S  + E  +IAEVT+VEID  R  YKP +   SILFF + DM+ IDPMY +SL  +I LF  SIE S +++ +  RI+ +N++ + +VYRN CR LFE HKLLFS+ M   +L    K+ +E + F+L GG+ LD     PNPAP W+S++ W  +    ++    G+ + F+ +   W   Y +  PE
Sbjct: 1198 RIALKFLRIIALKIEDCFTFEESLMRDLAVFNVNQPESIDLRKLDFEVRIVKNIWELIFEWQTNWEGWKKGYFWKMNINEMEDTALNLYKEFTTLNKKFYDR--HWEMLEATTKNVDSFRRTLPLITALKNPCMRERHWNRVRDVIHVNFDENSKNFTLELIINLDFQAFSEDIQDISNPATMELQIENSIKNIATIWKKQSFEMAFYHD-GIYRIKNVEDCFQLLEEHMVQISAMKATRFVEPFITIVDYWEKTLSYISETLEKGLTVQRQWLYLENIFQGDDIRKQLPEEAKRFATITEEFRTISSKMFQAKTAVKATNLRPPPFLLNRFSRMDERLELIQRALEIYLEAKRQLFPRFYFISNDDLLEILGNSKRPDLVQTHLKKLFDNLYKLELKRVGKTLSRWQASGMHSDDGEYVEFMMVIY---IDGPSERWLKQVEEYMLVVMKEMLKLTRGSLKKLVGNREKWISLWPGQMVLTTAQIQWTTECTRSLIHCSMVDQKKPLRKLKKKQIKVLSKLSEMSRKDLTKTMRLKVNTLITLEIHGRDVIERMYKSNCKDTGHFEWFSQLRFYWHRESELCVIRQTNTEHWYGYEYTGNSGRLVITPLTDRCYITLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGIWVIVTNCSEGLDYKSIGKNFSGLAQSGCWGCFDEFNRINIEVLSVVAQQIMSIMAALSTKALELMFEGQMIKLKHTVGLFITMNPGYAGRTELPDNLKSMFRPISMMVPDNIIIAENLLFSDGFTNTRNLARKVYTLYELAKQQLSKQYHYDFGLRSMVALLRYAGRKRRQLPNTTEEEIVYL-AMKDMNVARLTANDLPLFNGIMSDIFPGVSLPTIDYSEFNIAIYEEFREAGLQPITIAVKKVIELFETKNSRHSVMIIGDTGTAKSVTWRTLQNCFYRMNSQRFSGWEAVTVYPVNPKALNLAELYGEYNLSTGEWLDGVLSSIMRIICGDEEPTQKWLLFDGPVDAVWIENMNSVMDDNKLLTLVNSERITMPVQVSLLFEVGDLAVASPATVSRCGMVYNDYNDWGWKPFVNSWLQ-RLRI---KEFADFLRIHFDYMVPKILDFKRMRCKEPVRTNELNGVVSLCKLLEIFGTKVNGINPINLELLEEMTR----------LW----FMFCLVWSICSSVDEDSRQRLDSFIREL------------------ESCFPIKDTVFDY-FVDPNERTFLPWDSKL-LSSWKCDFESPFYKIIVPTGDTVRYEYVVSKLLAEEYPVMLVGNVGTGKTSTAISVMEACDKNKFCILAVNMSAQTTAAGLQESIENRTEKRTKTQFVPIGGKRMICFMDDFNMPAKDIYGSQPPLELIRQWIDYKYWFNRKTQQKIYVQNTLLMAAMGPPGGGRQTISSRTQSRFVLLNLTFPSQETIIRIFGTMLCQKLE-SYPNEVREMWLPITLCTINLYVSMISKMLPTPNKSHYLFNLRDISKVFQG-LLRSEKELQNKKNFFLRLWVHECFRVFSDRLVDDSDQFWFVN------------TINDILGKHFEVTFHSLCPSKVPPFFGDFAHPQGFYEDL-QVDFLRTFMKNQLEEYNNFPGMTRMNLVFFREAIEHIVRILRVISQPRGHILNMGIGGSGRQVLTKLAAFILEMAVFQIEVTKKYKTGDFREDLKNLYKVTGIKQRLTIFIFSSDQIAEVSFLEITNNMLSTGEI-NLFKSDEFDELKPELERPA----KKNG--VLLTTEALYSYFILNVRDFLHVALCFSPIGENFRSYIRQYPALLSSTTPNWFRFWPQEALLEVASHFLIGFPLNVVVSGKEDEKHRESLVISTEAILQRDIAYVFSVIHSSVAKMSENMYAEVKRYNYVTSPNYLQLVSGFKKLLEKKRLEVSTASNRLRNGLSKISETQEKVSLMSEELKASSEQVKILARECEDFISMIEIQKSEATEQKEKVDAEAVLIRRDEIICLELAATARADLEVVMPMIDAAVKALDALNKKDISEVKSYGRPPMKIEKVMEAVLILLGKEPT--------------WENAKKVLSESTFLNDLKNFDRDHISDKTLKRI-AIYTKNPELEPDKVAVVSLACKSLMQWIMAIENYGKVYRIVAPKQEKLDSAMKSLEEKQAALAAAKKKLEELQVVIEELYRQLEEKTNLLNELRAKEERLRKQLERAIILVESLSGERERWIETVNQLDLSFEKLPGDCLLSVAFMSYLGAFDTKYREELLVKWSLLIKDLLIPATLELKVTYFLVDAVSIREWNIQGLPADDLSTENGVIVTQGSRWPLIIDPQMQANNWIKNMEERNQLMTLDFGMADYLRQLERALKEGLPVLLQNVGEYLDQAINPILRQSFTIQSGERLLKFNDKYISYNNSFRFYITTKISNPHYPPEISSKTTIVNFALKQDGLEAQLLGIIVRKEKPALEEQKDELVMTIARNKRTLIDLDNEILRLLNESRGSLLDDDELFSTLQKSRQTSVLVKESLSIAEVTEVEIDAARQEYKPASERASILFFVLMDMSKIDPMYVFSLAAYILLFTQSIERSPRNQLVHERIQNINEYHSYAVYRNTCRGLFERHKLLFSIHMTAKILSNAGKLLEEEYDFILKGGIVLDKLGQAPNPAPWWISEQNWDNITELDKVSGFHGIIDSFEQHYKAWNGWYATTFPE 3807          

HSP 2 Score: 455.677 bits (1171), Expect = 1.277e-127
Identity = 249/655 (38.02%), Postives = 378/655 (57.71%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGIL-LTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIEN-NVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIK-VRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPN-NLSQNHWINRGVASLCQL 11350
            L    K+ VLR +RPD+I   +  FI   LG  ++DPP  DL ++F++S   +PLIFVLSPG DP  +L+   E     A ++ S+SLGQGQ PIA K+I   I+DG WV L NCHL+ SWM +L+K+    +     HK FRLWL+S P  DFP+SILQ  +KMT EPP+G+++N+ R Y N    +    + C++ S++  +LF LCFFH ++ ER+KF  LGWN+ Y FN+SD  +S   + ++LN+Y + P  AL YL    NYGG +TDD DRRLLI+ +  F+    ++  K+  S    Y+ P DG  Q Y++ I+  P    P+ +G H NADI     ET  LF  +L + +   ++   ++ E  + +LA +IL   P+  + E   K   +  +  +  VL QE+ R+NKL+  + + L +L++ I+GLVVM+++LE+++ ++  G+VP  W  K+Y SLKPL ++  DLI R+  F+ W +    P  FW++ + F   F+T VLQ  AR    PIDE+ ++F +   +++   + +R   G  +  LFLEG  W ++N+ L + LP  L   +P+I  KP + +       Y CP Y    R G+         FV+ +DL + N   ++WI RG A L  L
Sbjct: 3819 LTDFQKICVLRSLRPDRISFCLTQFIITKLGPRYVDPPVLDLKATFDESISQTPLIFVLSPGVDPAQSLISLSESVKM-AQRMYSLSLGQGQAPIATKLIMDGIKDGNWVFLANCHLSLSWMPTLDKMIA-TMQSMKLHKKFRLWLSSSPHPDFPISILQTSIKMTTEPPRGIKSNMKRLYNN---INEANMENCSEPSKYKKLLFALCFFHTVLLERKKFLELGWNVIYSFNDSDFEVSEILLLLYLNEYEDTPWGALKYLIAGVNYGGHITDDWDRRLLITYINQFFCDQALQTRKFRLSTLPNYFIPDDGDVQSYLDQIQMFPNFDKPDAFGQHSNADIASLIGETRMLFEALLSMQVQTNSTSSNENGETKVFDLAKEILMNTPDEINYEQTAKIIGINRT-PLEVVLLQEIERYNKLLVDMSTQLRDLRRGIQGLVVMSSDLEDIYLAVSEGRVPLQW-LKAYNSLKPLAAWARDLIHRVGHFNSWAKTLRPPILFWLAAYTFPTGFVTAVLQTSARATKTPIDELSWDFYVFVEEDTAAARIIREGGGVYIRSLFLEGGGWLRKNQCLQDPLPMELICPLPVIHFKPVENLKKRCRGVYQCPAYYYPVRSGS---------FVIAVDLKSGNEKADYWIKRGTALLLSL 4457          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah3 (dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB-GENE-091112-7])

HSP 1 Score: 3761.84 bits (9754), Expect = 0.000e+0
Identity = 1877/3092 (60.71%), Postives = 2412/3092 (78.01%), Query Frame = 1
Query:  106 GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDD---KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
             F + RF+N + L+S  LP+ PG+FE +++R+C      L  +WLPRCA LF+  +  W  LLPK S+   E V+  F  +A+LMS QLR++V ASL D  +F ++H++GN+FG  FDE+Q+T  P+++V+LK+ +P+I ++PS +   +L+ + +  I+ S+ +IPRVE  LFPE+ G+ L LR+V  +E LV   ++   +TF+ NT+GP+ YL VYKKY +LL+++   ++  FLK +H      KKI A Q++  +++ L  +VPLSLF LD   LN D+  + + L ELL +F +EENRE+N+SIC RYD+IT++++  P+ TE LV + ++L+  S   + +L+ E EEAV+RL FLLDY TI  ED+KL +T+ HWP  I +  + + +++ N++++ E  L  R+ + EE L+ + K ++ FK KE +T+EE++ NV+ L+ +   ++    ++E  NKEES+L+ EQSQFPVL T+I    PY +LW TALDF  K++ W+ GPF +LNA T+  D+  M + M+KL K F +     +V    K KIDKFK HLP+L  ICNPG+++RHW+ +S+ +GFD+KP E + L+  +  GL K+ ++LEEIGA+A+KE+ LEK+L KM  +W E+ F    Y+D+G S+LSA+DDIQ+LLDDHIIK+QTM+GSPFIKP E E K WE+KL  M DI+D  L+ Q+ W+YLEPIFSSEDI+AQMPE GRKF IVD  WK ++AES+K+   LVAT Q +ML RL +SN+ LEEIQ+GLN YLE KRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +LEFT  LEI GMIS+E E + ++  IYP KAKGMVEKWLLQVEN M+ S++ VI   +E Y    R +WVL WPGQ+VIC SCI+WT EV++AI   N L  Y+ + N+QI DIV+LVRG L+ G R+TLGAL VIDVHARDVV  +A+  VSS+N F+W+SQLRY+   GEV +  I+T + YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAM KFFKGLAQ+GAWACFDEFNRIE+EVLSVVAQQI SIQ A+ + +K F+FEGTELSLNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDY LIGEISLYSMGF  +R+LA KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNL+ K P+ E+E +LLL+A+ DVN+ KF++QD+PLF+GII+DLFPGV L K D+++   A+ DN+ K KLQ   WFI KI+Q+YEM+LVRHG MIVGEP GGKT AY+ LA AL D+  +G ++E+ VD+ IINPKA+TMGQLYG FDPVSHEW+DGVLA  FR+ A   +D R+W++FDGP+DAVWIENMNTVLDDNKKLCLMSGEIIQMS KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW P  +S++   LP  L ++H  LI DLF WL+ PCLDFI H C  L++TS IH    L +L+  LLDEI      E AE+        +++Q + LWLQ LFLF+ VWS+G ++  + R+KFD F+R L  G    +P+P S+KLTK+N FPER T+YD+ F K+  G W  W  +I +E   I   AK++++IIPT ET+RQ +FL  +L+HE PV++VGPTGTGKSV+ NN+L+ L K+RY    INFSARTSANQTQDIIM+KLDRRRKGV+GPP  K+C+++VDDLNMPAKE YGAQPPIELLRQWIDH HW+DKKDTS+L + D L +SAMGPPGGGRND++ R  RH N+L ++ F+D T+  IFT+I DWHF +GFD  F RLGK++V +TM VYK AI SFLPTP+KSHY+FNLRDF+RVI+GV+L P T++  G+K++RLW+HEVYRVFYDRL   +DR KFF+IVK  T+  FK +++K+LGHL+LSGKV D+ +R L FGDY   D   K YDEIT L  L + M+ +L ++N+ISKAPM+LVMFQFA+EHISR+CRVLKQDNGH LLVGIGGSGRQSAT++A F+ D+E+F IE+T+NY  ++WRD+LK L++K+G + K   FLFSD+QIK E+F+EDI+MLLNTGDVPN++P DE+A+I+EKMQ  A++E    G+KID TP++MYN+FI+RVK NLHIVLAMSPIG+ FRNRLRMFPSLINCCTIDWFQAWP+DALEMVANKFLED++++++ R  +V MCK + ESVR+LSE + + LRR+NYVTPTSYLELI TFK LLN KR+E+  L+NRY+ GL+KL+FAS +V  MQ EL ALQPELI T+ QTD+++ K+E++TVEV+AK+E+++A+++ AN  AA ++ IKD+CE DLAEAMP L  A+A+LDTLK  DIT++++M+NPP  +KLVME++C+M G KPERK D   +GKMIED+W  S K+LGD KFL+ LK F+ D++ P +IKK+REK+I  PDF P ++++ S+ACEGLCKW+ A++ Y+  AK+VAPKK KL  AE+EL + +++L  K+A+L EVE +LQ L D  +   Q+KK+LE NIELC++KL RAE+LIGGLGGEK RWTEAA++L  +Y N+TGDVL+S+A V+YLG FTV +R    + W + C    IP SE F + + LG  V IR+W IAGLPVD FS DNGIIV+NS RWPL IDPQGQANKWIKNM K+N+LS+IKL+D+N+VR+LEN+IQFGTPVLLENVGEEL+ +LEP+L K  F+QQGV+Y++LG+N IEY++DF+FYITT LRNPHYLPE++ KVCLLNFMITP GLEDQLLGIVA KEKPELEEKKN LI+ESA N ++LKE+E+QIL+VLSSS+GNILE+ETAI VLSSSKLLS+EISEKQ IA VT+ EID+TR GY+PVA H SILFFCISD+ANIDPMYQYSL WFINL+L SI +S  S+DL+ RI  + DHFTL VY N+CRSLFE  KLLFSL + + +++GK +V+D +WRFLLTGGVAL+NP+PNPAP W+SDK WSE+VRAS+L  ++GL EH Q N   WK +YDS  P+
Sbjct:  130 SFSSLRFVNSDSLLSADLPLLPGEFEELVQRQCQNTKDELLNTWLPRCASLFVTFKDAWLPLLPKSSSIAPEKVEKLFRCVAALMSLQLRSLVIASLQDLLQFFQLHQDGNDFGERFDEMQYTQRPVLLVKLKLEDPRISFEPSLQGCWELIQQAFTQIISSAHNIPRVECKLFPEI-GETLMLRSVQADEMLVKDIINTARETFQRNTIGPQRYLEVYKKYTHLLDHQ---DIVNFLKTKHSQQGFTKKITAVQNVWKDIASLHATVPLSLFCLDAVNLNQDLCDKAEHLIELLTTFVMEENRELNKSICHRYDEITDRITSKPSSTEELVELNKYLKHTSEVTIHKLRHEIEEAVKRLDFLLDYTTIQAEDMKLFSTVIHWPELILSSLEFSRDKLNNQKDEAEIHLMKRIGQLEETLKGLDKEVDIFKIKEKITLEEIKHNVEKLNNIGISLEAALKEIETSNKEESLLDKEQSQFPVLQTIIAKKQPYDQLWITALDFQTKSEMWMNGPFQQLNAETVSEDLGNMWRTMYKLAKSFPERTAPGRVTENFKKKIDKFKQHLPILTTICNPGLKDRHWEMISNTVGFDVKPDENTPLIKMVELGLSKYSDQLEEIGASASKEYSLEKSLEKMTREWAELHFMFAPYKDTGTSVLSAVDDIQLLLDDHIIKTQTMRGSPFIKPIEAEAKAWEEKLQRMQDILDGMLQCQSMWMYLEPIFSSEDIIAQMPENGRKFAIVDSYWKNIVAESLKDTHVLVATEQPNMLGRLQESNTFLEEIQQGLNSYLETKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLEFTPDLEITGMISSEKEIVPLIETIYPVKAKGMVEKWLLQVENTMLMSIRAVIKQGMEQYSEMPRKKWVLLWPGQVVICASCIFWTSEVSDAIQ-NNTLPSYVEQSNAQITDIVELVRGKLSGGARMTLGALIVIDVHARDVVCKLAQDGVSSLNDFQWISQLRYFWEDGEVMLRMITTAIRYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMSKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAVMRNMKTFMFEGTELSLNPTCCVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYGLIGEISLYSMGFTASRSLAQKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPE-EDEIVLLLRALMDVNMAKFVAQDLPLFQGIITDLFPGVVLAKPDYELLLKALHDNIGKMKLQPVPWFISKIIQVYEMMLVRHGFMIVGEPMGGKTSAYKVLAGALGDLYKEGLIEEFAVDFRIINPKAVTMGQLYGCFDPVSHEWSDGVLATSFRQQAQCTNDDRQWIIFDGPIDAVWIENMNTVLDDNKKLCLMSGEIIQMSPKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWTPLRDSYMN-TLPESLADEHRTLIADLFNWLVQPCLDFIYHECGFLVQTSPIHLAYSLMRLYTCLLDEIFQ----EGAES--------MTSQQMTLWLQSLFLFAVVWSLGGTVNGNSRNKFDTFYRNLLMGTITDHPRPMSVKLTKNNGFPERGTVYDYYFHKQGPGQWNNWTESIAKEDRVIPAGAKVSDLIIPTAETSRQLFFLRTYLSHEVPVLIVGPTGTGKSVINNNFLMSLSKERYTPICINFSARTSANQTQDIIMSKLDRRRKGVFGPPVGKKCIIYVDDLNMPAKEIYGAQPPIELLRQWIDHHHWYDKKDTSRLDIEDVLYMSAMGPPGGGRNDITGRFTRHLNILSIDTFDDETLSNIFTSITDWHFSNGFDASFYRLGKIMVQATMAVYKDAIESFLPTPSKSHYIFNLRDFARVIRGVMLCPSTHMQEGDKVIRLWIHEVYRVFYDRLVDNDDRGKFFNIVKERTSAYFKLSLDKLLGHLTLSGKVEDDSIRSLFFGDYSKPDSANKQYDEITDLSTLTEVMDFYLREFNNISKAPMNLVMFQFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFINDYELFQIELTKNYSMSDWRDNLKHLMLKSGIEGKKTTFLFSDSQIKDEAFVEDINMLLNTGDVPNIFPLDERADIIEKMQGIAQME----GKKIDVTPLSMYNFFIDRVKTNLHIVLAMSPIGEDFRNRLRMFPSLINCCTIDWFQAWPKDALEMVANKFLEDLDLEDDIRIEVVEMCKTFQESVRELSERYYSQLRRHNYVTPTSYLELILTFKALLNSKRSEVNELRNRYIVGLQKLDFASSQVAVMQQELTALQPELIETAKQTDQMMVKIEKETVEVDAKKELVSADEKVANEAAAAAKAIKDECEGDLAEAMPALEAALAALDTLKPADITVLKTMQNPPGPVKLVMESICVMKGIKPERKQDPGGSGKMIEDFWGPSKKILGDMKFLESLKTFNKDNIPPASIKKIREKFIDHPDFQPSVIKSVSSACEGLCKWVRAMEVYERVAKVVAPKKEKLKEAEEELAVQMQKLNVKRAELKEVEDRLQALNDTFEGMIQKKKDLEANIELCSQKLVRAEKLIGGLGGEKDRWTEAARLLGIKYNNLTGDVLLSSATVSYLGAFTVDYRVECQQQWLELCNRKKIPYSEDFTLGNTLGNQVLIRSWQIAGLPVDLFSTDNGIIVSNSRRWPLMIDPQGQANKWIKNMNKANKLSVIKLSDSNYVRSLENAIQFGTPVLLENVGEELDAVLEPVLLKQTFKQQGVEYMKLGENTIEYSRDFRFYITTGLRNPHYLPEVAVKVCLLNFMITPLGLEDQLLGIVATKEKPELEEKKNQLILESAANNKQLKEIENQILQVLSSSEGNILEDETAITVLSSSKLLSEEISEKQKIASVTESEIDETRMGYRPVAEHSSILFFCISDLANIDPMYQYSLTWFINLYLQSIAHSVPSDDLQIRIANILDHFTLRVYYNVCRSLFEKDKLLFSLLLTVGIMQGKGQVDDIVWRFLLTGGVALENPHPNPAPEWLSDKSWSEVVRASQLSRLEGLFEHVQENIALWKQIYDSGHPQ 3198          

HSP 2 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 438/660 (66.36%), Postives = 539/660 (81.67%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LP  +  + G+++++VLRC RPDK+VPAVQ FI DN+G+ +I+PP FDL  S++DSNCCSPLIFVLSPG+DP   LLKF +D G   S+  +ISLGQGQGP+A ++I  A+  G WVVLQNCHLATSWM +LEKICEE+I PENTH +FRLWLTS PS+ FPVS+LQNGVKMTNEPPKGLRANLLRSYL+DPISD  FF+       W  +LFGLCFFHALVQERR FGPLGWNIPYEFNESDLRIS+RQ+QMFL++Y E+PLEALTYLTGECNYGGRVTDDKDRRLL+SLL IFY+  ++++++Y      +YY P     Q Y++YIR+LPI+  PEV+GLH NA+ITKDNQETNQL  G+LLTLPRQ +   KSP++ + ELA+ +L KLP +FD+EM+  +YP++Y ESMNTVLRQELIRFN+L  VVRS+L+N QKA++G VVM++ELE VFNS+L+GKVP  WAAKSYPSLKPLGSYV+D + RL F  DWI+N  PS FW+S FYFTQSFLTGV QNFARKYTIPID +GFEFE+      T ++ +PEDGA + GLFLEGARW++E+ ++GES+PK+LF+S+PIIWLKP +       + Y+CPVYKTSARRGTLSTTGHSTN+VL+I+LP++  Q HW+NRGVA LCQLD+
Sbjct: 3202 LPGKWHTVVGMERMVVLRCFRPDKLVPAVQKFIVDNIGRAYIEPPTFDLAESYSDSNCCSPLIFVLSPGSDPTAGLLKFADDLGMGGSRTQTISLGQGQGPVAEQLIKAALSVGHWVVLQNCHLATSWMPTLEKICEEVITPENTHTSFRLWLTSQPSDKFPVSVLQNGVKMTNEPPKGLRANLLRSYLSDPISDPTFFNSSARQEIWQKLLFGLCFFHALVQERRTFGPLGWNIPYEFNESDLRISIRQIQMFLDEYEEVPLEALTYLTGECNYGGRVTDDKDRRLLMSLLSIFYSWQLIQQDQYRVCEGDLYYVPSHAPYQSYVDYIRNLPISAEPEVFGLHSNANITKDNQETNQLLDGVLLTLPRQTNSGAKSPQEVVDELAEGMLAKLPCDFDIEMVTNKYPLLYEESMNTVLRQELIRFNRLSKVVRSSLLNTQKALRGQVVMSSELENVFNSLLVGKVPAMWAAKSYPSLKPLGSYVSDFLARLQFLQDWIDNGPPSVFWVSAFYFTQSFLTGVSQNFARKYTIPIDYIGFEFEVCK--QETHMEEKPEDGAYIRGLFLEGARWNREHMVIGESVPKVLFDSLPIIWLKPGESATFLHQNVYVCPVYKTSARRGTLSTTGHSTNYVLSIELPSDQPQKHWVNRGVACLCQLDN 3859          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 3155.54 bits (8180), Expect = 0.000e+0
Identity = 1606/3111 (51.62%), Postives = 2175/3111 (69.91%), Query Frame = 1
Query:  106 GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLF--LRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXX-XXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEE-SSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITV-PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRE-LTGGINPL---------YPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF--EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
             F   R I++    SE   M+   F+ ++ +       +L  +W+P   +++   R    +L+P  S+     +++F+  +A+LM++QL+++   S+ D+T  I  + +          ++  + P  ++ L + +  I ++P FK+ +  ++  Y  +++S   IPRVE  L+ E  G      L+ +I  E ++ +  ++  +  +  +  P  ++++Y KY  L++ +AE +V  FL E+H    L  ++  YQ L DE+       V L +F L +  L   + KR + L + LV+  ++ ++E N  +C  YD I NK    P++TE L+ ++ ++ +    E+ +L+ + +E+  RL FL+DY T    DI+LN+  F     + ++FD     I+ +  Q ++ L+LR  +  E ++   + +E+F       + E+ + ++    L  +++   +++  +N+EE   +W  SQ+P   T+   L PY RL+ TA +F  ++  W+ GP   +N   +E D+   ++ ++KL K F D P   ++A+ VK +++ FK H+P++QV+CNPG++ERHW+ MS ++GF +KP+EE + +  FL   L  HL   E I   A+KEH LEK + +M  +W  M+F L  YR++G SILS+LD++QMLLDDHI+K+QTM+GSPFIKPFE E++ WEDKL+ + +I+D WLKVQ TWLYLEPIFSS DI+AQMPEEGR+F  VD TW++ M +   +   L       ML ++  SN LLE I KGLN+YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI  + FT+ L+I  M S+EGE + ++  I  +KA+G VEKWLL++EN M+ S+ KVI  + E+Y+   R  WV  WPGQ V+CVS +YWTK++ EAI   P  L+ YL + N+QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ ++ +  V     FEWLSQLRYY    ++    I+  L YG EYLGNTPRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDY A+GKFFKGL  AGAWACFDEFNRI+LEVLSVVAQQI +IQ  I+   +  +FEGTEL LNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALI EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENE +LLL++I DVNLPKFL+ D+PLFEGI SDLFPG+ LPK D+ +   A+++N  K  LQ  ++F +KILQIYEM++VRHG M+VGEPFGGKT AY+ LAAAL DI     M+E +V   +INPK+ITMGQLYGQFDPVSHEW+DG+LA+ +R FA++Q   RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +M+LIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S++   +P  L+  H  LI  LF+ ++  CL  IR   K+L  TS    V  L  L   ++DE             ++S +K +  +++  WL+G+F+F  +WS+G+S  E GR KFD   RE L GG++           + +P + +LT     P   T+Y++ F K+  G W+ W   + +    I  D + NEII+PT  T R    + L +TH+KP + VGPTGTGKSV I ++L+ RL KD Y    INFSA+T+A QTQ+IIM+KLD+RRKGV+GPP  K+ VVFVDD+NMPA+E YGAQPP+ELLRQW+DH +W+D KD S ++L+D  ++ AMGPPGGGRN V+ R +RHFN + +NEF++ TM  IF+ I+DWH      F   F  +   ++S+TM+VY++A  + LPTPAKSHY+FNLRDFSRVI+G+ L       +   + RLWVHEV RV+YDRL   +D       ++  +      +  ++  HL  +  G V ++D+R L+F D+     +D+ Y E+   + L + +ET L++YN+ISKAPM+LV+F+FA+EH+ R+ R+LKQ  GHALLVG+GGSGRQS TR+AA MA+ E+F +EI+++YG +EWRDDLK ++ K+       VFLF+D QIK ESF+ED+S LLNTG+VPNL+  DEK EI E+M+   R  ++   ++ D + +A++N F+ER +  LH+VLAMSPIGD FR+RLR FP+LINCCTIDWFQ+WPEDAL+ VA++FLED+EM    RE  + MCK +H S   LS  FL+ L+RYNYVTPTSYLELI  FK LL  KR E++ LK+RY  GL+KLE A+ +V  MQ EL+ALQP+L V + + ++++  ++ ++ EV    +++  ++ +AN +A  ++ IKD+C+ADLA A+PIL  A+A+LDTL Q DITLV++MKNPP  +KLVMEA+CI+ G KP+R PD S +GK +EDYW  + KLLGD KFL  L  ++ D++    +  +R KYI  PDF P+ +R AS A EGLCKW+ A+D YD  AK+VAPKK KLA AE++L++ ++ L +K+A L EV+ KL  L + L+  + +K +LE+ +E+C+KKL+RAEQLIGGLGGEKSRW+E A  L + Y N+TGD+L+SAA+VAYLG FT +FR    E W   C    IPCS++  +M+ LGEPVKIR+W IAGLP DSFSIDN II++N+ RWPL IDPQGQANKW+KNMEKSN L +IKL+D +FVRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY  DF+FYITT+LRNPHYLPE+S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ A+NKR+L+E+ED+ILEVLS+S+GNILE+ETA+ +LSSSK+L+ EISEKQ IAEVT+++ID+TR GY P+A+H +ILFF I+D+ANI+PMYQYSL WFINLF+MSI+NS+KS+ LE R++ L DHFT S+Y N+CRSLFE  KLLFS  + + LLK    V+++ WRFLLTGGV LDNP+ NP   W+    W E+ R  E+   KGLR+      + WK +YDS+ P
Sbjct:  265 SFKKLRLIDVEAFHSEEESMELSVFQQLVNKHIERATGILLNTWIPEVQKIY--HRGNKRNLIPSNSSVAR--LQSFYNCVATLMTSQLQSLALESMQDYTHLIAQNPHS---------VRVYEHPGFVLRLVLDQNTIKFEPDFKDFEVTVLNVYNAMLKSLSVIPRVETKLYSEWPGPETHHTLKPIILPE-ILEAQQEKVRRVIRAESAEPLKHVHLYDKYAPLVSQQAEEDVTQFLLEQHSFQELMMEVIRYQQLADEIQCSTVKVVRLGMFELHSHDLVRALVKRAEGLLQKLVNHMLQGHQEFNNKLCEEYDTIANKALRSPSNTEELMELRAYVAKVEEEEILQLEMKLQESNNRLCFLVDYVTFSPTDIQLNSKTFQRHARMPSIFDQHRQIIKEKTGQFQDGLKLRCERILEDIKSYEQQVEEFVN--FGDLSELNKYLKKAQSLNSKLELVMEKIRGINQEEEAFDWPVSQYPQRKTVQDQLLPYLRLYETAAEFQSQHHQWVTGPLTAVNPDKVEVDVGNYSRGLYKLEKTFQDLPKPLQIATSVKAEVEAFKEHIPIVQVLCNPGLRERHWEAMSAVVGFPLKPSEEDACVAHFLPLHLEAHLSAFESISEGASKEHGLEKAMERMVSEWAGMEFTLLPYRETGTSILSSLDEVQMLLDDHIVKTQTMRGSPFIKPFEAEIRDWEDKLLLLQEIMDEWLKVQGTWLYLEPIFSSPDIMAQMPEEGRRFTAVDKTWRDTMKQVSLDKHVLAVVAIEKMLDKMKHSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASVVFTDVLDITHMRSSEGEVVELLDIISTSKARGQVEKWLLELENGMLRSIHKVIGKACEAYLNDLRINWVRAWPGQTVLCVSQVYWTKDIHEAIAKGPKALQAYLEQNNTQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVQKGVDDETNFEWLSQLRYYWIENQLHTKMINAGLAYGYEYLGNTPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAIAKQCVVFNCSDGLDYIALGKFFKGLLSAGAWACFDEFNRIDLEVLSVVAQQILTIQRGISAHAEMLLFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYALIAEIVLYSCGFVRARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPE-ENEDVLLLRSIIDVNLPKFLAHDLPLFEGITSDLFPGIKLPKPDYSVLLEAIRENSAKMNLQVTDFFAEKILQIYEMMIVRHGFMLVGEPFGGKTSAYRVLAAALNDICEKNLMEENRVQITVINPKSITMGQLYGQFDPVSHEWSDGILAVSYRAFAISQSPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMSLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPVMLSWLN-TVPSTLSSMHKDLITGLFDRMLPACLQLIRKGTKELSPTSNTSLVKSLMNLMDCMMDEF-----------GDESQMKRMDQRDVCSWLEGIFVFCLLWSVGASCTEEGRVKFDGLVREMLVGGLSEETRTRHGILEHVEPPAKQLTVP--LPTEGTLYEYRFLKEGPGRWELWTEEL-KAFPPIPKDVQFNEIIVPTENTVRYNALMKLLITHQKPTVFVGPTGTGKSVYILDFLLNRLEKDVYSPLLINFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKKMVVFVDDVNMPARETYGAQPPVELLRQWLDHWNWYDMKDCSMINLVDIQIMCAMGPPGGGRNPVTPRFLRHFNTVTINEFDNKTMFTIFSRILDWHLTIRFPFPKPFASVTSQIISATMSVYQEATKNLLPTPAKSHYLFNLRDFSRVIQGICLSRPETADDLTAIKRLWVHEVLRVYYDRLVHPDDCAWMVGFLQEVSKSHLNEDFHQLFKHLDSNSDGLVTEDDLRSLMFCDFHDPKGEDRNYREVGDAEKLRQVVETHLEEYNNISKAPMNLVLFRFAIEHVCRISRILKQPRGHALLVGVGGSGRQSLTRLAAHMAEAELFQVEISKSYGVSEWRDDLKLIMQKSTSGDTHGVFLFTDTQIKMESFLEDVSNLLNTGEVPNLFAVDEKQEICERMRVLDR--QRDRDKQTDGSTLALFNMFLERCRSQLHVVLAMSPIGDTFRSRLRRFPALINCCTIDWFQSWPEDALQAVASRFLEDVEMTNTAREGCISMCKSFHTSTIDLSAHFLSELQRYNYVTPTSYLELISMFKHLLQRKRTEVMKLKSRYEVGLQKLESAATQVSTMQGELEALQPQLRVATKEVEEMMVVIQHESEEVSKTEKVVRVDEAEANEQAMAAKAIKDECDADLAVAVPILEAALAALDTLTQQDITLVKAMKNPPAGVKLVMEAICILKGIKPDRIPDPSGSGKKVEDYWGPAKKLLGDMKFLQSLHEYNKDNIPVSYMSIIRNKYITNPDFVPEKIRTASAAAEGLCKWVCAMDSYDKVAKVVAPKKEKLAHAEEKLKVAMESLRKKQAALKEVQDKLAKLQETLETNKNKKADLENQVEMCSKKLERAEQLIGGLGGEKSRWSETAFNLGQLYNNLTGDILISAAIVAYLGAFTSSFRQRATEEWIDMCKSRGIPCSKNMSLMNSLGEPVKIRSWTIAGLPSDSFSIDNAIIISNARRWPLMIDPQGQANKWLKNMEKSNSLHVIKLSDADFVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSVCIRLGDSTIEYAPDFRFYITTKLRNPHYLPEVSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGAENKRQLQEIEDKILEVLSASEGNILEDETAVQILSSSKVLANEISEKQAIAEVTELKIDQTRLGYTPIAIHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSQKSDLLEERLQILKDHFTYSLYCNVCRSLFEKDKLLFSFCLTVNLLKHNKLVDEKEWRFLLTGGVGLDNPHSNPC-TWLPKTSWDEICRLDEMERFKGLRKDLARLREGWKEVYDSKDP 3340          

HSP 2 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 386/664 (58.13%), Postives = 508/664 (76.51%), Query Frame = 2
Query: 9362 HRNCFLPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            H   F  +    L    +++++RC+RPDK+VP VQ F++ NLGQ FI+ PPF+L ++F DS+CC+PLIF+LSPG+DPM ALLKFGE+QG+  +++ S+SLGQGQGPIA  MI+  +++GTWVVLQNCHLATSWM +LE++CEE+   + TH +FRLWLTSYPS +FPV++LQNGVKMTNE PKGLR+N++RS+  DPISD +FFD  +  + +  +LF LCFFHAL QERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFL+ Y E+P +AL Y+TGECNYGGRVTDD DRR L ++L IFY ++I+    Y F PSG+YYSPP+G    YIEY ++LP+NP+PE++G++ NADITKD  ET  LF  ILLT  R + G   S +D + E+A DIL KLP++FD +  M++YP  Y++SMNTVL QE+ RFNKL+  +R + +N+QKAIKGLVVM+ ELEEV +S+L G++P  W  KSYPSLKPLG Y++D ++RL F  DW  + +P+ FW+SGF+FTQ+FLTG  QN+AR+YTIPID + F+FE+       + K  PEDG  + GLFL+GARWD+  K L ES PKIL +++P+IWLKP K   I     Y+ PVYKTS RRGTLSTTGHSTN+V+++ L +++   HWI RGVA LCQL+
Sbjct: 3341 HHTDFPSEWQEKLGQFQRMLIIRCLRPDKVVPMVQEFVSGNLGQQFIEVPPFNLATAFADSHCCAPLIFILSPGSDPMAALLKFGEEQGFTGNRLTSLSLGQGQGPIAMSMIETGVKEGTWVVLQNCHLATSWMSTLERVCEELN-ADTTHPDFRLWLTSYPSPNFPVAVLQNGVKMTNEAPKGLRSNIIRSFCMDPISDPEFFDSSSKPAVFKKLLFSLCFFHALTQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEEIPFDALRYMTGECNYGGRVTDDWDRRTLRTILSIFYTSEIINDADYKFDPSGLYYSPPEGDYNSYIEYTKTLPLNPSPEIFGMNANADITKDQVETQLLFDSILLTQSRSSGGSAASSDDMVFEVAADILNKLPQDFDTDAAMRKYPTSYNQSMNTVLVQEMGRFNKLLQTIRDSCVNIQKAIKGLVVMSAELEEVVSSILKGRIPAMWMKKSYPSLKPLGGYISDFLERLKFLQDWYMDGMPAVFWMSGFFFTQAFLTGGQQNYARRYTIPIDLLSFDFEVM---EDKEYKNPPEDGVYIRGLFLDGARWDRRTKRLAESFPKILHDTMPVIWLKPMKKQDIPERQCYISPVYKTSERRGTLSTTGHSTNYVISMALNSDVPPEHWIRRGVALLCQLN 4000          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 2973.34 bits (7707), Expect = 0.000e+0
Identity = 1564/3152 (49.62%), Postives = 2136/3152 (67.77%), Query Frame = 1
Query:   58 HIIVHQKKIRV*SCR*GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTV-----GPKNYLNVY-KKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFND-----------NPGAQK-----------------VASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAI-TVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLN-EDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISP----DAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE-HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK-VVDEDVRGLIFGDYMTDD-----KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            HI+    K  +  C   F +   I++++  S G P+     +N +  +C  +   L  +W P+   L   K TL   + PK+       + +F+   ++L+S QL+ +V  S+  F                FD L     PL  ++L   + K+ + P+F +L+  ++     I  + + +  ++  L     G        + + KL + ++    QT   N V     GP  +   Y  +Y  L+N  A+ +V   ++E H      K+++ ++ L  E+S L   +   +  LD   L   + K+ + L +++V   V  + + +  IC  ++ I ++  ++P  TE ++ +  ++ +  T  +  L     EA +R+ +L+D      E + LNTT+  WP +I+ +FD +   +   + + + DL  R  K    L+++ + +E+F   E   ++ +++    +  +  ++ D ++ ++ +NKEE++  WE++ +P +  + ++++PY +L+   L +      W+ G F +LN  +IE ++ E  + M+K++K F               G +K                 + S V  ++ +FK ++P++ ++CNPGI+ RHW+QMS+I G D+ P   S+L   L   L  +LE  E I A A+KE  LE+ +  M E W  + F    YRD+GVSILS++D+IQ +LDD I+K+QTM+GSPFIKPFE E+K+WE++L+ + D ID WLKVQ  WLYLEPIFSSEDI+ QMPEEGR F IV+  W+EVMA  VK+P  L AT    + ++L +S +LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE +  +  I  ++A+G VEKWL+QVE++M+ S++ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT EV EAI +  NGLK Y  +  +Q++DIV+LVRG L    R TLGAL  IDVHARDV+  + +  VSS   F+WL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F            +Q  + F+DKI+Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA ++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS++M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S+++  LP  L  +D+  L++ LFEWL+ P L  +R  C+++I +S  + VV L +LF  LL    N          ED   K     N+  W+   F F+ VWS+G       RS+FD F RE+  G     P P ++   +   F E+  +YD+ +E K  G W  W      ES+S +P    + K+ +II+PT +T R TY +DL + + +P+++VGPTGTGKSV +   L+  L KD +L   INFSARTSANQTQ+IIM++LD+RRKGVYGPP  K+C++FVDD+NMPAKE +GAQPP+ELLRQ+ DHG+W+D KDTSK+ L D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D +M+RIF+ IV ++   + F      +G  +VS+T+ VY+KAI + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHE+YRVFYDRL  ++DR   F +        FK N + +  HL    K + +E++R L+FGDYM  D     ++Y E+ S++   + +ET LD+YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FM++  +F  EI+++YG NEWR+DLKRL+  AG   +  VFL +D QIK E+F+ED+  +LNTG+VPN++  DEK EI+E    A R   +   + ++ +P+A++ YF+ R K+NLHIV+A SPIGDAFRNRLR FPSLINCCTIDWFQ WPE+ALE VANKFLE +++ +  R+ +V +CK +H S   LS  FL  L R+NYVTPTSYLELI  F+ LL  +R+ +++ KNRY  GL+KL FA  +V +M+ EL  LQP+L        K++  +E ++VEVEAK +++  ++E A +KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  D+T+V++MKNPP  +KLVM AVC+M   KPER  D S TG+ I DYW  S KLLGD  FL  LK +  D++  Q + K+R +Y+  PDFDP  V  AS+A EGLC+WI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + K +LE  ++LC +KL+RAE+LIGGLGGEK+RW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR+   + W + C    IP S+ F +   LG+P+KIRAWNIAGLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ + L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K +F+Q GVD +RLG++VIEY+ DF+FYITT+LRNPHYLPE++TKVCLLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+EDQILE L SS+GNILE+E+AI +L ++KL+S EI++KQ IAE T++EI ++R GY+ +A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI +S KS++LE R+ YL D+FT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP++ G++E F  + + +  +YDS+ P
Sbjct:  203 HILHPAMKSVLDICYSTFSHLLLIDLSDCRSTG-PVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTL-QKVKPKK-------LDSFYNCASTLISNQLKALVEKSVTAFVSL-------------FDPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWL---AEGS-----ISVIDAKL-SDHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKQVEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIIVGKLVSSHHQCSLQICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMEAQQRMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFA--ECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPD-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMK-TLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVN----------EDPGNK-----NMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWEC-PFDEKGLVYDYSYEFKGKGRWVHW-----NESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIME----AVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKESFIKSPESFLPIYDSKEP 3294          

HSP 2 Score: 859.366 bits (2219), Expect = 0.000e+0
Identity = 403/656 (61.43%), Postives = 502/656 (76.52%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSR-WHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDS-IQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDR-SSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L  L K+I+ RC+RPDKI PA+  F+TD LG+ F++PPPFDL  S+NDSNC  PL+FVLSPGADPM +LLKF  D+    S+  SISLGQGQGPIA K+I  A++DGTWV LQNCHLA SWM +LEKICE++  P+  H NFRLWLTSYPS  FPV+ILQNGVKMTNEPP GLR NLL+SYL+DPISD  FF GC      W  +L+G+CFFHALVQER+KFGPLGWNIPY FNESDLRIS+RQ+Q+F+N+Y E+P EA+TYLTGECNYGGRVTDD DRRLL+++L  FYN D+++  +Y FSPSG Y++PP    + Y+E+I+ LP   +PEV+G+HEN DI+KD Q+T  LF  +LLT    + G G S  DS + ++A+DIL KLP NFD+E  + ++PV Y ESMNTVL QE+ R+N L S +R +L NL KAIKGLVVM+ ELE V  S+L+GKVP  WA  SYPSLKPLGSYVND + RL F  DW +   P  FW+SGF+FTQ+F+TG LQN+ARKY+IPID +GF +E+  FD S      PEDG  ++GLFL+GARWDK++ +L E  PK+LF+++PIIW+KP    A+D+  S Y+CP+YKTS R+GTLSTTGHSTNFV+ + LP +    HWI RGVA LCQLDD
Sbjct: 3307 LNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLS-PDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYNNLSSTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDS---SPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPTDKKAMDQPHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3958          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 2946.38 bits (7637), Expect = 0.000e+0
Identity = 1559/3152 (49.46%), Postives = 2129/3152 (67.54%), Query Frame = 1
Query:   58 HIIVHQKKIRV*SCR*GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTV-----GPKNYLNVY-KKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFND-----------NPGAQK-----------------VASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAI-TVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLN-EDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISP----DAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE-HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK-VVDEDVRGLIFGDYMTDD-----KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            HI+    K  +  C   F +   I++++  S G P+     +N +  +C  +   L  +W P+   L   K TL   + PK+       + +F+   ++L+S QL+ +V  S+  F                FD L     PL  ++L   + K+ + P+F +L+  ++     I  + + +  ++  L     G        + + KL + ++    QT   N V     GP  +   Y  +Y  L+N  A+ +V   ++E H      K ++ ++ L  E+S L   +   +  LD   L   + K+ + L ++++S    +   +   IC  ++ I ++  ++P  TE ++ +  ++ +  T  +  L      ++ ++ +L+D      E + LNTT+  WP +I+ +FD +   +   + + + DL  R  K    L+++ + +E+F   E   ++ +++    +  +  ++ D ++ ++ +NKEE++  WE++ +P +  + ++++PY +L+   L +      W+ G F +LN  +IE ++ E  + M+K++K F               G +K                 + S V  ++ +FK ++P++ ++CNPGI+ RHW+QMS+I G D+ P   S+L   L   L  +LE  E I A A+KE  LE+ +  M E W  + F    YRD+GVSILS++D+IQ +LDD I+K+QTM+GSPFIKPFE E+K+WE++L+ + D ID WLKVQ  WLYLEPIFSSEDI+ QMPEEGR F IV+  W+EVMA  VK+P  L AT    + ++L +S +LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE +  +  I  ++A+G VEKWL+QVE++M+ S++ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT EV EAI +  NGLK Y  +  +Q++DIV+LVRG L    R TLGAL  IDVHARDV+  + +  VSS   F+WL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F            +Q  + F+DKI+Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA ++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS++M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S+++  LP  L  +D+  L++ LFEWL+ P L  +R  C+++I +S  + VV L +LF  LL    N          ED   K     N+  W+   F F+ VWS+G       RS+FD F RE+  G     P P ++   +   F E+  +YD+ +E K  G W  W      ES+S +P    + K+ +II+PT +T R TY +DL + + +P+++VGPTGTGKSV +   L+  L KD +L   INFSARTSANQTQ+IIM++LD+RRKGVYGPP  K+C++FVDD+NMPAKE +GAQPP+ELLRQ+ DHG+W+D KDTSK+ L D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D +M+RIF+ IV ++   + F      +G  +VS+T+ VY+KAI + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHE+YRVFYDRL  ++DR   F +        FK N + +  HL    K + +E++R L+FGDYM  D     ++Y E+ S++   + +ET LD+YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FM++  +F  EI+++YG NEWR+DLKRL+  AG   +  VFL +D QIK E+F+ED+  +LNTG+VPN++  DEK EI+E    A R   +   + ++ +P+A++ YF+ R K+NLHIV+A SPIGDAFRNRLR FPSLINCCTIDWFQ WPE+ALE VANKFLE +++ +  R+ +V +CK +H S   LS  FL  L R+NYVTPTSYLELI  F+ LL  +R+ +++ KNRY  GL+KL FA  +V +M+ EL  LQP+L        K++  +E ++VEVEAK +++  ++E A +KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  D+T+V++MKNPP  +KLVM AVC+M   KPER  D S TG+ I DYW  S KLLGD  FL  LK +  D++  Q + K+R +Y+  PDFDP  V  AS+A EGLC+WI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + K +LE  ++LC +KL+RAE+LIGGLGGEK+RW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR+   + W + C    IP S+ F +   LG+P+KIRAWNIAGLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ + L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K +F+Q GVD +RLG++VIEY+ DF+FYITT+LRNPHYLPE++TKVCLLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+EDQILE L SS+GNILE+E+AI +L ++KL+S EI++KQ IAE T++EI ++R GY+ +A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI +S KS++LE R+ YL D+FT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP++ G++  F         +YDS+ P
Sbjct:  140 HILHPAMKSVLDICYSTFSHLLLIDLSDCRSTG-PVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTL-QKVKPKK-------LDSFYNCASTLISNQLKALVEKSVTAFVSL-------------FDPLNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWL---AEGS-----ISVIDAKL-SDHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKVLEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIILS----DGVFLFFRICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFA--ECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELKKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSIRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPD-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHLCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNESGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMK-TLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPVN----------EDPGNK-----NMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWEC-PFDEKGLVYDYSYEFKGKGRWVHW-----NESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSVYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIME----AVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERKEVVPICKTFHTSAIDLSNRFLIELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVIEVESVEVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFL-------PIYDSKEP 3220          

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 399/655 (60.92%), Postives = 501/655 (76.49%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSR-WHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDS-IQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L  L K+I+ RC+RPDKI PA+  F+TD LG+ F++PPPFDL  S+NDSNC  PL+FVLSPGADPM +LLKF  D+    S+  SISLGQGQGPIA K+I  A++DGTWV LQNCHLA SWM +LEKICE++  P+  H NFRLWLTSYPS  FPV+ILQNGVKMTNEPP GLR NLL+SYL+DPISD  FF GC      W  +L+G+CFFHALVQER+KFGPLGWNIPY FNESDLRIS+RQ+Q+F+N+Y E+P EA+TYLTGECNYGGRVTDD DRRLL+++L  FYN D+++  +Y FSPSG Y++PP    + Y+E+I+ LP   +PEV+G+HEN DI+KD Q+T  LF  +LLT    + G G S  DS + ++A+DIL KLP NFD+E  + ++PV Y ESMNTVL QE+ R+N   + +R +L NL KAIKGLVVM+ ELE V  S+L+GKVP  WA  SYPSLKPLGSYVND + RL F  DW +   P  FW+SGF+FTQ+F+TG LQN+ARKY+IPID +GF +E+  FD S      PEDG  ++GLFL+GARWDK++ +L E  PK+LF+++PIIW+KP+ +++    S Y+CP+YKTS R+GTLSTTGHSTNFV+ + LP +    HWI RGVA LCQLDD
Sbjct: 3233 LNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLS-PDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDS---SPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPSTIIS--PHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3878          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 2942.91 bits (7628), Expect = 0.000e+0
Identity = 1555/3155 (49.29%), Postives = 2125/3155 (67.35%), Query Frame = 1
Query:   58 HIIVHQKKIRV*SCR*GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTV-----GPKNYLNVY-KKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFND-----------NPGAQK-----------------VASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAI-TVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLN-EDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISP----DAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE-HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK-VVDEDVRGLIFGDYMTDD-----KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTV---EVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            HI+    K  +  C   F +   I++++  S G P+     +N +  +C  +   L  +W P+   L   K TL   + PK+       + +F+   ++L+S QL+ +V  S+  F                FD +     PL  ++L   + K+ + P+F +L+  ++     I  + + +  ++  L     G        + + KL + ++    QT   N V     GP  +   Y  +Y  L+N  A+ +V   ++E H      K ++ ++ L  E+S L   +   +  LD   L   + K+ + L ++++S    +   +   IC  ++ I ++  ++P  TE ++ +  ++ +  T  +  L      ++ ++ +L+D      E + LNTT+  WP +I+ +FD +   +   + + + DL  R  K    L+++ + +E+F   E   ++ +++    +  +  ++ D ++ ++ +NKEE++  WE++ +P +  + ++++PY +L+   L +      W+ G F +LN  +IE ++ E  + M+K++K F               G +K                 + S V  ++ +FK ++P++ ++CNPGI+ RHW+QMS+I G D+ P   S+L   L   L  +LE  E I A A+KE  LE+ +  M E W  + F    YRD+GVSILS++D+IQ +LDD I+K+QTM+GSPFIKPFE E+K+WE++L+ + D ID WLKVQ  WLYLEPIFSSEDI+ QMPEEGR F IV+  W+EVMA  VK+P  L AT    + ++L +S +LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE +  +  I  ++A+G VEKWL+QVE++M+ SV+ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT EV EAI +  NGLK Y  +  +Q++DIV+LVRG L    R TLGAL  IDVHARDV+  + +  VSS   F+WL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F            +Q  + F+DKI+Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA ++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS++M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S+++  LP  L  +D+  L++ LFEWL+ P L  +R  C+++I +S  + VV L +LF  LL    N          ED   K     N+  W+   F F+ VWS+G       RS+FD F RE+  G     P P ++   +   F E+  +YD+ +E K  G W  W      ES+S +P    + K+ +II+PT +T R TY +DL + + +P+++VGPTGTGKS+ +   L+  L KD +L   INFSARTSANQTQ+IIM++LD+RRKGVYGPP  K+C++FVDD+NMPAKE +GAQPP+ELLRQ+ DHG+W+D KDTSK+ L D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D +M+RIF+ IV ++   + F      +G  +VS+T+ VY+KAI + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHE+YRVFYDRL  ++DR   F +        FK N + +  HL    K + +E++R L+FGDYM  D     ++Y E+ S++   + +ET LD+YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FM++  +F  EI+++YG NEWR+DLKRL+  AG   +  VFL +D QIK E+F+ED+  +LNTG+VPN++  DEK EI+E    A R   +   + ++ +P+A++ YF+ R K+NLHIV+A SPIGDAFRNRLR FPSLINCCTIDWFQ WPE+ALE VANKFLE +++ +  R+ +V +CK +H S   LS  FL  L R+NYVTPTSYLELI  F+ LL  +R+ +++ KNRY  GL+KL FA  +V +M+ EL  LQP+L        K++      ++    VEAK +++  ++E A +KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  D+T+V++MKNPP  +KLVM AVC+M   KPER  D S TG+ I DYW  S KLLGD  FL  LK +  D++  Q + K+R +Y+  PDFDP  V  AS+A EGLC+WI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + K +LE  ++LC +KL+RAE+LIGGLGGEK+RW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR+   + W + C    IP S+ F +   LG+P+KIRAWNIAGLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ + L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K +F+Q GVD +RLG++VIEY+ DF+FYITT+LRNPHYLPE++TKVCLLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+EDQILE L SS+GNILE+E+AI +L ++KL+S EI++KQ IAE T++EI ++R GY+ +A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI +S KS++LE R+ YL D+FT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP++ G++  F         +YDS+ P
Sbjct:  129 HILHPAMKSVLDICYSTFSHLLLIDLSDCRSTG-PVDCESLKNKVAVECERVEERLMKAWFPKIIHLLTSKDTL-QKVKPKK-------LDSFYNCASTLISNQLKALVEKSVTAFVSL-------------FDPVNINKLPLFKMDLIFDDEKMDFYPNFHDLELAVLEIANLISNTMQKVQTIQSWL---AEGS-----ISVIDAKL-SDHVQVWAQTTLRNAVRMNLEGPAKHFQSYVDRYDWLVNGTAQAQVDKLMEEEHSFDEHTKVLEWFRALSKEISSLPSLIHFDMVRLDCEELKQGLAKKANALSKIILS----DGVFLFFRICEEFEAIRDRALKVPETTEEMMEMITYINQVKTKGIEELNNRIMVSISQMNYLMDVHIFNEEHLDLNTTVLLWPQNINPIFDQSDEVMDEAKLKGQNDLSGRREKLLLELDKVGRRMEEFA--ECSELDMIQQYAADVRTVLKRLQDIEESIDFINKEEALYQWEKTSYPEVEVIKESIEPYQKLFTLVLKWQRTRKKWMDGSFLDLNGESIELEVEEYVREMYKMLKFFQQKQKKAELEKEKTAGLKKKTKEDQEDDKKESATILICSSVVKQVKEFKEYIPLVSILCNPGIRPRHWEQMSEIAGQDLTPDSGSTLRKILKQNLTPYLELFEGISAGASKEFGLERAMQTMVEAWDTVSFHYHPYRDTGVSILSSVDEIQTMLDDQIVKTQTMRGSPFIKPFETEIKVWEERLIGIQDTIDEWLKVQHQWLYLEPIFSSEDIMKQMPEEGRLFQIVNKHWREVMANCVKDPKILAATSLPGLFEKLQESYNLLENIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPTRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVEFIQLISTSEARGAVEKWLVQVEDIMLRSVRDVINRSRLAYPETKRSQWVREWPGQVVLCASQMYWTVEVHEAIRSSANGLKKYYEQLQNQLNDIVELVRGKLPKQTRTTLGALVTIDVHARDVILELIEKGVSSETDFQWLAQLRYYWANDNVRVRIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMRLEYFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPD-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPVADYKLFLECAHMCCENHNVQPVKVFLDKIIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNELGYNEEEKVIYQTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREFASSETPERKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSSQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWTPLVLSWMK-TLPDPLQAQDNSTLLQQLFEWLLPPTLVLLRKQCREVIPSSNSNTVVSLTRLFEMLLTRPLN----------EDPGNK-----NMRTWIMAAFAFALVWSVGGCCDTDSRSRFDKFLREMISGKAENCPIPAAVSKWEC-PFDEKGLVYDYSYEFKGKGRWVHW-----NESISNAPLGDKNTKVQDIIVPTIDTVRYTYLMDLCIQYGRPLLLVGPTGTGKSIYVKEKLMNNLDKDLFLPFFINFSARTSANQTQNIIMSRLDKRRKGVYGPPMGKKCIIFVDDMNMPAKEVFGAQPPVELLRQYFDHGNWYDLKDTSKITLTDMQLISAMGPPGGGRNAVTPRFLRHFNICSINAFSDESMVRIFSNIVTFYLRTNEFPPDCFTVGNQIVSATLEVYQKAIENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLTNKRTMIRLFVHEIYRVFYDRLVDDQDRAWLFTLTSNIVKQHFKDNFDSVFEHLKDGNKPLCEENMRNLLFGDYMMPDVDESERLYAEVPSVERFGEVVETCLDEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMSNMTLFQPEISKSYGMNEWREDLKRLMKNAGVKGEKTVFLLTDAQIKDEAFLEDVDSILNTGEVPNIFAVDEKQEIME----AVRPFAQAGNKNLEFSPLALFAYFVTRCKENLHIVVAFSPIGDAFRNRLRQFPSLINCCTIDWFQPWPEEALERVANKFLETLDLSDLERQEVVPICKTFHTSAIDLSNRFLLELGRHNYVTPTSYLELIAAFRLLLTQRRDTVMSAKNRYTNGLDKLAFAESQVSEMKKELVDLQPKLEQAKIDNTKIMEVTFIQSMIRFSVEAKSKLVRVDEEAATLKANEAQALKNECESDLAEAIPALEAALSALDTLKPADVTIVKAMKNPPAGVKLVMAAVCVMKDIKPERINDPSGTGQKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPAQVMHKIRSEYMTNPDFDPTKVVKASSAAEGLCRWITAMEVYDRVAKVVAPKKANLIVAQESLATTMALLNQKRAELKEVEDRLAALQKTLEEKTEEKAQLEFQVDLCARKLERAEKLIGGLGGEKNRWLKAANDLQCTYDNLTGDVLISAGVIAYLGAFTARFRHDCTKMWAQLCKSKKIPSSDDFSLSKTLGDPIKIRAWNIAGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERDHNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQVFKQGGVDCIRLGESVIEYSADFRFYITTKLRNPHYLPELATKVCLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDQILETLQSSEGNILEDESAIQILDAAKLMSNEITKKQQIAEKTEIEIAESREGYRAIAKHSSILFFTIADLANIDPMYQYSLNWFVNLYVNSILDSNKSKNLEKRLRYLIDYFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYSEFMFLLTGGVGLQNSIPNPDPNWLPDKSWDEICRASDLPALNGIKYSFL-------PIYDSKEP 3212          

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 399/655 (60.92%), Postives = 501/655 (76.49%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSR-WHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDS-IQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L  L K+I+ RC+RPDKI PA+  F+TD LG+ F++PPPFDL  S+NDSNC  PL+FVLSPGADPM +LLKF  D+    S+  SISLGQGQGPIA K+I  A++DGTWV LQNCHLA SWM +LEKICE++  P+  H NFRLWLTSYPS  FPV+ILQNGVKMTNEPP GLR NLL+SYL+DPISD  FF GC      W  +L+G+CFFHALVQER+KFGPLGWNIPY FNESDLRIS+RQ+Q+F+N+Y E+P EA+TYLTGECNYGGRVTDD DRRLL+++L  FYN D+++  +Y FSPSG Y++PP    + Y+E+I+ LP   +PEV+G+HEN DI+KD Q+T  LF  +LLT    + G G S  DS + ++A+DIL KLP NFD+E  + ++PV Y ESMNTVL QE+ R+N   + +R +L NL KAIKGLVVM+ ELE V  S+L+GKVP  WA  SYPSLKPLGSYVND + RL F  DW +   P  FW+SGF+FTQ+F+TG LQN+ARKY+IPID +GF +E+  FD S      PEDG  ++GLFL+GARWDK++ +L E  PK+LF+++PIIW+KP+ +++    S Y+CP+YKTS R+GTLSTTGHSTNFV+ + LP +    HWI RGVA LCQLDD
Sbjct: 3225 LNELQKMIIYRCLRPDKIEPAISKFVTDKLGKIFVEPPPFDLSKSYNDSNCTIPLVFVLSPGADPMASLLKFANDKNMGGSQFKSISLGQGQGPIAVKLIRSAMKDGTWVCLQNCHLAVSWMSTLEKICEDLS-PDTCHPNFRLWLTSYPSPRFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPISDADFFAGCPKKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNEYQEVPFEAITYLTGECNYGGRVTDDWDRRLLMTILADFYNKDVIDHPRYSFSPSGKYHAPPKSIYEDYVEFIKKLPFTQHPEVFGMHENVDISKDLQQTKLLFDSLLLTQGGGSKGGGGSGGDSTLLDIANDILSKLPGNFDIESALVKFPVCYEESMNTVLVQEMQRYN---NTIRVSLQNLIKAIKGLVVMDAELEAVAGSLLVGKVPEKWAKCSYPSLKPLGSYVNDFLARLKFLQDWYDTQKPHVFWLSGFFFTQAFITGALQNYARKYSIPIDLLGFNYEVLPFDTSDS---SPEDGVYIHGLFLDGARWDKKSGVLAEQYPKVLFDAVPIIWIKPSTIIS--PHSVYVCPLYKTSERKGTLSTTGHSTNFVITMMLPTSKRPQHWIKRGVALLCQLDD 3870          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3984.49 bits (10332), Expect = 0.000e+0
Identity = 1939/3091 (62.73%), Postives = 2459/3091 (79.55%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F + RF+   EL+S  LP+ P +FE V++R C E H+ L+  W+P CA LF  ++  W HL+P+    ++  V+ FFA IASLMS QLR MV  SL D   F  +H+NGN+FG  ++E++F    ++IV+L+V EPKI ++P+ +E   L+  C+  I++S+E +P+VEV+LFP+++ + L L +V  +E LV++Y+++TM+ F  N VGP+ YLNVYKKY +LLN KA+ ++ +FLKE H L A  KKI++   L+ E++ + ++VPL+LF LD  RLN D+  R   L++ L+ F V+ENR +N+SIC +Y  I +KV+E+P+ TE LVA+ +FLR++    V++LK+E  EA  RL FLLDYAT+ Y+D+KLN+T+F+WP  I  VF+V  NR+  +++Q E+DL  R  +FE++L+     IE FKK+E MT++EM+ NV+ L+EL   ++    + E +N EE +L WE+SQFP+L T + N  P+ +LW TA +FH K++ W+ G F +LNA  I  ++  M + M+KL K F D  G ++VA  +K KIDKFK HLP++ VICN GI++RHW+Q+SD++G+DI P  ++SL++ L YGL K++E+LE+IGA+A+KE+ LEK L KMK +W  + F    YR++  SILSA+DDIQ+LLDDHIIK+QTM GSPFIKP E E + WE  LV + +I+D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M E+VK+   L+AT Q +ML RL +SN LLE+IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFTE L+I GMIS+E E + +  KIYPAKAKGMVEKWLLQVE  M++S+++VI D I+ YV   R +WVL WPGQ+VICVS IYWTKEV+EAI     L  +L K N QI +IV+LVRG L+SG R TLGALTVIDVHARDVV  +A+ +VS+++ F+W+SQLRY   G +V V  I+TE+ YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQ+GAWACFDEFNRIE+EVLSVVAQQI SIQ AI + +K F FEGTEL+LNPTC++FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+D+F  A+KDN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ L+ AL D+ A  +M EY V+  +INPKAITMGQLYG FDPVSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S++   LP  L  +H ++I D+F WL+ PCLDFIR  CK L+ TS IH    + +L+  LLDEI N  S EE         + +S+Q I LWLQGLFLFS VW+IG ++    R KFD+F+R L  G++  +P+PKS+KLTK+N FPE+ ++YDF F K++ G W  W + I +E + I   AK++++IIPT ETARQT+FL  +L H  P++ VGPTGTGKS + N++L++LPK++Y+AN+INFSARTSANQTQDII +KLDRRRKG +GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHGHW+D+KDTS+L ++D L +SAMGPPGGGRND++ R  RH N++ ++ F+D T+ +IF +I DWHF  GFD  F R GKL++ +TM +YK A+ +FLPTP+KSHYVFNLRDFSRV++GVLL PHT+L + +KL+RLW+HEVYRVFYDRL   EDR  FF++VK TT++CFK +++K L HL+ +GKVVD+++R L FGDY    +D KIYDEIT LK+L   ME +L++YN++SKAPMSLVMF+FA+EHISR+CRVLKQDNGH LLVGIGGSGRQSAT++A FM  FE+F IEIT+NY  +EWRDD+K+++++AG   K  VFLF DNQIK E F+EDI+MLLNTGD+PN++P+DEKAEI+EKMQ  AR E    GRKI++TP+AMYN+FIE+VK NLH+VLAMSPIGDAFRNRLRMFPSLINCCTIDWFQ WP DALEMVANKFLED+ +D++ R+ +V MCK++ E+V+Q+S+ + NTLRR+NYVTPTSYLELI TFK LLN KR E+ T++NRY+ GLEKLEFAS +V  MQ EL ALQPELI TSA+T+K++ K+E++T+EV+AK+E+++A+++ AN  AA S+ IKD+CE DLAEAMP L  A+++LDTL Q+DITLV+SM NPP  +KLVME++C+M   KP+RKPD S TGKM+ED+W  S K+LGD KFLD LK F  D+++P  +KK+REK+I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L I ++QL  K+A+L  VE +LQ L D+L +   +K ELE+NIELC++KL RAE+LI GLGGEK RWTEAA++L  RY N+TGDVL+S+  VAYLG FTV +R+     W   C E  IPCS+ F +   LG+PVK+RAW IAGLPVDSFS+DNGIIV+NS R+PL IDPQGQANKWIKNMEK+N+L +IKL+D ++ RTLEN+IQFG PVLLEN+GEE++ +LEP+L K  F+QQGV+Y+RLG+N+IEY+KDF+ Y+TTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLSSSQGNILE+ETAI VLSSSKLLS+EISEKQ IA  T+ EID TR GYKPVAVH SI+FFCISD+ANI+PMYQYSL WFINL++ S+ +SEKSE+L  RIE +  HFT+S+Y N+CRSLFE  KLLFSL + I ++KG++K+ND++WRFLLTGGVALDNPYPNPA  W+SDK W+E+VRAS L  + G   H ++N  KWK++YDS  P+
Sbjct:  297 FDDLRFVRTEELLSGCLPLLPAEFEEVVQRHCREAHTALRNKWIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQNGNDFGDTYEEMKFCTPQILIVKLRVEEPKIAFEPALEECWALIKCCFLEILKSAEGLPKVEVDLFPDLQTENLTLSSVTQDESLVSNYINKTMEVFNLNIVGPQKYLNVYKKYSDLLNQKAQQDISSFLKEEHSLHAFTKKINSISQLRGEIASMHITVPLALFCLDALRLNEDLCARAQTLKDQLIQFVVDENRVLNKSICSKYSLIADKVNEVPSTTEELVALIDFLRKSRDVTVYKLKDEISEAASRLAFLLDYATLQYDDLKLNSTVFYWPEQIETVFEVNNNRLMAKKDQAEDDLNKRRSEFEKKLQGYVTEIEAFKKRENMTLDEMKANVEKLNELDRNLNAALAEFEAINVEEELLEWEKSQFPLLQTAMLNKVPFEQLWITAYNFHCKSEEWMNGAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNMLEYGLSKYIERLEQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIA-EGTLPAFLEKSNQQIGEIVELVRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHAANSMDEYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMN-TLPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVN--SSEEGN-------EPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEELIIPTTAKVSDLIIPTMETARQTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDIAFLRTGKLMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHLQDSDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKVVDDNIRSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTE----GRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQ 3371          

HSP 2 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 464/660 (70.30%), Postives = 552/660 (83.64%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPD ++ L G+++L+VLRC+RPDK+VPAVQ FI++N+G+ FI+PP FDL  S+NDSNCC+PLIFVLSPGADPM  LLKF +D G     I +ISLGQGQGPIA +MI  AI+ G+WVVLQNCHLATSWM +LEKICEEII+PENTH+ FRLWLTSYPS+ FPVSILQNG+KMTNEPPKG+RANLLRSYLNDP+SD  FF+ C     W  +LFGLCFFHALVQERR FGPLGWNIPYEFNESDLRIS+RQ+QMFLN+Y E+P EALTYLTGECNYGGRVTDDKDRRLL+ LL I YN DI +++KY  S    Y  P  GT Q  ++YIRSLP+  +PEV+GLHENADITKDNQETNQLFSG+LLTLPRQ SG G+SP++ +++LA DIL KLP++F+LE +M++YPV+Y ESMNTVLRQELIRFN+L +VVRS+LINL KAIKG V+M+ ELE VFNSML+GKVP+ WA+KSYPSLKPLGSYV DL+ RL F   WI+N  P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GF+FE+T + N  D+   P DGA V GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +      ++TYLCPVYKTSARRGTLSTTGHSTN+VL+I+LP++  + HW NRGVA+LCQLDD
Sbjct: 3375 LPDKWQELNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPENTHEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKDI-QQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEVTRYRN--DVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 4031          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3939.81 bits (10216), Expect = 0.000e+0
Identity = 1929/3097 (62.29%), Postives = 2444/3097 (78.92%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSS-----EHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHI-VLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F + RF+   EL+S  LP+ P +FE V++R C E H+ L+  W+P CA LF  ++  W HL+P+    ++  V+ FFA IASLMS QLR MV  SL D   F  +H+NGN+FG  ++E++F    ++IV+L+V EPKI ++P+ +E   L+  C+  I++S      E   +VEV+LFP+++ + L L +V  +E LV++Y+++TM+ F  N VGP+ YLNVYKKY +LLN KA+ ++ +FLKE H L A  KKI++   L+ E++ + ++VPL+LF LD  RLN D+  R   L++ L+ F V+ENR +N+SIC +Y  I +KV+E+P+ TE LVA+ +FLR++    V++LK+E  EA  RL FLLDYAT+ +         F+WP  I  VF+V  NR+  +++Q E+DL  R  +FE++L+     IE FKK+E MT++EM+ NV+ L+EL   ++    + E +N EE +L WE+SQFP+L T + N  P+ +LW TA +FH K++ W+ G F +LNA  I  ++  M + M+KL K F D  G ++VA  +K KIDKFK HLP++ VICN GI++RHW+Q+SD++G+DI P  ++SL++ L YGL K++E+LE+IGA+A+KE+ LEK L KMK +W  + F    YR++  SILSA+DDIQ+LLDDHIIK+QTM GSPFIKP E E + WE  LV + +I+D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M E+VK+   L+AT Q +ML RL +SN LLE+IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFTE L+I GMIS+E E + +  KIYPAKAKGMVEKWLLQVE  M++S+++VI D I+ YV   R +WVL WPGQ+VICVS IYWTKEV+EAI     L  +L K N QI +IV+LVRG L+SG R TLGALTVIDVHARDVV  +A+ +VS+++ F+W+SQLRY   G +V V  I+TE+ YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQ+GAWACFDEFNRIE+EVLSVVAQQI SIQ AI + +K F FEGTEL+LNPTC++FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+D+F  A+KDN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ L+ AL D+ A  +M EY V+  +INPKAITMGQLYG FDPVSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S++   LP  L  +H ++I D+F WL+ PCLDFIR  CK L+ TS IH    + +L+  LLDEI N  S EE         + +S+Q I LWLQGLFLFS VW+IG ++    R KFD+F+R L  G++  +P+PKS+KLTK+N FPE+ ++YDF F K++ G W  W + I +E + I   AK++++IIPT ETARQT+FL  +L H  P++ VGPTGTGKS + N++L++LPK++Y+AN+INFSARTSANQTQDII +KLDRRRKG +GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHGHW+D+KDTS+L ++D L +SAMGPPGGGRND++ R  RH N++ ++ F+D T+ +IF +I DWHF  GFD  F R GKL++ +TM +YK A+ +FLPTP+KSHYVFNLRDFSRV++GVLL PHT+L + +KL+RLW+HEVYRVFYDRL   EDR  FF++VK TT++CFK +++K L HL+ +GKVVD+++R L FGDY    +D KIYDEIT LK+L   ME +L++YN++SKAPMSLVMF+FA+EHISR+CRVLKQDNGH LLVGIGGSGRQSAT++A FM  FE+F IEIT+NY  +EWRDD+K+++++AG   K  VFLF DNQIK E F+EDI+MLLNTGD+PN++P+DEKAEI+EKMQ  AR E    GRKI++TP+AMYN+FIE+VK NL    L+MSPIGDAFRNRLRMFPSLINCCTIDWFQ WP DALEMVANKFLED+ +D++ R+ +V MCK++ E+V+Q+S+ + NTLRR+NYVTPTSYLELI TFK LLN KR E+ T++NRY+ GLEKLEFAS +V  MQ EL ALQPELI TSA+T+K++ K+E++T+EV+AK+E+++A+++ AN  AA S+ IKD+CE DLAEAMP L  A+++LDTL Q+DITLV+SM NPP  +KLVME++C+M   KP+RKPD S TGKM+ED+W  S K+LGD KFLD LK F  D+++P  +KK+REK+I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L I ++QL  K+A+L  VE +LQ L D+L +   +K ELE+NIELC++KL RAE+LI GLGGEK RWTEAA++L  RY N+TGDVL+S+  VAYLG FTV +R+     W   C E  IPCS+ F +   LG+PVK+RAW IAGLPVDSFS+DNGIIV+NS R+PL IDPQGQANKWIKNMEK+N+L +IKL+D ++ RTLEN+IQFG PVLLEN+GEE++ +LEP+L K  F+QQGV+Y+RLG+N+IEY+KDF+ Y+TTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLSSSQGNILE+ETAI VLSSSKLLS+EISEKQ IA  T+ EID TR GYKPVAVH SI+FFCISD+ANI+PMYQYSL WFINL++ S+ +SEKSE+L  RIE +  HFT+S+Y N+CRSLFE  KLLFSL + I ++KG++K+ND++WRFLLTGGVALDNPYPNPA  W+SDK W+E+VRAS L  + G   H ++N  KWK++YDS  P+
Sbjct:  289 FDDLRFVRTEELLSGCLPLLPAEFEEVVQRHCREAHTALRNKWIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQNGNDFGDTYEEMKFCTPQILIVKLRVEEPKIAFEPALEECWALIKCCFLEILKSHYFVNFELYLQVEVDLFPDLQTENLTLSSVTQDESLVSNYINKTMEVFNLNIVGPQKYLNVYKKYSDLLNQKAQQDISSFLKEEHSLHAFTKKINSISQLRGEIASMHITVPLALFCLDALRLNEDLCARAQTLKDQLIQFVVDENRVLNKSICSKYSLIADKVNEVPSTTEELVALIDFLRKSRDVTVYKLKDEISEAASRLAFLLDYATLQF---------FYWPEQIETVFEVNNNRLMAKKDQAEDDLNKRRSEFEKKLQGYVTEIEAFKKRENMTLDEMKANVEKLNELDRNLNAALAEFEAINVEEELLEWEKSQFPLLQTAMLNKVPFEQLWITAYNFHCKSEEWMNGAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNMLEYGLSKYIERLEQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIA-EGTLPAFLEKSNQQIGEIVELVRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLSGALDDLHAANSMDEYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMN-TLPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVN--SSEEGN-------EPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKEELIIPTTAKVSDLIIPTMETARQTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFDIAFLRTGKLMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHLQDSDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKVVDDNIRSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTE----GRKIEATPLAMYNFFIEKVKANLSFFALSMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQ 3360          

HSP 2 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 464/660 (70.30%), Postives = 552/660 (83.64%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPD ++ L G+++L+VLRC+RPDK+VPAVQ FI++N+G+ FI+PP FDL  S+NDSNCC+PLIFVLSPGADPM  LLKF +D G     I +ISLGQGQGPIA +MI  AI+ G+WVVLQNCHLATSWM +LEKICEEII+PENTH+ FRLWLTSYPS+ FPVSILQNG+KMTNEPPKG+RANLLRSYLNDP+SD  FF+ C     W  +LFGLCFFHALVQERR FGPLGWNIPYEFNESDLRIS+RQ+QMFLN+Y E+P EALTYLTGECNYGGRVTDDKDRRLL+ LL I YN DI +++KY  S    Y  P  GT Q  ++YIRSLP+  +PEV+GLHENADITKDNQETNQLFSG+LLTLPRQ SG G+SP++ +++LA DIL KLP++F+LE +M++YPV+Y ESMNTVLRQELIRFN+L +VVRS+LINL KAIKG V+M+ ELE VFNSML+GKVP+ WA+KSYPSLKPLGSYV DL+ RL F   WI+N  P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GF+FE+T + N  D+   P DGA V GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +      ++TYLCPVYKTSARRGTLSTTGHSTN+VL+I+LP++  + HW NRGVA+LCQLDD
Sbjct: 3364 LPDKWQELNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPENTHEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKDI-QQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEVTRYRN--DVDEAPADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 4020          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3454.84 bits (8957), Expect = 0.000e+0
Identity = 1690/2583 (65.43%), Postives = 2080/2583 (80.53%), Query Frame = 1
Query: 1639 GPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQE--YKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            G F +LNA  I  ++  M + M+KL K F D  G ++VA  +K KIDKFK HLP++ VICN GI++RHW+Q+SD++G+DI P  ++SL++ L           E+IGA+A+KE+ LEK L KMK +W  + F    YR++  SILSA+DDIQ+LLDDHIIK+QTM GSPFIKP E E + WE  LV + +I+D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M E VK+   L+AT Q +ML RL +SN LLE+IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFTE L+I GMIS+E E + +  KIYPAKAKGMVEKWLLQVE  M++S+++VI D I+ YV   R +WVL WPGQ+VICVS IYWTKEV+EAI     L  +L K N QI +IV+LVRG L+SG R TLGALTVIDVHARDVV  +A+ +VS+++ F+W+SQLRY   G +V V  I+TE+ YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQ+GAWACFDEFNRIE+EVLSVVAQQI SIQ AI + +K F FEGTEL+LNPTC++FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+D+F  A+KDN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ L+         G + +  Y V+  +INPKAITMGQLYG FDPVSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S++   LP  L  +H ++I D+F WL+ PCLDFIR  CK L+ TS IH    + +L+  LLDEI N  S EE         + +S+Q I LWLQGLFLFS VW+IG ++    R KFD+F+R L  G++  +P+PKS+KLTK+N FPE+ ++YDF F K++ G W  W + I +E           E+IIPT    R+T+FL  +L H  P++ VGPTGTGKS + N++L++LPK++Y+AN+INFSARTSANQTQDII +KLDRRRKG +GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHGHW+D+KDTS+L ++D L +SAMGPPGGGRND++ R  RH N++ ++ F+D T+ +IF +I DWHF  GFD        L++ +TM +YK A+ +FLPTP+KSHYVFNLRDFSRV++GVLL PHT+L   +KL+RLW+HEVYRVFYDRL   EDR  FF++VK TT++CFK +++K L HL+ +GKVVD+++R L FGDY    +D KIYDEIT LK+L   ME +L++YN++SKAPMSLVMF+FA+EHISR+CRVLKQDNGH LLVGIGGSGRQSAT++A FM  FE+F IEIT+NY  +EWRDD+K+++++AG   K  VFLF DNQIK E F+EDI+MLLNTGD+PN++P+DEKAEI+EKMQ  AR E    GRKI++TP+AMYN+FIE+VK NLH+VLAMSPIGDAFRNRLRMFPSLINCCTIDWFQ WP DALEMVANKFLED+ +D++ R+ +V MCK++ E+V+Q+S+ + NTLRR+NYVTPTSYLELI TFK LLN KR E+ T++NRY+ GLEKLEFAS +V  MQ EL ALQPELI TSA+T+K++ K+E++T+EV+AK+E+++A+++ AN  AA S+ IKD+CE DLAEAMP L  A+++LDTL Q+DITLV+SM NPP  +KLVME++C+M   KP+RKPD S TGKM+ED+W  S K+LGD KFLD LK F  D+++P  +KK+REK+I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L I ++QL  K+A+L  VE +LQ L D+L +   +K ELE+NIELC++KL RAE+LI GLGGEK RWTEAA++L  RY N+TGDVL+S+  VAYLG FTV +R+     W   C E  IPCS+ F +   LG+PVK+RAW IAGLPVDSFS+DNGIIV+NS R+PL IDPQGQANKWIKNMEK+N+L +IKL+D ++ RTLEN+IQFG PVLLEN+GEE++ +LEP+L K  F+QQGV+Y+RLG+N+IEY+KDF+ Y+TTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLSSSQGNILE+ETAI VLSSSKLLS+EISEKQ IA  T+ EID TR GYKPVAVH SI+FFCISD+ANI+PMYQYSL WFINL++ S+ +SEKSE+L  RIE +  HFT+S+Y N+CRSLFE  KLLFSL + I ++KG++K+ND++WRFLLTGGVALDNPYPNPA  W+SDK W+E+VRAS L  + G   H ++N  KWK++YDS  P+
Sbjct:  201 GAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNIL-----------EQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVE-VKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIA-EGTLPAFLEKSNQQIGEIVELVRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLS---------GALDDLHYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMN-TLPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLDEIVN--SSEEGN-------EPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEKGSVYDFYFHKQASGQWNMWTDYITKE-----------ELIIPTTAKVRKTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFD-------ILMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHL---DKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKVVDDNIRSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTE----GRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQ 2725          

HSP 2 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 461/660 (69.85%), Postives = 548/660 (83.03%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPD ++ L G+++L+VLRC+RPDK+VPAVQ FI++N+G+ FI+PP FDL  S+NDSNCC+PLIFVLSPGADPM  LLKF +D G     I +ISLGQGQGPIA +MI  AI+ G+WVVLQNCHLATSWM +LEKICEEII+PENTH+ FRLWLTSYPS+ FPVSILQNG+KMTNEPPKG+RANLLRSYLNDP+SD  FF+ C     W  +LFGLCFFHALVQERR FGPLGWNIPYEFNESDLRIS+RQ+QMFLN+Y E+P EALTYLTGECNYGGRVTDDKDRRLL+ LL I YN DI +++KY  S    Y  P  GT Q  ++YIRSLP+  +PEV+GLHENADITKDNQETNQLFSG+LLTLPRQ SG G+SP++ +++LA DIL KLP++F+LE +M++YPV+Y ESMNTVLRQELIRFN+L +VVRS+LINL KAIKG V+M+ ELE VFNSML+GKVP+ WA+KSYPSLKPLGSYV DL+ RL F   WI+N  P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GF+FE+ +          P DGA V GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +      ++TYLCPVYKTSARRGTLSTTGHSTN+VL+I+LP++  + HW NRGVA+LCQLDD
Sbjct: 2729 LPDKWQELNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPENTHEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKDI-QQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEVNA----------PADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 3377          

HSP 3 Score: 68.1662 bits (165), Expect = 4.268e-10
Identity = 30/65 (46.15%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  235 WLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHK 429
            W+P CA LF  ++  W HL+P+    ++  V+ FFA IASLMS QLR MV  SL D   F  +H+
Sbjct:  109 WIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQ 173          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3354.69 bits (8697), Expect = 0.000e+0
Identity = 1660/2584 (64.24%), Postives = 2037/2584 (78.83%), Query Frame = 1
Query: 1639 GPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLL---DEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            G F +LNA  I  ++  M + M+KL K F D  G ++VA  +K KIDKFK HLP++ VICN GI++RHW+Q+       +  T +   +     G     +   +IGA+A+KE+ LEK L KMK +W  + F    YR++  SILSA+DDIQ+LLDDHIIK+QTM GSPFIKP E E   WE  LV + +I+D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M E+VK+   L+AT Q +ML RL +SN LLE+IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFTE L+I GMIS+E E + +  KIYPAKAKGMVEKWLLQVE  M++S+++VI D I+ YV   R +WVL WPGQ+VICVS IYWTKEV+EAI      +  L K N QI +IV+LVRG L+SG R TLGALTVIDVHARDVV  +A+ +VS+++ F+W+SQLRY   G +V V  I+TE+ YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQ+GAWACFDEFNRIE+EVLSVVAQQI SIQ AI + +K F FEGTEL+LNPTC++FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+D+F  A+KDN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ L+         G + +  +   +INPKAITMGQLYG FDPVSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S++   LP  L  +H ++I D+F WL+ PCLDFIR  CK L+ TS IH    + +L+  LL    E  N+P               +S+Q I LWLQGLFLFS VW+IG ++    R KFD+F+R L  G++  +P+PKS+KLTK+N FPE+ T                        S+S      ++++IIPT ETARQT+FL  +L H  P++ VGPTGTGKS + N++L++LPK++Y+AN+INFSARTSANQTQDII +KLDRRRKG +GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHGHW+D+KDTS+L ++D L +SAMGPPGGGRND++ R  RH N++ ++ F+D T+ +IF +I DWHF  GFD        L++ +TM +YK A+ +FLPTP+KSHYVFNLRDFSRV++GVLL+      + +KL+RLW+HEVYRVFYDRL   EDR  FF++VK TT++CFK +++K L HL+ +GKVVD+++R L FGDY    +D KIYDEIT LK+L   ME +L++YN++SKAPMSLVMF+FA+EHISR+CRVLKQDNGH LLVGIGGSGRQSAT++A FM  FE+F IEIT+NY  +EWRDD+K+++++AG   K  VFLF DNQIK E F+EDI+MLLNTGD+PN++P+DEKAEI+EKMQ  AR E    GRKI++TP+AMYN+FIE+VK NLH+VLAMSPIGDAFRNRLRMFPSLINCCTIDWFQ WP DALEMVANKFLED+E                  +V+Q+S+ + NTLRR+NYVTPTSYLELI TFK LLN KR E+ T++NRY+ GLEKLEFAS +V  MQ EL ALQPELI TSA+T+K++ K+E++T+EV+AK+E+++A+++ AN  AA S   KD+CE DLAEAMP L  A+++LDTL Q+DITLV+SM NPP  +KLVME++C+M   KP+RKPD S TGKM+ED+W  S K+LGD KFLD LK F  D+++P  +KK+REK+I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L I ++QL  K+A+L  VE +LQ L D+L +   +K ELE+NIELC++KL RAE+LI GLGGEK RWTEAA++L  RY N+TGDVL+S+  VAYLG FTV +R+     W   C E  IPCS+ F +   LG+PVK+RAW IAGLPVDSFS+DNGIIV+NS R+PL IDPQGQANKWIKNMEK+N+L +IKL+D ++ RTLEN+IQFG PVLLEN+GEE++ +LEP+L K  F+QQGV+Y+RLG+N+IEY+KDF+ Y+TTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLSSSQGNILE+ETAI VLSSSKLLS+EISEKQ IA  T+ EID TR GYKPVAVH SI+FFCISD+ANI+PMYQYSL WFINL++ S+ +SEKSE+L  RIE +  HFT+S+Y N+CRSLFE  KLLFSL + I ++KG++K+ND++WRFLLTGGVALDNPYPNPA  W+SDK W+E+VRAS L  + G   H ++N  KWK++YDS  P+
Sbjct:   66 GAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQVFLTNLLALSSTIKVGYICSKIMGGESTFKNFIQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEE--WEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVKDTRVLIATKQDNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIA-----EGTLPKSNQQIGEIVELVRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLS---------GALDDLHLK--VINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMN-TLPENLTSEHREMISDMFNWLLQPCLDFIRSECKFLVFTSPIHLAYSMMRLYTCLLVNSSEEGNEP---------------MSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEKGT------------------------SLST-----VSDLIIPTMETARQTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFD-------ILMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLLQRD--FDSDKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKVVDDNIRSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTE----GRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVE------------------TVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAAS---KDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQ 2551          

HSP 2 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 450/660 (68.18%), Postives = 531/660 (80.45%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPD ++ L G+++L+VLRC+RPDK+VPAVQ FI++N+G+ FI+PP FDL  S+NDSNCC+PLIFVLSPGADPM  LLKF +D G     I +ISLGQGQGPIA +MI  AI+ G+WVVLQNCHLATSWM +LEKICEEII+PENTH+ FRLWLTSYPS+ FPVSILQNG+KMTNEPPKG+RANLLRSYLNDP+SD  FF+ C     W  +LFGLCFFHALVQERR FGPLGWNIPYEFNESDLRIS+RQ+QMFLN+Y E+P EALTYLTGECNYGGRVTDDKDRRLL+ LL I YN DI +++KY  S    Y  P  GT Q  ++YIRSLP+  +PEV+GLHENADITKDNQETNQLFSG+LLTLPRQ SG G+SP+D    LA DIL KLP++F+LE +M++YPV+Y ESMNTVLR   +            LINL KAIKG V+M+ ELE VFNSML+GKVP+ WA+KSYPSLKPLGSYV DL+ RL F   WI+N  P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GF+FE+ +          P DGA V GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +      ++TYLCPVYKTSARRGTLSTTGHSTN+VL+I+LP++  + HW NRGVA+LCQLDD
Sbjct: 2555 LPDKWQELNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPENTHEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKDI-QQDKYRLSTGDTYCVPSYGTYQSCVDYIRSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQD----LAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRLTFL------------LINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEVNA----------PADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 3187          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3337.35 bits (8652), Expect = 0.000e+0
Identity = 1654/2583 (64.03%), Postives = 2035/2583 (78.78%), Query Frame = 1
Query: 1639 GPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQE--YKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            G F +LNA  I  ++  M + M+KL K F D  G ++VA  +K KIDKFK HLP++ VICN GI++RHW+Q+SD++G+DI P  ++SL++ L           E+IGA+A+KE+ LEK L KMK +W  + F    YR++  SILSA+DDIQ+LLDDHIIK+QTM GSPFIKP E E + WE  LV + +I+D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M E+V            +ML RL +SN LLE+IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFTE L+I GMIS+E E + +  KIYPAKAKGMVEKWLLQVE  M++S+++VI D I+ YV   R +WVL WPGQ+VICVS IYWTKEV+EAI     L  +L K N QI +IV+LVRG L+SG R TLGALTVIDVHARDVV  +A+ +VS+++ F+W+SQLRY   G +V V  I+TE+ YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQ+GAWACFDEFNRIE+EVLSVVAQQI SIQ AI + +K F FEGTEL+LNPTC++FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+D+F  A+KDN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ L+         G + +  Y V+  +INPKAITMGQLYG FDPVSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S++   LP  L  +H +++      L             K +    + DVV        ++DEI N  S EE         + +S+Q I LWLQGLFLFS VW+IG ++    R KFD+F+R L  G++  +P+PKS+KLTK+N FPE+                                          T  +  QT+FL  +L H  P++ VGPTGTGKS + N++L++LPK++Y+AN+INFSARTSANQTQDII +KLDRRRKG +GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHGHW+D+KDTS+L ++D L +SAMGPPGGGRND++ R  RH N++ ++ F+D T+ +IF +I DWHF  GFD        L++ +TM +YK A+ +FLPTP+KSHYVFNLRDFSRV++GVLL PHT+L   +KL+RLW+HEVYRVFYDRL   EDR  FF++VK TT++CFK +++K L HL+ +GKVVD+++R L FGDY    +D KIYDEIT LK+L   ME +L++YN++SKAPMSLVMF+FA+EHISR+CRVLKQDNGH LLVGIGGSGRQSAT++A FM  FE+F IEIT+NY  +EWRDD+K+++++AG   K  VFLF DNQIK E F+EDI+MLLNTGD+PN++P+DEKAEI+EKMQ  AR E    GRKI++TP+AMYN+FIE+VK NLH+VLAMSPIGDAFRNRLRMFPSLINCCTIDWFQ WP DALEMVANKFLED+ +D++ R+ +V MCK++ E+V+Q+S+ + NTLRR+NYVTPTSYLELI TFK LLN KR E+ T++NRY+ GLEKLEFAS +V  MQ EL ALQPELI TSA+T+K++ K+E++T+EV+AK+E+++A+++ AN  AA S+ IKD+CE DLAEAMP L  A+++LDTL Q+DITLV+SM NPP  +KLVME++C+M   KP+RKPD S TGKM+ED+W  S K+LGD KFLD LK F  D+++P  +KK+REK+I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L I ++QL  K+A+L  VE +LQ L D+L +   +K ELE+NIELC++KL RAE+LI GLGGEK RWTEAA++L  RY N+TGDVL+S+  VAYLG FTV +R+     W   C E  IPCS+ F +   LG+PVK+RAW IAGLPVDSFS+DNGIIV+NS R+PL IDPQGQANKWIKNMEK+N+L +IKL+D ++ RTLEN+IQFG PVLLEN+GEE++ +LEP+L K  F+QQGV+Y+RLG+N+IEY+KDF+ Y+TTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLSSSQGNILE+ETAI VLSSSKLLS+EISEKQ IA  T+ EID TR GYKPVAVH SI+FFCISD+ANI+PMYQYSL WFINL++ S+ +SEKSE+L  RIE +  HFT+S+Y N+CRSLFE  KLLFSL + I ++KG++K+ND++WRFLLTGGVALDNPYPNPA  W+SDK W+E+VRAS L  + G   H ++N  KWK++YDS  P+
Sbjct:  273 GAFQDLNAEDITEEVGNMWRNMYKLSKTFADMAGPKRVAENMKIKIDKFKMHLPIISVICNRGIKKRHWEQISDVVGYDITPAPDTSLLNIL-----------EQIGASASKEYSLEKALEKMKSEWSNINFVFIRYRETSTSILSAVDDIQLLLDDHIIKTQTMCGSPFIKPIEAEAREWEQTLVLIQEIMDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKNIMVEAVST---------DNMLGRLQESNVLLEDIQKGLNTYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTEDLQITGMISSENEIVPLSQKIYPAKAKGMVEKWLLQVEENMLSSMRQVIRDGIDGYVEVPRKQWVLQWPGQVVICVSSIYWTKEVSEAIA-EGTLPAFLEKSNQQIGEIVELVRGKLSSGARATLGALTVIDVHARDVVAKLAQDKVSNLSDFQWISQLRYSWEGQDVMVKMITTEVKYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQSGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRNMKTFFFEGTELTLNPTCSVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDLFIQALKDNIAKLKLQPVPWFIGKIIQIYEMMLVRHGFMIVGDPMGGKTCAYKVLS---------GALDDLHYAVELKVINPKAITMGQLYGCFDPVSHEWTDGVLATTFREQASSTTDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSAKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLQDSYMN-TLPENLTSEHREMVGIHVSLL----------ESDKTLTKQLLSDVV----FPCFIVDEIVN--SSEEGN-------EPMSSQQITLWLQGLFLFSVVWTIGGTINTDSRKKFDIFYRNLLMGLDEHHPRPKSVKLTKNNLFPEK-----------------------------------------GTSLSTVQTFFLKTYLEHSVPMLFVGPTGTGKSAITNSFLIKLPKNKYVANSINFSARTSANQTQDIIFSKLDRRRKGQFGPPVGKQAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDRKDTSRLDILDVLFVSAMGPPGGGRNDITGRFTRHLNIVTIDAFDDETLTKIFGSIADWHFSKGFD-------ILMIQATMAIYKAAVENFLPTPSKSHYVFNLRDFSRVVRGVLLCPHTHL---DKLIRLWIHEVYRVFYDRLIDPEDRQVFFNMVKETTSNCFKQSVDKALSHLAPTGKVVDDNIRSLFFGDYFKPDSDTKIYDEITDLKHLTSVMEHYLEEYNNVSKAPMSLVMFRFAIEHISRICRVLKQDNGHLLLVGIGGSGRQSATKLATFMNSFELFQIEITKNYTISEWRDDVKKVMLQAGVAGKNTVFLFCDNQIKDEGFVEDINMLLNTGDIPNIFPADEKAEIVEKMQAIARTE----GRKIEATPLAMYNFFIEKVKANLHMVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQTWPTDALEMVANKFLEDVALDDDIRKEVVSMCKYFQETVKQMSDRYYNTLRRHNYVTPTSYLELILTFKTLLNSKRQEVETMRNRYMVGLEKLEFASSQVSVMQKELTALQPELIKTSAETEKMMIKIEKETIEVDAKKELVSADEKVANEAAAASKAIKDECEGDLAEAMPALEAALSALDTLNQSDITLVKSMTNPPAPVKLVMESICVMKAIKPDRKPDPSGTGKMVEDFWGPSKKVLGDLKFLDGLKAFDKDNISPAVMKKIREKFIDNPDFQPSVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLKEAEGKLFIQMQQLNTKRAELKAVEDRLQALNDELSDMNNKKMELENNIELCSQKLVRAEKLISGLGGEKDRWTEAARLLGIRYNNLTGDVLLSSGTVAYLGAFTVDYRHECQNQWQILCKEKKIPCSDDFSLSSTLGDPVKVRAWQIAGLPVDSFSVDNGIIVSNSRRFPLMIDPQGQANKWIKNMEKANKLFVIKLSDASYTRTLENAIQFGNPVLLENLGEEIDAVLEPLLLKQTFKQQGVEYIRLGENIIEYSKDFRLYMTTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAANKKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKLLSEEISEKQQIASATEKEIDSTRMGYKPVAVHSSIIFFCISDLANIEPMYQYSLTWFINLYIHSLAHSEKSENLHERIENIIGHFTISIYNNVCRSLFEKDKLLFSLLLTIGIMKGEDKINDDVWRFLLTGGVALDNPYPNPASLWLSDKSWAEIVRASNLEPLSGFMNHVKDNISKWKTIYDSLKPQ 2745          

HSP 2 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 450/660 (68.18%), Postives = 534/660 (80.91%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPD ++ L G+++L+VLRC+RPDK+VPAVQ FI++N+G+ FI+PP FDL  S+NDSNCC+PLIFVLSPGADPM  LLKF +D G     I +ISLGQGQGPIA +MI  AI+ G+WVVLQNCHLATSWM +LEKICEEII+PENTH+ FRLWLTSYPS+ FPVSILQNG+KMTNEPPKG+RANLLRSYLNDP+SD  FF+ C     W  +LFGLCFFHALVQERR FGPLGWNIPYEFNESDLRIS+RQ+QMFLN+Y E+P EALTYLTGECNYGGRVTDDKDRRLL+ LL I YN DI +                           +SLP+  +PEV+GLHENADITKDNQETNQLFSG+LLTLPRQ SG G+SP++ +++LA DIL KLP++F+LE +M++YPV+Y ESMNTVLRQELIRFN+L +VVRS+LINL KAIKG V+M+ ELE VFNSML+GKVP+ WA+KSYPSLKPLGSYV DL+ RL F   WI+N  P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GF+FE+ +          P DGA V GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +      ++TYLCPVYKTSARRGTLSTTGHSTN+VL+I+LP++  + HW NRGVA+LCQLDD
Sbjct: 2749 LPDKWQELNGINRLVVLRCLRPDKMVPAVQEFISENMGKKFIEPPTFDLAGSYNDSNCCAPLIFVLSPGADPMAGLLKFADDLGMGGESIQTISLGQGQGPIAERMIHTAIKKGSWVVLQNCHLATSWMSALEKICEEIIVPENTHEKFRLWLTSYPSDKFPVSILQNGIKMTNEPPKGVRANLLRSYLNDPVSDPTFFNSCQKPQMWQKLLFGLCFFHALVQERRNFGPLGWNIPYEFNESDLRISMRQLQMFLNEYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLCLLSIVYNKDIQQD--------------------------KSLPLITHPEVFGLHENADITKDNQETNQLFSGVLLTLPRQTSGSGRSPQEIVEDLAKDILNKLPKDFNLEKVMEKYPVVYEESMNTVLRQELIRFNRLTAVVRSSLINLGKAIKGQVLMSAELENVFNSMLVGKVPSMWASKSYPSLKPLGSYVADLLSRLQFLQGWIDNGPPKVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFQFEVNA----------PADGAYVKGLFLEGARWDQQAMQIGESLPKILYDPLPIIWLKPGESSKFQHTNTYLCPVYKTSARRGTLSTTGHSTNYVLSIELPSDRPEKHWTNRGVAALCQLDD 3372          

HSP 3 Score: 68.1662 bits (165), Expect = 4.268e-10
Identity = 30/65 (46.15%), Postives = 40/65 (61.54%), Query Frame = 1
Query:  235 WLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHK 429
            W+P CA LF  ++  W HL+P+    ++  V+ FFA IASLMS QLR MV  SL D   F  +H+
Sbjct:  181 WIPACASLFTSQKDKWIHLVPQHDNDSTLQVQEFFACIASLMSLQLRGMVINSLQDLLSFFTLHQ 245          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3801.91 bits (9858), Expect = 0.000e+0
Identity = 1883/3090 (60.94%), Postives = 2416/3090 (78.19%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F N RF+   +L++  LP+ P +++ V+++ C E   +L   W+P CA+LF+ ++  W H  PK    +S  ++ +FA++AS MS QLR++V  SL D   F  IHK+GN+F   + E+ F    L++++L+V +P I++ P+F +   L+   +  I+++S+ IP+VE  LFP+++G  + L TV   E LV+ +LD+T++ FK N VGP  YLNVYKKY +LL+N AE  +  FLKE+H +      I++ +  K+E++ + ++VPL++F LD   LN D+ +R   L++ L+ ++V+ NRE N SIC +Y  I +KVSEIP +T  LVA+ E+L+++S   VF+L+ +  +A ERL FL+DYA +P EDIKLN+ LF WP  I +VF+ + N + ++R+Q E DL  R  +FE RLE  +K +E F+K+EVMT EEM+ NV+ L +L   +D    + E +NKEE +L  E+S FP+L T++ N  PY +LW TA +F  K++ W+ GP + +NA  I  +I  M +  +KL K   D P  +++A  VK KI+KFK H+P+L + CNPG+++RHW Q+SDI+G++IKPTE + L + L YG  K ++KLE IGAAA+KE+ LEK L KMK DW  M F   +YRD+  SIL A+DDIQ++LDDH+IK+QTM GS FIKP E E + WE+KLV + + +D WLK Q TWLYLEPIFSSEDI+AQMPEEG+KF  VD  WK +MA++V +   +VA  Q  M ++L ++N LLE+IQ+GLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFT+ LEI GMIS+E ET+  +  IYP KAKGMVEKWL QVE VM+ S+++VI + IE+YV   R  WVL+WPGQ+VICVS I+WT+EV+EA+ V + L D+L K N QI  IV+LVRG L+SG R+TLGALTVIDVHARDVV  +    ++S+N F+W+SQLRYY     V V  I+TE  YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE+EVLSVVAQQI SIQ AI + LKRF+FEGTELSLNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+++F  A+ +N+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ LAAAL D+ A   M+E+ V++ IINPKAITMGQLYG FD VSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS+KM+LIFEPADLEQASPATVSRCGMIYME  QLGW+P  +S+++  LP CL ++H +L+ D+F WL+ PCLDF R +CK +++TS IH    + +L+ SLLDEIR+    EE E  E      +S+Q I+LWLQGLFLFS VW++  ++    R KFDVFFR L  G++   P+PKS+KLTK+N FPER +IYDF F K+ GG+W  W   I +E  +I  +AK++++IIPT ETARQ++FL  +L HE P++ VGPTGTGKS + N++L+ LPK+ Y  N INFSARTSANQTQDIIM+KLDRRRKG++GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHG+WFDKKDT++L ++D LL++AMGPPGGGRND++ R  RH N++ +N F D  + +IF++I DWHF  GFD +F R GK+LV +T  +Y+ A+ +FLPTP+KSHYVFNLRDFSRVI+GVLL PHT+L + EK +RLW+HEVYRVFYDRL   +DR  FF++VK TT++CFK  +EK+L HLS +GK+ D+++R L FGDY+   +D KIYDEI  L+ L   ME +LD++NS+SKAPMSLVMF+FA+EHISR+CRVLKQ  GH LLVGIGGSGRQSAT+++ FM  +E++ IEIT+NY  ++WR+DLK++++++G   K  VFLFSDNQIK ESF+EDI+MLLNTGDVPN++P+DEKA+++EKMQ AAR E    G K+++TP++MYN+FIERV++NLHIVLAMSPIGDAFR RLRMFPSLINCCTIDWFQ+WP DALE+VANKFLED+E+D+N R  +V MCK++ ESV++LS ++ NTL R+NYVTPTSYLELI TFK LLN KR E+ T++NRYL GL+KLEFAS +V  MQ+EL ALQP+LI TS  T  ++ K+E +T E +AK+ ++ A++++AN  AA SQ IK++CE DLAEAMP L  A+A+LDTL  +DITLV+SM+NPP  +KLVME++C+M G KPERKPD S +GKMIEDYW  S K+LGD KFL+ LK +  D++    +K++RE++I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +LEI +++L +K+A+L  VE +LQDL D+ +   ++K  LE NIE+C++KL RAE+LI GLGGEK RWTEAA+ L  RY N+TGDVL+++  VAYLG FTV +R      W   C +  IP S  F + + LG+P+KIRAW IAGLPVDSFS+DNGIIV+NS RWPL IDPQGQANKW+KNMEK+N+LS+IK +D N+VRTLEN++QFGTPVLLENVGEEL+  +EPIL K  F+QQGV+Y+RLG+N+IEY+++FKFYITTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLS  +GNILE+ETAI +LSSSK+LS+EISEKQ IA VT+ +ID+TR GYKPVAVH + +FFCISD+A+I+PMYQYSL WFINL++ S+ NS KS++L+ RIEY+ +HFTLS+Y N+CRSLFE  KLLFSL + + LLK +  +++E+W FLLTGGVALDNP+PNPAP W+S+K W E+VRAS L  +KGL E    N   WK +YDS  P
Sbjct:  335 FQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFFIPQLIMIKLEVRDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPNEDIKLNSNLFLWPDQIEDVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLIDVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEAL-VEDTLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYWTEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMD-TLPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQE-EEMEIYEG-----LSSQQIFLWLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDDRNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEYITKEEETIPANAKVSDLIIPTMETARQSFFLKTYLDHEIPILFVGPTGTGKSAITNDFLLHLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLSPTGKITDDNIRSLFFGDYLKPESDQKIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTE----GEKVEATPLSMYNFFIERVRKNLHIVLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIPGSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWP 3411          

HSP 2 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 457/660 (69.24%), Postives = 540/660 (81.82%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LP  +  LQ L+K+ +LRC+RPDKIVPA+Q+FI + +G+ FI+ P FDL  S+ DS+CC PLIF+LSPGADPM  LLKF +D     +K  +ISLGQGQGPIAA MI++AI +GTWVVLQNCHLATSWM +LEKICEE+I+PENT+  FRLWLTSYPSE FPVSILQNG+KMTNEPPKGLRANLLRSYLNDPISD  FF  C     W  +LFGLCFFHA+VQERR +G LGWNIPYEFNESDLRIS+RQ+QMFLNDY E+P EALTYLTGECNYGGRVTDDKDRRLL+SLL +FY  +I E + Y  +P   Y  PP G+ Q YIEY+R+LPI  +PEV+GLHENADITKDNQETNQLF G+LLTLPRQ+ G GKSP++ ++ELA DIL KLP +F+LE +MK+YPV+Y ESMNTVLRQELIRFN+L  VVR +LI+L +AIKG V+M++ELEEVFNSML+GKVP  WAAKSYPSLKPLG YV DL+ RL FF +WI+   P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GFEFE+T     T ++  PEDGA + GLFLEGARWD+    +GESLPKIL++ +PIIWLKP +  +      Y+CPVYKTSARRG LSTTGHSTN+VL+I+LP ++ Q HWINRGVASLCQLD+
Sbjct: 3416 LPSPWFFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPENTNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI-ETDNYHIAPGDAYVIPPYGSYQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTP--KETTMENIPEDGAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4072          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3746.05 bits (9713), Expect = 0.000e+0
Identity = 1868/3115 (59.97%), Postives = 2400/3115 (77.05%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRV-------------------------EVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F N RF+   +L++  LP+ P +++ V+++ C E   +L   W+P CA+LF+ ++  W H  PK    +S  ++ +FA++AS MS QLR++V  SL D   F  IHK+GN+F   + E+ F    L++++L+V +P I++ P+F +   L+   +  I+++S+ IP+V                         E  LFP+++G  + L TV   E LV+ +LD+T++ FK N VGP  YLNVYKKY +LL+N AE  +  FLKE+H +      I++ +  K+E++ + ++VPL++F LD   LN D+ +R   L++ L+ ++V+ NRE N SIC +Y  I +KVSEIP +T  LVA+ E+L+++S   VF+L+ +  +A ERL FL+DYA +P E I+             +VF+ + N + ++R+Q E DL  R  +FE RLE  +K +E F+K+EVMT EEM+ NV+ L +L   +D    + E +NKEE +L  E+S FP+L T++ N  PY +LW TA +F  K++ W+ GP + +NA  I  +I  M +  +KL K   D P  +++A  VK KI+KFK H+P+L + CNPG+++RHW Q+SDI+G++IKPTE + L + L YG  K ++KLE IGAAA+KE+ LEK L KMK DW  M F   +YRD+  SIL A+DDIQ++LDDH+IK+QTM GS FIKP E E + WE+KLV + + +D WLK Q TWLYLEPIFSSEDI+AQMPEEG+KF  VD  WK +MA++V +   +VA  Q  M ++L ++N LLE+IQ+GLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFT+ LEI GMIS+E ET+  +  IYP KAKGMVEKWL QVE VM+ S+++VI + IE+YV   R  WVL+WPGQ+VICVS I+WT+EV+EA+ V + L D+L K N QI  IV+LVRG L+SG R+TLGALTVIDVHARDVV  +    ++S+N F+W+SQLRYY     V V  I+TE  YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE+EVLSVVAQQI SIQ AI + LKRF+FEGTELSLNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+++F  A+ +N+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ LAAAL D+ A   M+E+ V++ IINPKAITMGQLYG FD VSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS+KM+LIFEPADLEQASPATVSRCGMIYME  QLGW+P  +S+++  LP CL ++H +L+ D+F WL+ PCLDF R +CK +++TS IH    + +L+ SLLDEIR+    EE E  E      +S+Q I+LWLQGLFLFS VW++  ++    R KFDVFFR L  G++   P+PKS+KLTK+N FPER +IYDF F K+ GG+W  W   I +E  +I  +AK++++IIPT ETARQ++FL  +L HE P++ VGPTGTGKS + N++L+ LPK+ Y  N INFSARTSANQTQDIIM+KLDRRRKG++GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHG+WFDKKDT++L ++D LL++AMGPPGGGRND++ R  RH N++ +N F D  + +IF++I DWHF  GFD +F R GK+LV +T  +Y+ A+ +FLPTP+KSHYVFNLRDFSRVI+GVLL PHT+L + EK +RLW+HEVYRVFYDRL   +DR  FF++VK TT++CFK  +EK+L HLS +GK+ D+++R L FGDY+   +D KIYDEI  L+ L   ME +LD++NS+SKAPMSLVMF+FA+EHISR+CRVLKQ  GH LLVGIGGSGRQSAT+++ FM  +E++ IEIT+NY  ++WR+DLK++++++G   K  VFLFSDNQIK ESF+EDI+MLLNTGDVPN++P+DEKA+++EKMQ AAR E    G K+++TP++MYN+FIER     +  LAMSPIGDAFR RLRMFPSLINCCTIDWFQ+WP DALE+VANKFLED+E+D+N R  +V MCK++ ESV++LS ++ NTL R+NYVTPTSYLELI TFK LLN KR E+ T++NRYL GL+KLEFAS +V  MQ+EL ALQP+LI TS  T  ++ K+E +T E +AK+ ++ A++++AN  AA SQ IK++CE DLAEAMP L  A+A+LDTL  +DITLV+SM+NPP  +KLVME++C+M G KPERKPD S +GKMIEDYW  S K+LGD KFL+ LK +  D++    +K++RE++I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +LEI +++L +K+A+L  VE +LQDL D+ +   ++K  LE NIE+C++KL RAE+LI GLGGEK RWTEAA+ L  RY N+TGDVL+++  VAYLG FTV +R      W   C +  IP S  F + + LG+P+KIRAW IAGLPVDSFS+DNGIIV+NS RWPL IDPQGQANKW+KNMEK+N+LS+IK +D N+VRTLEN++QFGTPVLLENVGEEL+  +EPIL K  F+QQGV+Y+RLG+N+IEY+++FKFYITTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLS  +GNILE+ETAI +LSSSK+LS+EISEKQ IA VT+ +ID+TR GYKPVAVH + +FFCISD+A+I+PMYQYSL WFINL++ S+ NS KS++L+ RIEY+ +HFTLS+Y N+CRSLFE  KLLFSL + + LLK +  +++E+W FLLTGGVALDNP+PNPAP W+S+K W E+VRAS L  +KGL E    N   WK +YDS  P
Sbjct:  334 FQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFFIPQLIMIKLEVRDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVYLCWKPLASYICVSPHLRMTSVLQVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPSESIE-------------DVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLIDVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEAL-VEDTLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYWTEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMD-TLPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQE-EEMEIYEG-----LSSQQIFLWLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDDRNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEYITKEEETIPANAKVSDLIIPTMETARQSFFLKTYLDHEIPILFVGPTGTGKSAITNDFLLHLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLSPTGKITDDNIRSLFFGDYLKPESDQKIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTE----GEKVEATPLSMYNFFIERGTNRAYFSLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIPGSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWP 3422          

HSP 2 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 457/660 (69.24%), Postives = 540/660 (81.82%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LP  +  LQ L+K+ +LRC+RPDKIVPA+Q+FI + +G+ FI+ P FDL  S+ DS+CC PLIF+LSPGADPM  LLKF +D     +K  +ISLGQGQGPIAA MI++AI +GTWVVLQNCHLATSWM +LEKICEE+I+PENT+  FRLWLTSYPSE FPVSILQNG+KMTNEPPKGLRANLLRSYLNDPISD  FF  C     W  +LFGLCFFHA+VQERR +G LGWNIPYEFNESDLRIS+RQ+QMFLNDY E+P EALTYLTGECNYGGRVTDDKDRRLL+SLL +FY  +I E + Y  +P   Y  PP G+ Q YIEY+R+LPI  +PEV+GLHENADITKDNQETNQLF G+LLTLPRQ+ G GKSP++ ++ELA DIL KLP +F+LE +MK+YPV+Y ESMNTVLRQELIRFN+L  VVR +LI+L +AIKG V+M++ELEEVFNSML+GKVP  WAAKSYPSLKPLG YV DL+ RL FF +WI+   P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GFEFE+T     T ++  PEDGA + GLFLEGARWD+    +GESLPKIL++ +PIIWLKP +  +      Y+CPVYKTSARRG LSTTGHSTN+VL+I+LP ++ Q HWINRGVASLCQLD+
Sbjct: 3427 LPSPWFFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPENTNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI-ETDNYHIAPGDAYVIPPYGSYQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTP--KETTMENIPEDGAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4083          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah7c (dynein, axonemal, heavy chain 7C [Source:MGI Symbol;Acc:MGI:3639762])

HSP 1 Score: 3121.26 bits (8091), Expect = 0.000e+0
Identity = 1625/3112 (52.22%), Postives = 2162/3112 (69.47%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFP--EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNG---LKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPK-------SIKLTKSNSF----PERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE--HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPD-TSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   R ++I E       ++  +F+N++ +        L  +W P    ++          LP  +  +S  + +FF   A+LM+ QL++++  S+ DFT+ I             +  +  + P  I+ L + +  I ++P F +  D+L+  Y+ ++++   +PRVE  L+   E + +   L+ +I NE ++  + ++  +     +V P  +L +Y KY  L+  KAE ++  FL +      L ++I  YQ L++E+           +F +    L   + KR D +   L++     +++ +  +C  ++ I  K    P +T  L+ ++  +++  TT++  L++   ++   L FL++       DI+LN ++F W   +  +FD     I+++ EQ +E L+ R  +F E LE   K +E+F       + +M+R +Q    L  ++D   D+++Q N EE    W  S +P    +   L+PY RL+ TA++F  K+  W +GP+H++N   +E D+    + ++KL K F+D+P A  +  KV+  +++FK ++P++QVICNPG+  RHW+ MS I+G+ +KP+++S+++ F+   L   L++ E I  AA+KE+ LEK + KM  +W  M+F +  YR+SG  ILS++DDIQMLLDDHIIK+QTM+GSPFIKP+EK+M+ WE KL+ + +I+D WLKVQATWLYLEPIFSS DI++QMPEEGR+F  VD TW+++M   V++   L       ML+RL  SN LLE I KGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI ++EFTE L+I  M S+EGE + +V  I  AKA+G VEKWL+++E  MI S+ KVI D+I +Y    R  WV DWPGQ V+CVS  +WT EV  AI  P G   L+DYL KCN QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ ++A  ++S  + F+WLSQLRYY +   +    I+  L YG EYLGN+PRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G    VFEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENE ILLL++I DVNLPKFLS D+PLFEGI SDLFPGV LPK D++   +A++DN     LQ  ++F +KILQIYEM++VRHG MIVGEPFGGKT AY+ LA AL DI   G M+E KV   ++NPK++TMGQLYGQFD VSHEW+DGVLA+ FR FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +MNLIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S+I   LP  ++    + I  LF+ ++   ++FIR + K+L  TS+ + V  L  L    +D+  ++   +E   QE            +  L+G+FLFS +WS+G++  +  R KFD   REL  G  P+  + +       S + T S +F    PE+ TIYD+ F  +  G W +W+  +  ++  I  D + NEII+PT +T R +  + L  TH+KP I VGPTGTGKSV I N+L+ +L KD Y    +NFSA+T+A QTQ+IIM+KLD+RRKGV+GPP  KR +VFVDD+NMPA+E YGAQPPIELLRQW+DH +W+D KD S + L+D  ++ AMGPPGGGRN ++ R +RHFN++ +NEF+D +M  IF+ I+ WH    + F   F  +   +V+ TM +YK A+ + LPTPAKSHY+FNLRDFSRVI+GV L       N E + RLWVHEV RV+YDRL    DR    + ++    +  + +   +  +L  +  G V ++D+R L+F D+     +D  Y E+ ++  L   +E  LD+YN++SK PM+LV+F+FA+EHISR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+ +F +EI++ YG +EW +DLK +L K   +    VFLF+D QIK+ESF+ED++ LLN G+VPNL+  DEK EI EKM+   R  +K   ++ D +PIA++N FI+R +  LH+VLAMSPIGDAFR RLR FP+L+NCCTIDWFQ+WPEDALE VA++FLEDIEM E T+E  + MCK +H S   LS  F N L+RYNYVTPTSYLELI TFK LL  KRNE++ +K RY  GL+KL+ AS +V  MQ EL+AL P+L V S + D+++  +E++++EV    +I+ A++  AN +A  ++ IKD+C+ADLAEA+PIL  A+A+LDTL   DIT+V+SMK+PP  +KLVMEAVCI+ G K ++ PD T +GK IED+W  + +LLGD +FL  L  +  D++ P  +  +R+ YIP PDF P+ +RNASTA EGLCKW+IA+D YD  AKIVAPKK+KLA AE +L I ++ L +K+A L EV+ KL  L D L+  +Q+K +LE+ ++LC+KKL+RAEQLIGGLGGEK+RW+ +A  L   Y N+TGD+L+S+ VVAYLG FT  +R +  + W + C E  IPCS+ + +M  LGE V IRAWNIAGLP DSFSIDNGII+ N+ RWPL IDPQGQANKWIKNMEK+N L +IKL+D ++VRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY  DF+FYITT+LRNPHYLPE S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ ADNKR+LKE+ED+ILEVLS S+GNILE+ETAI +LSSSK L+ EIS+KQ +AE T+ +ID TR GY+ +A+H SILFF I+D+ANI+PMYQYSL WFINLF++SIENSEKS+ L  R++ L DHFT S+Y NICRSLFE  KLLFS  + + LL   N +N   WRFLLTGG+ LDNPY NP   W+  K W E+ R  +LP+ K +R  F    D WK +YDS  P
Sbjct:  289 FKKLRLVDIEEFHKRQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIYYKGNK--KKQLP--TGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLI---------AQPPESTRAFEHPGFIMRLVLDKDNISFEPEFNDYIDILVNIYEIMIKAVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDGHKEKIREVILRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADIICGKLIAKMFRNHQKESTMLCDEFEKIAEKALSTPLNTAELMEMKADIQKVETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHT--FGDLMDMQRYLQKAQVLNSKLDAAADKIDQFNAEEEAYGWVPSVYPQRKKIQDALNPYLRLYETAVEFSAKHKWWTEGPYHKVNPDQVETDVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLHPRHWEAMSTIVGYPLKPSDDSTVLSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWNSMEFVIHPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDMMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIAAYTKYSRISWVRDWPGQTVLCVSQTFWTVEVQTAI--PKGHQALEDYLAKCNQQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLADKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPN-ENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWIN-TLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVHSLMNLIDCFMDDFADENKQKERNDQES-----------FSLLEGIFLFSLIWSVGATCTDDDRMKFDKILRELMEG--PISDQTRNKFTLLSSTEQTSSKAFIVPFPEKGTIYDYQFILEDLGRWDKWIKKL-ADTPPIPKDVQFNEIIVPTLDTVRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDMTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRGWLINYIQGILKNYMQEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREVENVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKT--KQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEETQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNLINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEP 3363          

HSP 2 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 405/665 (60.90%), Postives = 514/665 (77.29%), Query Frame = 2
Query: 9362 HRNCFLPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEG-KSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            H   F  D         +++++RC+RPDK++P +Q FI   LG+ FI+PPPFDL  +F DSNCC+PLIFVLSPGADPMNALLKF +DQGY  SK++S+SLGQGQGPIA KM+++A++DGTWVVLQNCHLATSWM +LEK+CEE+  PE+TH +FR+WLTSYPS +FPVS+LQNGVKMTNE PKGLRAN++RSYL DPISD +FFD C     +  +L+GLCFFHALVQERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFL+ Y ELP +AL Y+TGECNYGGRVTDD DRR L S+L  F+  ++VE  +Y F  SGIY+ PP G  + YI+Y ++LP+ P PEV+G++ NADITKD  ET  LF  ILLT   Q+SG G KS ++ + E+A DIL KLP NFD+E  M+RYP  Y++SMNTVL QE+ RFNKL+  +R + IN+QKAIKGLVVM+ ELEEV +S+L  K+P  W  KSYPSLKPLGSYVND ++RL F   W E   P  FW+SGF+FTQ+FLTG  QN+ARK+TIPID + F++E+    +  + K  PEDG  ++GLFL+GA WD++ K L ES PK+L++++P++WLKP K   I +  +Y+ P+YKTS RRGTLSTTGHSTNFV+ + LP++  + HWI RGVA LCQL+
Sbjct: 3364 HHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELN-PESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFDSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFIPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLT-QSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLAFDYEVM---DDKEYKNAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDISKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah7a (dynein, axonemal, heavy chain 7A [Source:MGI Symbol;Acc:MGI:2685838])

HSP 1 Score: 3111.63 bits (8066), Expect = 0.000e+0
Identity = 1624/3110 (52.22%), Postives = 2156/3110 (69.32%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFP--EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXX-XXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNG---LKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGG--INPLYPKPKSIKLTKSNS-------FPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE--HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPD-TSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   R ++I E  S    ++  +F+N++ +        L  +W P    +F ++      L   +ST     + +FF   A+LM+ QL++++  S+ DFT+ I             + ++  + P  I+ L + +  I ++P F E  D LI  Y+ ++++   +PRVE  L+   E + +   L+ +I NE ++ ++ ++  +     +V P  +L +Y KY  L+  KAE ++   L +      L ++I  YQ L +E+         L +F +    L   + KR D +   L++    +++E+N  +C  ++ I  K    P +T  L+ ++  +++  TT++  L +   ++   L FL++       DI+LN ++F W   +  +FD     I+ + E  +E L+ R  +F E LE   K +E+F       + +++R +Q    L G++D   D+++Q N EE    W  S +P    +   L+PY  L+ TA++F  K+  W +GP+H++N   +E D+    + ++KL K F+D+P A  +  KV   +++FK ++P++QV CNPG++ RHW+ MS I+G+ ++P+++S++  F+   L   L++   I  AA+KE+ LEK + KM  +W  M+F +  YR+SG  ILS++DDIQMLLDDHIIK+QTM+GSPFIKP+EK+M+ WE KL+ + +I+D WLKVQATWLYLEPIFSS DI++QMPEEGR+F  VD TW++VM   V++   L       ML+RL  SN LLE I KGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI ++EFTE L+I  M S+EGE + +V  I  AKA+G VEKWL+++E  MI S+ KVI D+I +Y  T R  WV DWPGQ V+CVS  +WT EV   I +P G   L+ YL KCN QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ ++   ++S  + F+WLSQLRYY +   +    I+  L YG EYLGN+PRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G    VFEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENE ILLL++I DVNLPKFLS D+PLFEGI SDLFPGV LPK D++   +A++DN     LQ  ++F +KILQIYEM++VRHG MIVGEPFGGKT AY+ LA AL DI   G M+E KV   ++NPK++TMGQLYGQFD VSHEW+DGVLA+ FR FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +MNLIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S+I   LP  ++    + I  LF+ ++   ++FIR + K+L  TS+ + V  L  L    +D+  ++   +E   +E            +  L+G+FLFS +WS+G++  +  R KFD   REL  G   N    K K +  T+  S       FPE+ TIYD+ F  +  G W +W+  +  ++  I  D + NEII+PT +T R +  ++L  TH+KP I VGPTGTGKSV I N+L+ +L KD Y    +NFSA+T+A QTQ+IIM+KLD+RRKGV+GPP  KR +VFVDD+NMPA+E YGAQPPIELLRQW+DH +W+D KD S + L+D  ++ AMGPPGGGRN ++ R +RHFN++ +NEF++ +M  IF+ I+ WH    + F   F  L   +V+ TM +YK A+ + LPTPAKSHY+FNLRDFSRVI+GV L       N E + RLWVHEV RV+YDRL    DR    + ++    +  + +   +  +L  +  G V ++D+R L+F D+     +D  Y EI ++  L   +E  LD+YN++SK PM+LV+F+FA+EHISR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+ +F +EI++ YG +EW +DLK +L K        VFLF+D QIK+ESF+ED++ LLN G+VPNL+  DEK EI EKM+   R  +K   ++ D +PIA++N FI+  +  LH+VLAMSPIGDAFR RLR FP+L+NCCTIDWFQ+WPEDALE VA++FLEDIEM E  RE  + MCK +H S   LS  F N L+RYNYVTPTSYLELI TFK LL  KRNE++ +K RY  GL+KL+ AS +V  MQ EL+AL P+L V S + D+++  +E++++EV    +I+ A++  AN +A  ++ IKD+C+ADLA A+PIL  A+A+LDTL   DIT+V+SMK+PP  +KLVMEAVCI+ G K ++ PD T +GK  ED+W  + +LLGD +FL  L  +  D++ P  +  +R+ YIP PDF P+ +RNASTA EGLCKW+IA+D YD  AKIVAPKK+KLA AE +L++ ++ L +K+A L EV+ KL  L D L+  +Q+K +LE  ++LC+KKL+RAEQLIGGLGGEK+RW+ +A  L   Y N+TGD+L+S+ VVAYLG FT  +R +  + W + C E  IPCS+ + +M  LGE V IRAWNIAGLP DSFSIDNGII+ N+ RWPL IDPQGQANKWIKNMEK+N L +IKL+D ++VRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY+ DF+FYITT+LRNPHYLPE S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ ADNKR+LKE+ED+ILEVLS S+GNILE+ETAI +LSSSK L+ EIS+KQ +AE T+ +ID TR GY+P+A+H SILFF I+D+ANI+PMYQYSL WFINLF++SIENSEKS+ L  R++ L DHFT S+Y NICRSLFE  KLLFS  + + LL   N +N   WRFLLTGG+ LDNPY NP   W+  K W E+ R  +LP+ K +RE F    D WK +YDS  P
Sbjct:  289 FKKLRLVDIEEFHSCQDALELSEFQNIVIKHMESAKETLLKTWFPEVQNIF-NQGNKKKQLPTGKSTAK---LDSFFNCAATLMTLQLQDLILVSMQDFTDLI---------AQPLESIRVFEHPGFIMRLVLDKEAIKFEPEFNEYIDSLINIYEIMIKAVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDTHKEKIREVILRESVAPTEHLKMYDKYQFLITGKAERDIDELLFQNQNYERLIEEIRKYQKLGEEIQYTSQKTVCLGMFEMHCEELIRSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSTPLNTAELMEMKAHVQKLETTDMLELGQRLVDSKICLAFLIECVNFSPADIRLNKSVFQWYGRMGEIFDEHRKIIKEKTELYQEFLKFRCERFVEELESYAKQVEEFHA--FGDLLDVQRYLQKAQVLNGKLDAAADKIDQFNAEEEAFGWVPSAYPQRKKIQDALNPYLHLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVHSMVEEFKQYIPLIQVFCNPGLRPRHWEAMSTIVGYPLQPSDDSTVFSFIDMNLEPFLDRFGSISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSRDIMSQMPEEGRRFTAVDKTWRDVMKTVVQDKQVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIRDAIVAYTKTSRISWVRDWPGQTVLCVSQTFWTVEV--QIAIPEGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTDLLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPN-ENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRDNCHSMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGVLAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWIN-TLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDRES-----------FSLLEGIFLFSLIWSVGATCTDDDRLKFDKILRELLEGPISNLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYDYQFIPEGLGRWDKWIKDL-ADTPPIPKDVQFNEIIVPTLDTIRYSALMNLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSNKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLINYIQEILKNYMQEDFHDLFKNLDFNHDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAESDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQIDRQRDK--SKQTDGSPIALFNMFIDCCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAVCILKGIKADKIPDPTGSGKKTEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLKVAMEGLRKKQAALHEVQDKLAKLQDTLELNKQKKADLEHQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTKQWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPSYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYSPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDITRMGYRPIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHDNAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIREEFMRLKDGWKKVYDSMEP 3363          

HSP 2 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 400/664 (60.24%), Postives = 509/664 (76.66%), Query Frame = 2
Query: 9362 HRNCFLPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            H   F  D         +++++RC+RPDK++P +Q FI   LG++FI+PPPFDL  +F DSNCC+PLIFVLSPGADPMNALLKF +DQGY  SK++S+SLGQGQGPIA KM+++A++DGTWVVLQNCHLATSWM +LEK+CEE+   E+TH +FR+WLTSYPS +FPVS+LQNGVKMTNE PKGLRAN++RSYL DPISD +FF  C     +  +L+GLCFFHALVQERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFL+ Y ELP +AL Y+TGECNYGGRVTDD DRR L S+L  F+  ++VE  +Y F  SGIY+ PP G  + YI+Y ++LP+ P PEV+G++ NADITKD  ET  LF  ILLT    +    KS ++ + E+A DIL KLP NFD+E  M+RYP  Y++SMNTVL QE+ RFNKL+  +R + IN+QKA+KGLVVM+ ELEEV +S+L  K+P  W  KSYPSLKPLGSYVND ++RL F   W E   P  FW+SGF+FTQ+FLTG  QN+ARK+TIPID +GF++E+    +  + K  PEDG  ++GLFL+GA WD++ K L ES PK+L++++P++WLKP K   I R  +Y+ P+YKTS RRGTLSTTGHSTNFV+ + LP+   + HWI RGVA LCQL+
Sbjct: 3364 HHEMFPEDWGNKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELS-AESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIDYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLTQSHSSGSGTKSSDEVVNEVAGDILGKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAVKGLVVMSTELEEVVSSILNVKIPAMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVM---DDKEYKKAPEDGVYIHGLFLDGASWDRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPRRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSVHPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3111.63 bits (8066), Expect = 0.000e+0
Identity = 1623/3111 (52.17%), Postives = 2163/3111 (69.53%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFP--EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKK-KEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNG---LKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELT-GGINPLYP-KPKSIKLTKSNS-------FPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE--HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPD-TSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   R ++I E  +    ++  +F+N++ +       +L  +W P    ++          LP  +  +S  + +FF   A+LM+ QL++++  S+ DFT+ I             +  +  + P  I+ L + +  I + P F +  D+LI  Y+ +++    +PRVE  L+   E + +   L+ +I NE ++ ++ ++  +     +V P  +L +Y KY  L+  KAE ++  FL +      L ++I  YQ L++E+           +F +    L   + KR D +   L++    +++E+N  +C  ++ I  K   +P +T  L+ ++  +++  TT++  L++   ++   L FL++       DI+LN ++F W   +  +FD     I+++ EQ +E L+ R  +F E LE   K +E+F    +++ ++   +  Q L+   G++D   D++EQ N EE    W  S +P    +   L+PY RL+ TA++F  K+  W +GP+H++N   +E D+    + ++KL K F+D+P A  +  KV+  +++FK ++P++QVICNPG++ RHW+ MS I+GF + P+++S++  F+   L   L++ E I  AA+KE+ LEK + KM  +W  M+F +  YR+SG  ILS++DDIQMLLDDHIIK+QTM+GSPFIKP+EK+M+ WE KL+ + +I+D WLKVQATWLYLEPIFSS DI++QMPEEGR+F  VD TW++VM   V++   L       ML+RL  SN LLE I KGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI ++EFTE L+I  M S+EGE + +V  I  AKA+G VEKWL+++E  MI S+ KVI D+I +Y    R  WV DWPGQ V+CVS  +WT EV  AI  P G   L+ YL KCN QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ ++   ++S  + F+WLSQLRYY +   +    I+  L YG EYLGN+PRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G +  VFEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHY+YGMRAVKSVLTAAGNL+ K P+ ENE ILLL++I DVNLPKFLS D+PLFEGI SDLFPGV LPK D++   +A+++N     LQ  ++F +KILQIYEM++VRHG MIVGEPFGGKT AY+ LA AL DI   G M+E KV   ++NPK++TMGQLYGQFD VSHEW+DG+LA+ FR FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +MNLIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S+I   LP  ++    + I  LF+ ++   ++FIR + K+L  TS+ + V  L  L    +D+  ++   +E   +E            +  L+G+F+FS  WS+G++  +  R KFD   REL  G I+ L   K K +  T+  S       FPE+ TIY++ F  +  G W +W+  +  ++  I  D +  EII+PT +T R +  + L  TH+KP I VGPTGTGKSV I N+L+ +L KD Y    +NFSA+T+A QTQ+IIM+KLD+RRKGV+GPP  KR +VFVDD+NMPA+E YGAQPPIELLRQW+DH +W+D KD S + L+D  ++ AMGPPGGGRN ++ R +RHFN++ +NEF+D +M  IF+ I+ WH    + F   F  L   +V+ TM +YK A+ + LPTPAKSHY+FNLRDFSRVI+GV L       N E + RLWVHEV RV+YDRL    DR      ++    +  + +   +  +L  +  G V ++D+R L+F D+     +D  Y EI ++  L   +E  LD+YN++SK PM+LV+F+FA+EHISR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+ +F +EI++ YG +EW +DLK +L K   +    VFLF+D QIK+ESF+ED++ LLN G+VPNL+  DEK EI EKM+   R  +K   R+ D +PIA++N FI+R +  LH+VLAMSPIGDAFR RLR FP+L+NCCTIDWFQ+WPEDALE VA++FLEDIEM E  +E  + MCK +H S   LS  F N L+RYNYVTPTSYLELI TFK LL  KRNE++ +K RY  GL+KL+ AS +V  MQ EL+AL P+L V S + D+++  +E++++EV    +I+ A++  AN +A  ++ IKD+C+ADLAEA+PIL  A+A+LDTL   DIT+V+SMK+PP  +KLVMEA+CI+ G K ++ PD T +GK IED+W  + +LLGD +FL  L  +  D++ P  +  +R+ YIP PDF P+ +RNASTA EGLCKW+IA+D YD  AKIVAPKK+KLA AE +L I ++ L +K+A L EV+ KL  L D L+  +Q+K +LE+ ++LC+KKL+RAEQLIGGLGGEK+RW+ +A  L   Y N+TGD+L+S+ VVAYLG FT  +R +  + W + C E  IPCS+ + +M  LGE V IRAWNIAGLP DSFSIDNGII+ N+ RWPL IDPQGQANKWIKNMEK+N L +IKL+D ++VRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY  DF+FYITT+LRNPHYLPE S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ ADNKR+LKE+ED+ILEVLS S+GNILE+ETAI +LSSSK L+ EIS+KQ +AE T+ +ID TR GY+ +A+H SILFF I+D+ANI+PMYQYSL WFINLF++SIENSEKS+ L  R++ L DHFT S+Y NICRSLFE  KLLFS  + + LL  +N +N   WRFLLTGG+ LDNPY NP   W+  K W E+ R  +LP+ K +R  F    D WK +YDS  P
Sbjct:  333 FKKLRLVDIEEFHNRQDSLELSEFQNIVIKHMESAKEMLLKTWFPEVQNIYYKGNK--KKQLP--TGKSSAKLDSFFNCAATLMTLQLQDLILVSMQDFTDLI---------AQPPESTRAFEHPGFIMRLILDKKTIKFAPDFNDYIDILINVYEIMIKMVSFVPRVETKLYSQWESKSKPTTLKPIILNE-IIDTHKEKIREVVLRESVAPTEHLKMYDKYQFLITGKAERDIDEFLFQSQNYERLIEEIRKYQKLEEEIQYTSRKAVRLGMFEMHCEELIKSLVKRADVICGKLIAKMFRDHQEVNTMLCDEFEKIAEKALSMPLNTAELMEMKAHVQKLETTDMLELRQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEALKFRCERFVEELESYAKQVEEFHTFGDLLDVQRYLKKAQVLN---GKLDAAADKIEQFNAEEEAYGWVPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRGWTEGPYHKVNPDQVEADVGNYWRGLYKLEKVFHDSPNALAMTKKVQSMVEEFKQYIPLIQVICNPGLRPRHWEAMSTIVGFPLLPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKAMDKMMTEWDSMEFVILPYRESGTYILSSVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFKAVDKTWRDVMKTVVQDKRVLAVVTIERMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELVDTISTAKARGQVEKWLVELERTMIKSIHKVIGDAIAAYTKNSRISWVRDWPGQTVLCVSQTFWTVEVQTAI--PKGHRALEGYLAKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLASLVDKKISDDSDFQWLSQLRYYWQENNLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYNYGMRAVKSVLTAAGNLKLKYPN-ENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNELLAAIRENCHTMNLQMTDFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMVSWIN-TLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVQSLMNLIDCFMDDFADENKQKERNDRES-----------FSLLEGIFMFSLAWSVGATCTDDDRLKFDKILRELMEGPISDLTRNKFKLLSGTEQTSSKVFIVPFPEKGTIYEYQFIPEGLGRWDKWIKKL-ADTPPIPKDVQFIEIIVPTLDTIRYSALMHLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSVIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIVTINEFSDKSMFTIFSRILAWHLRTCYKFPDDFLDLTTQIVNGTMALYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLVDNADRSWLIHYIQEILKNYMQEDFHDLFKNLDFNQDGTVEEDDLRSLMFCDFHDPKREDFGYREIANVDALRMIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAENDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKT--RQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIQEGCIDMCKRFHTSTINLSTSFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQSELEALHPQLKVASREVDEMMIIIERESMEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGKLRIAMEGLRKKQAALYEVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYINLTGDILISSGVVAYLGAFTSNYRQNQTQEWSQSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQSLIVQGADNKRQLKEIEDKILEVLSLSEGNILEDETAIKILSSSKSLANEISQKQEVAEETEKKIDNTRMGYRIIAIHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSKRLQILRDHFTYSLYVNICRSLFEKDKLLFSFCLTVNLLIHENAINKTEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSMEP 3407          

HSP 2 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 404/665 (60.75%), Postives = 512/665 (76.99%), Query Frame = 2
Query: 9362 HRNCFLPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEG-KSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            H   F  D         +++++RC+RPDK++P +Q FI   LG+ FI+PPPFDL  +F DSNCC+PLIFVLSPGADPMNALLKF +DQGY  SK++S+SLGQGQGPIA KM+++A++DGTWVVLQNCHLATSWM +LEK+CEE+   E+TH +FR+WLTSYPS +FPVS+LQNGVKMTNE PKGLRAN++RSYL DPISD +FF  C     +  +L+GLCFFHALVQERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFL+ Y ELP +AL Y+TGECNYGGRVTDD DRR L S+L  F+  ++VE  +Y F  SGIY+ PP G  + YI Y ++LP+ P PEV+G++ NADITKD  ET  LF  ILLT   Q+SG G KS ++ + E+A DIL KLP NFD+E  M+RYP  Y++SMNTVL QE+ RFNKL+  +R + IN+QKAIKGLVVM+ ELEEV +S+L  K+P  W  KSYPSLKPLGSYVND ++RL F   W E   P  FW+SGF+FTQ+FLTG  QNFARK+TIPID +GF++E+    +  + K  PEDG  ++GLFL+GA W+++ K L ES PK+L++++P++WLKP K   I +  +Y+ P+YKTS RRGTLSTTGHSTNFV+ + LP++  + HWI RGVA LCQL+
Sbjct: 3408 HHEMFPEDWENKANDFQRMLIIRCLRPDKVIPMLQEFIIKKLGRPFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELS-AESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLDQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYINYTKTLPLIPAPEVFGMNANADITKDQSETQLLFDNILLT-QSQSSGSGTKSSDEVVNEVAGDILSKLPNNFDVEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPVMWMGKSYPSLKPLGSYVNDFLERLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNFARKFTIPIDLLGFDYEVM---DDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4067          
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 3760.3 bits (9750), Expect = 0.000e+0
Identity = 1870/3122 (59.90%), Postives = 2406/3122 (77.07%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVE-------------------------------VNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F + RF+   E+++  LP+QP +F +VI++ C E H  L   W+P CA+LF  ++  W H  PK +  +S  ++ +FA++AS MS QLR +V  SL D      IHK+GN+F   + E++F    L++++L+V+EP I++ PSF    +L+   +  I+++S  IP+++                                    E++G  L L TV   EKLV+ +L +T + F+ N VGP  YLNVYKKY +LL+N AE  + AFLKE H +     KI+A +  ++E++ + ++VPL++F LD   LN D+ +R   L++ L+ F+V+ NR+ N SIC +Y  I +KVSE+P +T+ LV++ EFL+++S   VF+L+ +  +A ERL FL+DYA +PY+              I ++FD + N + ++R+Q E DL  R  +FE RLE   + +E F+K+EVMT EEM+ NV+ L+EL   ++    + E +NKEE +L  E+S +P+L  M+KN  PY +LW TA +F IK++ W+ GP   LNA  I  +I  M +  +KLIK  +D P  +++A  VK KIDKFK ++P+L + CNPG+++RHW Q+S+I+G++IKPTE + L + L +G  K +EKLE IGAAA+KE+ LEK L +MK DW  + F   +YRD+  +IL A+DDIQMLLDDH+IK+QTM GSPFIKP E E + WE+KL+ + D +D WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK +M+++VK+   LVA  Q  M ++L ++N LLE+IQKGLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFT+ LEI+GMIS+E ET+  + KIYPA AKGMVEKWL QVE +M+ S+++VI   IE+YV   R  WVL WPGQ+VICVS I+WT+EV++A+   N L D+L K N QI  IV+LVRG L+SG R+TLGALTVIDVHARDVV  +++ +VS +N F+W+SQLRYY    +V V  I+TE  YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE+EVLSVVAQQI SIQ AI + LK F+FEGTELSLNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+++F   + DN+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ LAAAL D+ A   M+E+ V+Y IINPKAITMGQLYG FD VSHEW DGVLA  FRE A +  D RKW++FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM++KM+LIFEPADLEQASPATVSRCGMIYMEP QLGW+P  +S+++  LP  L ++H +L+ D+F WL+ PCL+F R +CK +++TS IH    + +L+ SLLDEIR        E +E    + +S+Q I+LWLQGLFLFS VW++  ++    R KFDVFFR L  G++  +P+PKS+KLTK+N FPER +IYDF F K++ G+W+ W   I +E   +   AK++E+IIPT ETARQ++FL  +L HE P++ VGPTGTGKS + NN+L+ LPK+ YL N INFSARTSANQTQDIIM+KLDRRRKG++GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHG+WFDKKDT++L ++D LL++AMGPPGGGRND++ R  RH N++ +N F D+ + +IF++IVDWHF  GFD +F R GK+LV +T  +Y+ A+ +FLPTP+KSHYVFNLRDFSRVI+GVLL PHT+L + EK +RLW+HEVYRVFYDRL  +EDR  FF++VK TT++CFK  IEK+L HLS +GK+VD+++R L FGDY    +D KIYDEIT LK L   ME +L+++N+ISKAPMSLVMF+FA+EHISR+CRVLKQD GH LLVGIGGSGRQSA +++ FM  +E++ IEIT+NY  N+WR+DLK+++++ G   K  VFLF+DNQIK ESF+EDI+MLLNTGDVPN++P+DEKA+I+EKMQ AAR +    G K++ TP++MYN+FIERV   +   LAMSPIGDAFRNRLRMFPSLINCCTIDWFQ+WP DALE+VANKFLED+E+D+N R  +V MCK++ ESV++LS ++ N LRR+NYVTPTSYLELI TFK LLN KR E+  ++NRYLTGL+KL+FA+ +V  MQ EL ALQP+LI+TS +T K++ K+E +T E + K+ ++ A++++ANV AA +Q IK++CE DLAEAMP L  A+A+LDTL   DI+LV+SM+NPP  +KLVME++CIM G KPERKPD S +GKMIEDYW  S K+LGD KFL+ LK +  D++ P  +K++RE++I  P+F P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +L   +++L +K+A+L  V  +LQ L D  +E   +KK+LE+NIE+C++KL RAE+LI GLGGEK RWTEAA+ L  RY N+TGDVL+S+  VAYLG FTV +R      W  +C +  IP    F +   LG+P+KIRAW IAGLPVDSFSIDNGIIV+NS RW L IDP GQANKWIKNMEK+N+L++IK +D+N++R LEN++Q GTPVL+EN+GEEL+  +EPIL K  F+QQGV+Y+RLG+N+IEY++DFK YITTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK+ LKE+ED+ILEVLS S+GNILE+ETAI VLSSSK+LS+EISEKQ +A +T+ +ID+TR GYKPVAVH + +FFCISD+ANI+PMYQYSL WFINL++ S+ +S KSE+L  RI+Y+ DHFTLS+Y N+CRSLFE  KLLFSL + I ++K K ++ +E+W FLLTGG+ALDNPYPNPAP W+S+K W+E+VRAS LP + GL EH + N  +WK +YDS  P 
Sbjct:  362 FRDLRFVRTAEILAGKLPLQPQEFWDVIQKHCLEAHQTLLNKWIPTCAQLFTSRKEHWIHFAPKSNYDSSRNIEEYFASVASFMSLQLRELVIKSLEDLVSLFMIHKDGNDFKEPYQEMKFFIPQLIMIKLEVSEPIIVFNPSFDGCWELIRDSFLEIIKNSNGIPKLKYIPLKFSFTAAAADRQCVKAAEPGEPSMHAAATAMAELKGYNLLLGTVNAEEKLVSDFLIQTFKVFQKNQVGPCKYLNVYKKYVDLLDNTAEQNIAAFLKENHDIDDFVTKINAIKKRRNEIASMNITVPLAMFCLDATALNHDLCERAQNLKDHLIQFQVDVNRDTNTSICNQYSHIADKVSEVPANTKELVSLIEFLKKSSAVTVFKLRRQLRDASERLEFLMDYADLPYQ--------------IEDIFDNSRNLLLHKRDQAEMDLIKRCSEFELRLEGYHRELESFRKREVMTTEEMKHNVEKLNELSKNLNRAFAEFELINKEEELLEKEKSTYPLLQAMLKNKVPYEQLWSTAYEFSIKSEEWMNGPLFLLNAEQIAEEIGNMWRTTYKLIKTLSDVPAPRRLAENVKIKIDKFKQYIPILSISCNPGMKDRHWQQISEIVGYEIKPTETTCLSNMLEFGFGKFVEKLEPIGAAASKEYSLEKNLDRMKLDWVNVTFSFVKYRDTDTNILCAIDDIQMLLDDHVIKTQTMCGSPFIKPIEAECRKWEEKLIRIQDNLDAWLKCQATWLYLEPIFSSEDIIAQMPEEGRKFGIVDSYWKSLMSQAVKDNRILVAADQPRMAEKLQEANFLLEDIQKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIVGMISSEKETVPFIQKIYPANAKGMVEKWLQQVEQMMLASMREVIGLGIEAYVKVPRNHWVLQWPGQVVICVSSIFWTQEVSQALA-ENTLLDFLKKSNDQIAQIVQLVRGKLSSGARLTLGALTVIDVHARDVVAKLSEDRVSDLNDFQWISQLRYYWVAKDVQVQIITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKTFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLKVLNDNIKKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEYKIINPKAITMGQLYGCFDQVSHEWMDGVLANAFREQASSLSDDRKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMNSKMSLIFEPADLEQASPATVSRCGMIYMEPHQLGWKPLKDSYMD-TLPSSLTKEHKELVNDMFMWLVQPCLEFGRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIR------AVEEEEMELGEGLSSQQIFLWLQGLFLFSLVWTVAGTINADSRKKFDVFFRNLIMGMDDNHPRPKSVKLTKNNIFPERGSIYDFYFIKQASGHWETWTQYITKEEEKVPAGAKVSELIIPTMETARQSFFLKTYLDHEIPMLFVGPTGTGKSAITNNFLLHLPKNTYLPNCINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTTRLDIVDMLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDDILTKIFSSIVDWHFGKGFDVMFLRYGKMLVQATKTIYRDAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDVEKCIRLWIHEVYRVFYDRLIDKEDRQVFFNMVKETTSNCFKQTIEKVLIHLSPTGKIVDDNIRSLFFGDYFKPESDQKIYDEITDLKQLTVVMEHYLEEFNNISKAPMSLVMFRFAIEHISRICRVLKQDKGHLLLVGIGGSGRQSAAKLSTFMNAYELYQIEITKNYAGNDWREDLKKIILQVGVATKSTVFLFADNQIKDESFVEDINMLLNTGDVPNIFPADEKADIVEKMQTAARTQ----GEKVEVTPLSMYNFFIERVINKISFSLAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRVEVVSMCKYFQESVKKLSLDYYNKLRRHNYVTPTSYLELILTFKTLLNSKRQEVAMMRNRYLTGLQKLDFAASQVAVMQRELTALQPQLILTSEETAKMMVKIEAETREADGKKLLVQADEKEANVAAAIAQGIKNECEGDLAEAMPALEAALAALDTLNPADISLVKSMQNPPGPVKLVMESICIMKGMKPERKPDPSGSGKMIEDYWGVSKKILGDLKFLESLKTYDKDNIPPLTMKRIRERFINHPEFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLAAQMQKLNQKRAELKLVVDRLQALNDDFEEMNTKKKDLEENIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYTNLTGDVLLSSGTVAYLGAFTVDYRVQCQNQWLAECKDKVIPGFSDFSLSHTLGDPIKIRAWQIAGLPVDSFSIDNGIIVSNSRRWALMIDPHGQANKWIKNMEKANKLAVIKFSDSNYMRMLENALQLGTPVLIENIGEELDASIEPILLKATFKQQGVEYMRLGENIIEYSRDFKLYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLIVESAKNKKHLKEIEDKILEVLSMSKGNILEDETAIKVLSSSKVLSEEISEKQKVASMTETQIDETRMGYKPVAVHSATIFFCISDLANIEPMYQYSLTWFINLYMHSLTHSTKSEELNLRIKYIIDHFTLSIYNNVCRSLFEKDKLLFSLLLTIGIMKQKKEITEEVWYFLLTGGIALDNPYPNPAPQWLSEKAWAEIVRASALPKLHGLMEHLEQNLGEWKLIYDSAWPH 3456          

HSP 2 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 460/660 (69.70%), Postives = 546/660 (82.73%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LP  ++  QGL+K+++LRC+RPDK+VPAV+ FI +++G+ +I+ P FDL  S+NDS+CC+PLIFVLSP ADPM  LLKF +D G   ++  +ISLGQGQGPIAAKMI+ AI+DGTWVVLQNCHLA SWM +LEKICEE+I+PE+T+  FRLWLTSYPSE FPVSILQNG+KMTNEPPKGLRANLLRSYLNDPISD  FF  C     W  MLFGLCFFHA+VQERR FGPLGWNIPYEFNESDLRIS+ Q+QMFLNDY E+P +ALTYLTGECNYGGRVTDDKDRRLL+SLL +FY  +I E++ Y  +P   YY PP G+ Q YI+Y+R+LPI  +PEV+GLHENADITKDNQETNQLF G+LLTLPRQ+ G GKSP++ ++ELA DIL KLP +FDLE +MK YPV+Y ESMNTVLRQELIRFN+L  VVR +LINL +AIKG V+M++ELEEVFNSML+GKVP  WAAKSYPSLKPLG YV DL+ RL FF +WI+   P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GFEFE+T     T ++  PEDGA + GLFLEGARWD++   +GESLPKIL++ +PIIWLKP +         Y+CPVYKTSARRGTLSTTGHSTN+VL+I+LP ++ Q HWINRGVASLCQLD+
Sbjct: 3460 LPGSWKFSQGLEKMVILRCLRPDKMVPAVREFIAEHMGKLYIEAPTFDLQGSYNDSSCCAPLIFVLSPSADPMAGLLKFADDLGMGGTRTQTISLGQGQGPIAAKMINNAIKDGTWVVLQNCHLAASWMPTLEKICEEVIVPESTNARFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPVFFQSCAKAVMWQKMLFGLCFFHAVVQERRNFGPLGWNIPYEFNESDLRISMWQIQMFLNDYKEVPFDALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI-EEDYYSLAPGDTYYIPPHGSYQSYIDYLRNLPITAHPEVFGLHENADITKDNQETNQLFEGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPRDFDLEEVMKLYPVVYEESMNTVLRQELIRFNRLTKVVRRSLINLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTP--QETVMENNPEDGAYIKGLFLEGARWDRKTMQIGESLPKILYDPLPIIWLKPGESAMFLHQDIYVCPVYKTSARRGTLSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4116          
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 3746.05 bits (9713), Expect = 0.000e+0
Identity = 1868/3115 (59.97%), Postives = 2400/3115 (77.05%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRV-------------------------EVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F N RF+   +L++  LP+ P +++ V+++ C E   +L   W+P CA+LF+ ++  W H  PK    +S  ++ +FA++AS MS QLR++V  SL D   F  IHK+GN+F   + E+ F    L++++L+V +P I++ P+F +   L+   +  I+++S+ IP+V                         E  LFP+++G  + L TV   E LV+ +LD+T++ FK N VGP  YLNVYKKY +LL+N AE  +  FLKE+H +      I++ +  K+E++ + ++VPL++F LD   LN D+ +R   L++ L+ ++V+ NRE N SIC +Y  I +KVSEIP +T  LVA+ E+L+++S   VF+L+ +  +A ERL FL+DYA +P E I+             +VF+ + N + ++R+Q E DL  R  +FE RLE  +K +E F+K+EVMT EEM+ NV+ L +L   +D    + E +NKEE +L  E+S FP+L T++ N  PY +LW TA +F  K++ W+ GP + +NA  I  +I  M +  +KL K   D P  +++A  VK KI+KFK H+P+L + CNPG+++RHW Q+SDI+G++IKPTE + L + L YG  K ++KLE IGAAA+KE+ LEK L KMK DW  M F   +YRD+  SIL A+DDIQ++LDDH+IK+QTM GS FIKP E E + WE+KLV + + +D WLK Q TWLYLEPIFSSEDI+AQMPEEG+KF  VD  WK +MA++V +   +VA  Q  M ++L ++N LLE+IQ+GLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +LEFT+ LEI GMIS+E ET+  +  IYP KAKGMVEKWL QVE VM+ S+++VI + IE+YV   R  WVL+WPGQ+VICVS I+WT+EV+EA+ V + L D+L K N QI  IV+LVRG L+SG R+TLGALTVIDVHARDVV  +    ++S+N F+W+SQLRYY     V V  I+TE  YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIE+EVLSVVAQQI SIQ AI + LKRF+FEGTELSLNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYALIGEISLYSMGF+D+R+LA KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+++F  A+ +N+ K KLQ   WFI KI+QIYEM+LVRHG MIVG+P GGKT AY+ LAAAL D+ A   M+E+ V++ IINPKAITMGQLYG FD VSHEWTDGVLA  FRE A +  D RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS+KM+LIFEPADLEQASPATVSRCGMIYME  QLGW+P  +S+++  LP CL ++H +L+ D+F WL+ PCLDF R +CK +++TS IH    + +L+ SLLDEIR+    EE E  E      +S+Q I+LWLQGLFLFS VW++  ++    R KFDVFFR L  G++   P+PKS+KLTK+N FPER +IYDF F K+ GG+W  W   I +E  +I  +AK++++IIPT ETARQ++FL  +L HE P++ VGPTGTGKS + N++L+ LPK+ Y  N INFSARTSANQTQDIIM+KLDRRRKG++GPP  K+ VVFVDDLNMPAKE YGAQPPIELLRQWIDHG+WFDKKDT++L ++D LL++AMGPPGGGRND++ R  RH N++ +N F D  + +IF++I DWHF  GFD +F R GK+LV +T  +Y+ A+ +FLPTP+KSHYVFNLRDFSRVI+GVLL PHT+L + EK +RLW+HEVYRVFYDRL   +DR  FF++VK TT++CFK  +EK+L HLS +GK+ D+++R L FGDY+   +D KIYDEI  L+ L   ME +LD++NS+SKAPMSLVMF+FA+EHISR+CRVLKQ  GH LLVGIGGSGRQSAT+++ FM  +E++ IEIT+NY  ++WR+DLK++++++G   K  VFLFSDNQIK ESF+EDI+MLLNTGDVPN++P+DEKA+++EKMQ AAR E    G K+++TP++MYN+FIER     +  LAMSPIGDAFR RLRMFPSLINCCTIDWFQ+WP DALE+VANKFLED+E+D+N R  +V MCK++ ESV++LS ++ NTL R+NYVTPTSYLELI TFK LLN KR E+ T++NRYL GL+KLEFAS +V  MQ+EL ALQP+LI TS  T  ++ K+E +T E +AK+ ++ A++++AN  AA SQ IK++CE DLAEAMP L  A+A+LDTL  +DITLV+SM+NPP  +KLVME++C+M G KPERKPD S +GKMIEDYW  S K+LGD KFL+ LK +  D++    +K++RE++I  PDF P +++N S+ACEGLCKW+ A++ YD  AK+VAPK+ +L  AE +LEI +++L +K+A+L  VE +LQDL D+ +   ++K  LE NIE+C++KL RAE+LI GLGGEK RWTEAA+ L  RY N+TGDVL+++  VAYLG FTV +R      W   C +  IP S  F + + LG+P+KIRAW IAGLPVDSFS+DNGIIV+NS RWPL IDPQGQANKW+KNMEK+N+LS+IK +D N+VRTLEN++QFGTPVLLENVGEEL+  +EPIL K  F+QQGV+Y+RLG+N+IEY+++FKFYITTRLRNPHYLPE++ KVCLLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLS  +GNILE+ETAI +LSSSK+LS+EISEKQ IA VT+ +ID+TR GYKPVAVH + +FFCISD+A+I+PMYQYSL WFINL++ S+ NS KS++L+ RIEY+ +HFTLS+Y N+CRSLFE  KLLFSL + + LLK +  +++E+W FLLTGGVALDNP+PNPAP W+S+K W E+VRAS L  +KGL E    N   WK +YDS  P
Sbjct:  334 FQNLRFVRTADLLAGKLPLLPHEYKEVVQKHCREARHILLTKWIPTCAQLFVTQKEHWVHFAPKNDYDSSRNIEEYFASVASFMSLQLRDLVIKSLRDLVSFFMIHKDGNDFKEPYQEMDFFIPQLIMIKLEVRDPIIVFNPTFDDCWQLIKNSFLEIIKNSDGIPKVYLCWKPLASYICVSPHLRMTSVLQVESILFPDLKGYNMILGTVNPEESLVSDFLDQTLEVFKKNQVGPYKYLNVYKKYDDLLDNMAEKGISEFLKEKHEIEDFVTSINSIKKRKNEIASMHITVPLAMFCLDAVFLNYDLCERAQNLKDNLILYQVDVNRETNTSICNQYSTIADKVSEIPANTAELVALIEYLKKSSDVTVFKLRRQLRDASERLEFLMDYADLPSESIE-------------DVFESSRNLLMSKRDQAEMDLIKRCSEFESRLEGYSKELEMFRKREVMTTEEMKNNVEKLHDLSKNLDLALTEFELINKEEELLEKEKSSFPLLQTLMINKIPYEQLWVTAYEFSTKSEEWMNGPLYLMNAEQIAEEIGNMWRTTYKLTKTLIDVPAPKRLAENVKLKIEKFKQHIPILNIACNPGMKDRHWQQISDIVGYEIKPTETTCLANMLEYGFGKFVDKLEPIGAAASKEYSLEKNLEKMKADWVNMCFSFVKYRDTDTSILCAVDDIQLILDDHVIKTQTMCGSVFIKPIEAECRKWEEKLVRVQENLDAWLKCQVTWLYLEPIFSSEDIIAQMPEEGKKFTTVDTYWKSLMAQAVNDTRVMVAADQPRMTEKLQEANVLLEDIQRGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLEFTDNLEIKGMISSEKETVPFIQTIYPVKAKGMVEKWLQQVEQVMLASMRQVIENGIEAYVQVPRNAWVLEWPGQVVICVSSIFWTREVSEAL-VEDTLTDFLKKSNDQIAQIVELVRGKLSSGARLTLGALTVIDVHARDVVAKLRHDHINSLNDFQWISQLRYYWTEKNVHVQMITTEALYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETTKDLAKALAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIEVEVLSVVAQQILSIQQAIIRKLKRFIFEGTELSLNPTCAVFITMNPGYAGRAELPDNLKALFRTVAMMVPDYALIGEISLYSMGFLDSRSLAQKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPE-ENESVLLLRALLDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYEVFLEALNNNIRKMKLQPVPWFIGKIIQIYEMMLVRHGYMIVGDPMGGKTSAYKVLAAALGDLHAANQMEEFAVEFKIINPKAITMGQLYGCFDAVSHEWTDGVLANAFREQASSITDDRKWIIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSKMSLIFEPADLEQASPATVSRCGMIYMEAHQLGWKPLKDSYMD-TLPRCLTKEHTELVEDMFTWLVQPCLDFSRLHCKFVVQTSPIHLAFSMMRLYSSLLDEIRDIQE-EEMEIYEG-----LSSQQIFLWLQGLFLFSLVWTLAGTINAESRKKFDVFFRNLIMGMDDRNPRPKSVKLTKNNIFPERGSIYDFYFLKQGGGHWNAWTEYITKEEETIPANAKVSDLIIPTMETARQSFFLKTYLDHEIPILFVGPTGTGKSAITNDFLLHLPKNVYQPNFINFSARTSANQTQDIIMSKLDRRRKGLFGPPIGKKAVVFVDDLNMPAKEVYGAQPPIELLRQWIDHGYWFDKKDTNRLDIVDVLLVTAMGPPGGGRNDITGRFTRHLNIISINAFEDEILTKIFSSIADWHFGKGFDVMFLRYGKMLVQATQTIYRAAVENFLPTPSKSHYVFNLRDFSRVIQGVLLCPHTHLQDLEKFIRLWIHEVYRVFYDRLIDNDDRQTFFNLVKETTSNCFKQTMEKVLIHLSPTGKITDDNIRSLFFGDYLKPESDQKIYDEIIDLRGLTVVMEYYLDEFNSVSKAPMSLVMFKFAIEHISRICRVLKQKKGHLLLVGIGGSGRQSATKLSTFMNSYELYQIEITKNYTNSDWREDLKKIMLQSGVATKSTVFLFSDNQIKHESFVEDINMLLNTGDVPNIFPADEKADLVEKMQTAARTE----GEKVEATPLSMYNFFIERGTNRAYFSLAMSPIGDAFRTRLRMFPSLINCCTIDWFQSWPTDALELVANKFLEDVELDDNIRAEVVSMCKYFQESVKKLSVDYYNTLLRHNYVTPTSYLELILTFKTLLNSKRQEVDTIRNRYLAGLQKLEFASSQVAVMQVELTALQPQLIQTSEDTAMMMVKIELETKEADAKKLLVQADEKEANAAAAISQAIKNECEGDLAEAMPALEAALAALDTLNPSDITLVKSMQNPPGPVKLVMESICVMKGLKPERKPDPSGSGKMIEDYWGVSRKILGDLKFLESLKTYDKDNIPSVIMKRIRERFIDHPDFQPAVIKNVSSACEGLCKWVRAMEVYDRVAKVVAPKRERLREAEGKLEIQMQKLNQKRAELKLVEDRLQDLNDEFELMNRKKNSLEKNIEICSQKLVRAEKLISGLGGEKDRWTEAARQLGIRYDNLTGDVLLASGTVAYLGAFTVDYRAQCQNEWLVSCKDKVIPGSVDFSLSNTLGDPIKIRAWQIAGLPVDSFSVDNGIIVSNSRRWPLMIDPQGQANKWVKNMEKTNKLSVIKFSDTNYVRTLENALQFGTPVLLENVGEELDAFIEPILLKATFKQQGVEYMRLGENIIEYSREFKFYITTRLRNPHYLPEVAVKVCLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNKLILESAQNKKQLKEIEDKILEVLSLCEGNILEDETAIKILSSSKVLSEEISEKQEIASVTETQIDETRMGYKPVAVHSAAIFFCISDLAHIEPMYQYSLTWFINLYVQSLANSNKSDELDLRIEYIIEHFTLSIYNNVCRSLFEKDKLLFSLLLTVGLLKERKAIDEEVWYFLLTGGVALDNPFPNPAPEWLSEKSWGEIVRASSLQKLKGLMEDVMQNIKVWKDIYDSAWP 3422          

HSP 2 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 457/660 (69.24%), Postives = 540/660 (81.82%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LP  +  LQ L+K+ +LRC+RPDKIVPA+Q+FI + +G+ FI+ P FDL  S+ DS+CC PLIF+LSPGADPM  LLKF +D     +K  +ISLGQGQGPIAA MI++AI +GTWVVLQNCHLATSWM +LEKICEE+I+PENT+  FRLWLTSYPSE FPVSILQNG+KMTNEPPKGLRANLLRSYLNDPISD  FF  C     W  +LFGLCFFHA+VQERR +G LGWNIPYEFNESDLRIS+RQ+QMFLNDY E+P EALTYLTGECNYGGRVTDDKDRRLL+SLL +FY  +I E + Y  +P   Y  PP G+ Q YIEY+R+LPI  +PEV+GLHENADITKDNQETNQLF G+LLTLPRQ+ G GKSP++ ++ELA DIL KLP +F+LE +MK+YPV+Y ESMNTVLRQELIRFN+L  VVR +LI+L +AIKG V+M++ELEEVFNSML+GKVP  WAAKSYPSLKPLG YV DL+ RL FF +WI+   P  FWISGFYFTQSFLTGV QN+ARKYTIPID +GFEFE+T     T ++  PEDGA + GLFLEGARWD+    +GESLPKIL++ +PIIWLKP +  +      Y+CPVYKTSARRG LSTTGHSTN+VL+I+LP ++ Q HWINRGVASLCQLD+
Sbjct: 3427 LPSPWFFLQTLEKIAILRCLRPDKIVPAIQNFICETMGKIFIEAPTFDLQGSYGDSSCCVPLIFILSPGADPMAGLLKFADDVSMGGTKTQTISLGQGQGPIAANMINKAIHEGTWVVLQNCHLATSWMPALEKICEEVIVPENTNSEFRLWLTSYPSEKFPVSILQNGIKMTNEPPKGLRANLLRSYLNDPISDPLFFQSCTKPVIWQKLLFGLCFFHAIVQERRNYGALGWNIPYEFNESDLRISMRQIQMFLNDYEEVPFEALTYLTGECNYGGRVTDDKDRRLLLSLLSMFYCKEI-ETDNYHIAPGDAYVIPPYGSYQSYIEYLRTLPITAHPEVFGLHENADITKDNQETNQLFQGVLLTLPRQSGGSGKSPQEVVEELAQDILSKLPNDFNLEEVMKKYPVVYKESMNTVLRQELIRFNRLTKVVRRSLIDLGRAIKGQVLMSSELEEVFNSMLVGKVPAMWAAKSYPSLKPLGGYVADLLARLTFFQEWIDKGPPVVFWISGFYFTQSFLTGVSQNYARKYTIPIDHIGFEFEVTP--KETTMENIPEDGAYIKGLFLEGARWDRSTSQIGESLPKILYDPLPIIWLKPGESASFLHQDIYVCPVYKTSARRGILSTTGHSTNYVLSIELPTDMPQKHWINRGVASLCQLDN 4083          
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 3109.32 bits (8060), Expect = 0.000e+0
Identity = 1620/3109 (52.11%), Postives = 2157/3109 (69.38%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEP-VKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFP--EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPN-GLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELT-GGINPLYP-KPKSIKLTKSNS-------FPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE--HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPD-TSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   R ++I E  +    ++   F+N++ +        L  +W P    ++          LP   TG+S   +++FF   A+LM+ QL++++  S+ DFT+ I             + ++  + P  I+ L + +  + ++P F +  D+L+  Y+ ++++   +PRVE  L+   E + +   L+ +I +E ++ ++ ++  +     +V P  +L +Y KY  L+  +AE ++  FL +      L ++I  YQ L +E+           +F +    L   + KR D +   L++    +++E+N  +C  ++ I  K    P +T  L+ ++  +++  TT++  L +   ++   L FL++       DI+LN ++F W   +  +FD     I+++ EQ +E L+LR  +F E LE   K  E+F       +++++R ++    L  ++D   D++EQ N EE    W  S +P    +   L+PY RL+ TA++F  K+  W +GP+H++N   +E D+    + ++KL K F+D+P A  +  KV+ +++ FK ++P++QVICNPG++ RHW+ MS I+G+ ++P+++S++  F+   L   L++ E I  AA+KE+ LEK++ KM  +W+ M+F +  YR+SG  ILSA+DDIQMLLDDHIIK+QTM+GSPFIKP+EK+M+ WE KL+ + +I+D WLKVQATWLYLEPIFSS DI++QMPEEGR+F  VD TW++VM   V+N   L       ML+R+  SN LLE I KGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI R+EFTE L+I  M S+EGE + +V  I   KA+G VEKWL+++E +MI S+ KVI D+I +Y    R  WV DWPGQ V+CVS  +WT EV  AI + +  L+DYL KCN QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ N+ K ++S    FEWLSQLRYY     +    I+  L YG EYLGN+PR+V+ P  D C+ TL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQI I  G +  VFEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENE ILLL++I DVNLPKFLS D+PLFEGI SDLFPGV LPK D++   +A+++N     LQ   +F +KILQIYEM++VRHG MIVGEPFGGKT AY+ LA AL DI   G M+E KV   ++NPK++TMGQLYGQFD VSHEW+DG+LA+ FR FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +MNLIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S+I   LP  ++    + I  LF+ ++   ++FIR + K+L  TS+ + V  L  L    +D+  ++   +E   +E+           +  L+G+FLFS +WS+G+S     R K++   REL  G I+ L   K K +  T+  S       FPE+ TIYD+ F  +  G W +W+  +  ++  I  D + NEII+PT +T R +  + L  TH+KP I VGPTGTGKSV I N+L+ +L KD Y    +NFSA+T+A QTQ+IIM+KLD+RRKGV+GPP  KR +VFVDD+NMPA+E YGAQPPIELLRQW+DH +W+D KD S + L+D  ++ AMGPPGGGRN ++ R +RHFN++ +NEF+D +M  IF+ I+ WH    + F   F  L   +V+ TM +YK A+ + LPTPAKSHY+FNLRDFSRVI+GV L       N E + RLWVHEV RV+YDRL    DR    + ++    +  + +   +  +L     G V ++D+R L+F D+     +D  Y EI ++  L   +E  LD+YN++SK PM+LV+F+FA+EHISR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+ +F +EI++ YG +EW +DLK +L K        VFLF+D QIK+ESF+ED++ LLN G+VPNL+  DEK EI EKM+   R  +K   ++ D +PIA++N FI+R +  LH+VLAMSPIGDAFR RLR FP+L+NCCTIDWFQ+WPEDALE VA++FLEDIEM E  RE  + MCK +H S   LS  F N L+RYNYVTPTSYLELI TFK LL  KRNE++ +K RY  GL+KL+ AS +V  MQ EL+AL P+L V S Q D ++  +E++++EV    +I+ A++  AN +A  ++ IKD+C+ADLAEA+PIL  A+A+LDTL   DIT+V+SMK+PP  +KLVMEA+CI+ G K ++ PD T +GK IED+W  + +LLGD +FL  L  +  D++ P  +  +R+ YIP PDF P+ +RNASTA EGLCKW+IA+D YD  AKIVAPKK+KLA AE EL I ++ L +K+A L EV+ KL  L D L+  +Q+K +LE+ ++LC+KKL+RAEQLIGGLGGEK+RW+ +A  L   Y N+TGD+L+S+ VVAYLG FT  +R    + W   C E  IPCS+ + +M  LGE V IRAWNIAGLP D FSIDNGII+ N+ RWPL IDPQGQANKWIKNMEK+N L +IKL+D ++VRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY  DF+FYITT+LRNPHYLPE S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ A+NKR+LKE+ED+ILEVLSSS+GNILE+ETAI +LSSSK L+ EIS+KQ +AE T+ +ID TR GY+P+AVH SILFF I+D+ANI+PMYQYSL WFINLF++SIENSEKS+ L  R+  L DHFT S+Y NICRSLFE  K+LFS  + + LL  +N +N   WRFLLTGG+ LDNPY NP   W+  K W E+ R  EL + K +R  F    + WK +YDS  P
Sbjct:  322 FKKLRLVDIEEFHNRQDALELSGFQNIVIKHMESAKETLLKTWFPEVQNIYYQGNK--KKQLP---TGDSSAKLESFFNCAATLMTLQLQDLILVSMQDFTDLI---------AQPPESIRAFEHPGFIMRLVLDKKAVKFEPEFTDYIDILVNVYEIMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILDE-IIDAHKEKIREVVLRESVAPTEHLKMYDKYQFLITRQAEQDIEEFLTQSQNYERLIEEIRKYQKLGEEIQYTSRKTVRLGMFEMHCEELIRSLVKRADIICGKLIAKMFRDHQEVNTMLCEEFEKIAEKALSTPPNTAELMEMKAHIQKVETTDMLDLGQRLVDSKNCLAFLIECVNFSPADIRLNNSVFQWYGRMGEIFDEHRKIIKDKTEQYQEGLKLRCERFVEELESYAKQAEEFYT--FGDLQDVQRYLKKAQVLNSKLDAAADKIEQFNAEEEAFGWIPSVYPQRKKIQDGLNPYLRLYETAVEFSTKHRAWTEGPYHKVNPDQVEADVGNYWRGLYKLEKAFHDSPNALAMTKKVRARVEDFKQYIPLVQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVFSFIDMNLEPFLDRFEGISEAASKEYSLEKSMDKMMTEWEAMEFVIHPYRESGTFILSAVDDIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDVMKMVVQNKHVLAVVTIERMLERMKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIARVEFTETLDITHMKSSEGEVVELVDTISTTKARGQVEKWLVELERIMIKSIHKVIGDAITAYTKNARINWVRDWPGQTVLCVSQTFWTVEVQVAIPMGHKALEDYLGKCNHQIDDIVTLVRGKLSKQNRVTLGALVVLDVHARDVLANLVKKRISDDTDFEWLSQLRYYWHENNLETKMINAGLRYGYEYLGNSPRMVLAPFCDYCFLTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQIGINSGTELLVFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSIKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPN-ENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIRENCHSMNLQMTNFFSEKILQIYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALGDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDLVSHEWSDGILAVSFRAFAASSTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPQMLGWRPLMVSWIN-TLPQSVSIIQKEFIEGLFDRMVPLSVEFIRRHTKELSPTSDTNLVRSLMNLIDCFMDDFADENKQKERNDREN-----------FSLLEGIFLFSLIWSVGASCTADDRIKYNKILRELMEGPISDLTRNKFKLLSGTEQTSSKALTVPFPEKGTIYDYQFIPEGLGRWDQWIKKL-ADTPPIPKDVQFNEIIVPTLDTVRYSALMSLLTTHQKPSIFVGPTGTGKSVYIINFLLNQLNKDIYKPLIVNFSAQTTAAQTQNIIMSKLDKRRKGVFGPPLGKRMIVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPITPRYMRHFNIITINEFSDKSMFTIFSRILTWHLRTCYKFPDDFLDLTTQIVNGTMTLYKDAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETAENKEAIKRLWVHEVLRVYYDRLLDNADRSWLVNYIQEILRNYMQEDFHDLFKNLDFDNDGIVEEDDLRSLMFCDFHDPKREDFGYREIPNVDALRVIVEGHLDEYNNMSKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSLFQVEISKGYGSHEWHEDLKVILRKCAEGDMQGVFLFTDTQIKRESFLEDVNNLLNAGEVPNLFALDEKQEICEKMRQLDRQRDKT--KQTDGSPIALFNMFIDRCRNQLHVVLAMSPIGDAFRIRLRKFPALVNCCTIDWFQSWPEDALEAVASRFLEDIEMSEEIREGCIDMCKSFHTSTINLSTTFHNELQRYNYVTPTSYLELISTFKLLLEKKRNEVMKMKRRYEVGLDKLDSASSQVATMQGELEALHPQLKVASRQVDDMMIMIEKESIEVAKTEKIVKADETVANDQAMAAKAIKDECDADLAEALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDIRFLQSLHEYDKDNIPPAYMNIIRKSYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELRIAMEGLRKKQAALREVQDKLAKLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSNSALELGHLYVNLTGDILISSGVVAYLGAFTSNYRQHQTKEWSHSCKERDIPCSDDYSLMGTLGEAVTIRAWNIAGLPSDLFSIDNGIIIMNARRWPLMIDPQGQANKWIKNMEKTNSLQLIKLSDPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVARERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDNTRMGYRPIAVHSSILFFSIADLANIEPMYQYSLTWFINLFILSIENSEKSDILSQRLHILRDHFTYSLYVNICRSLFEKDKMLFSFCLTVNLLIHENAINKAEWRFLLTGGIGLDNPYTNPC-TWLPQKSWDEICRLDELHAFKTIRREFMRLKEGWKKVYDSMEP 3396          

HSP 2 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 399/647 (61.67%), Postives = 509/647 (78.67%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            +++++RC+RPDK++P +Q FI   LG++FI+PPPFDL  +F DSNCC+PLIFVLSPGADPMNALLKF +DQGY  SK++S+SLGQGQGPIA KM+++A++DGTWVVLQNCHLATSWM +LEK+CEE+  PE+TH +FR+WLTSYPS +FPVS+LQNGVKMTNE PKGLRAN++RSYL DPISD +FF  C     +  +L+GLCFFHALVQERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFLN Y ELP +AL Y+TGECNYGGRVTDD DRR L S+L  F+  ++VE  +Y F  SGIY+ PP G  + YIEY ++LP+ P+PE++G++ NADITKD  ET  LF  ILLT  R +    KS ++ + E+A DIL KLP NFD+E  M+RYP  Y++SMNTVL QE+ RFNKL+  +R + IN+QKAIKGLVVM+ ELEEV +S+L  K+P  W  KSYPSLKPLGSYVND + RL F   W E   P  FW+SGF+FTQ+FLTG  QN+ARK+TIPID +GF++E+    +  + K  PEDG  ++GLFL+GA W+++ K L ES PK+L++++P++WLKP K   I +  +Y+ P+YKTS RRGTLSTTGHSTNFV+ + LP++  + HWI RGVA LCQL+
Sbjct: 3414 RMLIIRCLRPDKVIPMLQEFIIKKLGRSFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMNALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKDGTWVVLQNCHLATSWMPTLEKVCEELS-PESTHPDFRIWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCRKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYDALRYMTGECNYGGRVTDDWDRRTLRSILNKFFCTELVENPQYKFDSSGIYFVPPSGDHKSYIEYTKTLPLIPDPEIFGMNANADITKDQSETQLLFDNILLTQSRSSGSGAKSSDEVVNEVAGDILGKLPNNFDIESAMRRYPTTYTQSMNTVLVQEMGRFNKLLITIRESCINIQKAIKGLVVMSTELEEVVSSILNVKIPGMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKFTIPIDLLGFDYEVM---DDKEYKNAPEDGVYIHGLFLDGASWNRKTKKLAESHPKVLYDTVPVMWLKPCKKSDIPKRPSYVAPLYKTSERRGTLSTTGHSTNFVIAMILPSDQPKEHWIGRGVALLCQLN 4056          
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 3101.23 bits (8039), Expect = 0.000e+0
Identity = 1618/3113 (51.98%), Postives = 2153/3113 (69.16%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEP-VKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFP--EMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLK---DYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNS-----------FPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE--HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPD-TSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   R ++I E  +    ++   F+N+I R        L   W P    ++          LP   TG+S   +++FF   A+LM+ QL+++   S+ DFT+ I             D ++  + P  I+ L +    I ++P   +  D+ +  Y  ++++   +PRVE  L+   E + +   L+ +I NE +V ++ ++  +     +V P  +L +Y KY  L+  KAE +V  FL E H    +  +I  YQ L +E+    +      +F +    L   + KR D +   L++    +++E+N  +C  ++ I  K    P +T  L+ ++ ++++   T++  L++   ++   L FL++Y      D++LN ++F W   +  +F+     I+ + EQ +E L+LR  +F E LE   K  E+F       +++++R ++    L G++D   D++EQ N EE    W  S +P    +   L+PY RL+ TA++F      W +GP+H++N   +E DI    + ++KL K F+D+P A  +  KV+ K++ FK H+P++QVICNPG++ RHW+ MS I+G+ ++P+++S++  FL   L  ++++ E I  AA+KE+ LEK + KM  +W  ++F +  YR++G  IL+++D+IQMLLDDHIIK+QTM+GSPFIKP+EK+M+ WE KL+ + +I+D WLKVQATWLYLEPIFSS DI++QMPEEGR+F  VD TW+++M   +++   L       ML+RL  SN LLE I KGLN+YLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI ++EFTE L+I  M S+EGE + ++  I  AKA+G VEKWL+++E VMINS+ KV  D+  +Y   +R  WV DWPGQ V+CVS I+WTKEV  AI  P G+K    YL  CN QIDDIV LVRG L+   R+TLGAL V+DVHARDV+ ++ K  +S  + FEWLSQLRYY +   +    I+  L YG EYLGN+PRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G    +FEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ENE ILLL++I DVNLPKFLS D+PLFEGI SDLFPGV LPK D++   +A+KDN     LQ   +F +KILQ+YEM++VRHG MIVGEPFGGKT AY+ LA AL DI   G M+E KV   ++NPK++TMGQLYGQFD VSHEW+DGVLA+ FR FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS +MNLIFEP DLE ASPATVSRCGMIYMEP  LGWRP M S++   LP  ++    + I  LF+ ++   ++FIR + K+L  TS+ + V  L  L    +D+  ++  ++E   +E            Y  L+G+FLFS +WS+G+S  +  R KF+   REL    +P+  + ++    +S +           FPE+ TIYD+ F  +  G W+ W+  + +E+  I  D   NEII+PT +T R +  ++L  TH+KP I VGPTGTGKSV I N+L+ +L K+ Y    INFSA+T+A QTQ+I+M+KLD+RRKGV+GPP  KR VVFVDD+NMPA+E YGAQPPIELLRQW+DH +W+D KD S + L+D  ++ AMGPPGGGRN V+ R +RHFN++ +NEF+D +M  IF+ I+ WH E  + F   F  L   +V+ TM +YK+A+ + LPTPAKSHY+FNLRDFSRVI+GV L         E + RLWVHEV RV+YDRL    DR    + ++    +    +  ++   L     G V  +D+R L+F D+     +D  Y EI  + NL   +E  L++YN+ISK PM+LV+F+FA+EHISR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+ +F +EI++ Y   EW +DLK +L K        VFLF+D QIK+ESF+ED+S LLN G++PNL+  DEK EI +KM+   R  +K   ++ D +PIA++N FI+  +  LH+VLAMSPIGDAFRNRLR FP+L+NCCTIDWFQ+WPEDAL+ VA++FLE+IEM E  R+  + MCK +H S   LS+ F   L+RYNYVTPTSYLELI TFK LL  KR+E++ +K RY  GLEKL+ AS +V  MQ+EL+AL P+L V S + D+++  +E+++VEV    +I+ A++  AN +A  S+ IKD+C+ADLA A+PIL  A+A+LDTL   DIT+V+SMK+PP  +KLVMEA+CI+ G K ++ PD T +GK IED+W  + +LLGD +FL  L  +  D++ P  +  +R+ YIP PDF P+ +RNASTA EGLCKW+IA+D YD  AKIVAPKK+KLA AE EL+I +  L +K+A L EV+ KL  L D L+  +Q+K +LE+ ++LC+KKL+RAEQLIGGLGGEK+RW+  A  L + Y N+TGD+L+S+ VVAYLG FT  +R +  + W   C    IPCS+   +M  LGE V IR WNIAGLP DSFSIDNGII+ N+ RWPL IDPQ QANKWIKNMEK+N L +IKL++ ++VRTLEN IQFGTPVLLENVGEEL+PILEP+L K  F+Q G   +RLGD+ IEY  DF+FYITT+LRNPHYLPE S KV LLNFMITP+G++DQLLGIV A+E+P+LEE+K  LI++ A+NKR+LKE+ED+ILEVLSSS+GNILE+ETAI +LSSSK L+ EIS+KQ +AE T+ +ID TR GY+P+A+H SILFF ++D+ANI+PMYQYSL WFINLF++SIENSEKSE L  R++ L DHFT S+Y N+CRSLFE  KLLFS  + I LL  +  +N   WRFLLTGG+ LDNPY N    W+  K W E+ R  +LP+ K +R  F    D WK +YDS  P
Sbjct:  289 FKKLRLVDIKEFHNCQDALELSSFQNIIMRHMDSAKETLLKMWFPEVQNIYYQGNK--KKQLP---TGDSSAKLESFFNCAAALMTLQLQDLTLVSMQDFTDLI---------AQPPDSVRAFEHPGFIMRLILDNDTIKFEPELSDYIDIFLNVYDVMIKAVSFVPRVETKLYSKWESKSKPTTLKPIILNE-IVDAHKEKIKEVIMKESVAPTEHLRLYDKYDFLITRKAERDVDNFLAENHSYEKIIDEICKYQKLIEEIQYTSIKTIRLGMFEMHCEELIRALVKRADIICGKLLAKMFRDHQEVNTRLCDEFERIAEKALSTPPNTAELMEMKAYIQKVEVTDMIELEQRLVDSKNCLAFLIEYVNFSPADMRLNNSVFQWYGRMGEIFEEHRKIIKEKIEQYQEGLKLRCERFVEELESYAKQSEEFYS--FGDLQDVQRYLKKAQILNGKLDLAADKIEQFNAEEEAFGWLPSVYPQRKKIQDGLNPYLRLYETAVEFSSNYRAWTEGPYHKVNPDQVEADIGNYWRGLYKLEKTFHDSPYALAMTKKVRSKVEDFKQHIPLIQVICNPGLRPRHWEAMSAIVGYPLQPSDDSTVSSFLDMNLEPYIDRFEGISEAASKEYSLEKAMEKMITEWDAVEFVIHSYRETGTFILASVDEIQMLLDDHIIKTQTMRGSPFIKPYEKQMREWEGKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMSQMPEEGRRFTAVDKTWRDIMRSVMQDKHVLTVVTIDRMLERLKKSNELLELILKGLNEYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIAKVEFTETLDITHMKSSEGEVVELIEIISTAKARGQVEKWLVELERVMINSIHKVTGDATFAYTKYERINWVRDWPGQTVLCVSQIFWTKEVQTAI--PMGIKALEQYLKTCNRQIDDIVTLVRGKLSMQNRVTLGALVVLDVHARDVLSSLVKKNISDDSDFEWLSQLRYYWQENHLETKMINAGLRYGYEYLGNSPRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYLALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINAGADILMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIVLYSCGFVTARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPN-ENEEILLLRSIIDVNLPKFLSHDLPLFEGITSDLFPGVKLPKPDYNDLLAAIKDNCASMNLQMTAFFSEKILQVYEMMIVRHGFMIVGEPFGGKTSAYRVLAGALNDICEKGLMEENKVQITVLNPKSVTMGQLYGQFDSVSHEWSDGVLAVSFRAFASSVTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSPQMNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWRPLMLSWVNL-LPASVSVIQKEFIMGLFDRMVPVSVEFIRKHTKELSPTSDTNLVRSLMNLIDCFMDDFADEVKLKERNDRE-----------TYSLLEGIFLFSLIWSVGASCTDDDRLKFNKILRELME--SPISDRTRNTFKLQSGTEQTSSKALTVPFPEKGTIYDYQFVTEGIGKWEPWIKKL-KEAPPIPKDVMFNEIIVPTLDTIRYSALMELLTTHQKPSIFVGPTGTGKSVYITNFLLNQLNKEIYKPLLINFSAQTTAAQTQNIVMSKLDKRRKGVFGPPLGKRMVVFVDDVNMPAREVYGAQPPIELLRQWLDHWNWYDLKDCSMIKLVDIQIMCAMGPPGGGRNPVTPRYMRHFNIITINEFSDKSMYTIFSRILTWHLEICYKFPDEFLDLTTQIVNGTMTLYKEAMKNLLPTPAKSHYLFNLRDFSRVIQGVCLSRPETTETTEVIKRLWVHEVLRVYYDRLLDNTDRSWLINYIQEILRNYMYEDFHELFQRLDFDNDGMVEADDLRSLMFCDFHDPKREDTNYREIADVDNLRMIVEIHLEEYNNISKKPMNLVLFRFAIEHISRISRILKQPRSHALLVGVGGSGRQSVTRLAAHMADYSVFQVEISKGYDTTEWHEDLKVILRKCAEGEMQGVFLFTDTQIKEESFLEDVSNLLNAGEIPNLFALDEKQEICDKMRQLDRQRDKT--KQTDGSPIALFNMFIDHCRSQLHVVLAMSPIGDAFRNRLRKFPALVNCCTIDWFQSWPEDALQAVASRFLEEIEMSEEIRDGCIDMCKSFHTSTIDLSKSFFVELQRYNYVTPTSYLELISTFKLLLEKKRSEVMKMKKRYEVGLEKLDSASSQVATMQMELEALHPQLKVASKEVDEMMIMIEKESVEVAKTEKIVKADETIANEQAMASKAIKDECDADLAGALPILESALAALDTLTAQDITVVKSMKSPPAGVKLVMEAICILKGIKADKIPDPTGSGKKIEDFWGPAKRLLGDMRFLQSLHEYDKDNIPPAYMNIIRKNYIPNPDFVPEKIRNASTAAEGLCKWVIAMDSYDKVAKIVAPKKIKLAAAEGELKIAMDGLRKKQAALKEVQDKLARLQDTLELNKQKKADLENQVDLCSKKLERAEQLIGGLGGEKTRWSHTALELGQLYINLTGDILISSGVVAYLGAFTSTYRQNQTKEWTTLCKGRDIPCSDDCSLMGTLGEAVTIRTWNIAGLPSDSFSIDNGIIIMNARRWPLMIDPQSQANKWIKNMEKANSLYVIKLSEPDYVRTLENCIQFGTPVLLENVGEELDPILEPLLLKQTFKQGGSTCIRLGDSTIEYAPDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGMQDQLLGIVVAQERPDLEEEKQALILQGAENKRQLKEIEDKILEVLSSSEGNILEDETAIKILSSSKALANEISQKQEVAEETEKKIDTTRMGYRPIAIHSSILFFSLADLANIEPMYQYSLTWFINLFILSIENSEKSEILAKRLQILKDHFTYSLYVNVCRSLFEKDKLLFSFCLTINLLLHERAINKAEWRFLLTGGIGLDNPYANLC-TWLPQKSWDEICRLDDLPAFKTIRREFMRLKDGWKKVYDSLEP 3363          

HSP 2 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 398/647 (61.51%), Postives = 504/647 (77.90%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            +++++RC+RPDK++P +Q FI + LG+ FI+PPPFDL  +F DSNCC+PLIFVLSPGADPM ALLKF +DQGY  SK++S+SLGQGQGPIA KM+++A+++GTWVVLQNCHLATSWM +LEK+CEE+  PE+TH +FR+WLTSYPS +FPVS+LQNGVKMTNE PKGLRAN++RSYL DPISD +FF  C     +  +L+GLCFFHALVQERRKFGPLGWNIPYEFNE+DLRISV+Q+ MFLN Y ELP EAL Y+TGECNYGGRVTDD DRR L S+L  F+N ++VE   Y F  SGIY+ PP G  + YIEY ++LP+ P PE++G++ NADITKD  ET  LF  ILLT  R A    KS ++ + E+A DIL KLP NFD+E  M+RYP  Y++SMNTVL QE+ RFNKL+  +R + +N+QKAIKGL VM+ +LEEV +S+L  K+P  W  KSYPSLKPLGSYVND + RL F   W E   P  FW+SGF+FTQ+FLTG  QN+ARKYTIPID +GF++E+       + K  PEDG  ++GLFL+GA W+++ K L ES PKIL++++P++WLKP K   I +  +Y+ P+YKTS RRG LSTTGHSTNFV+ + LP++  + HWI RGVA LCQL+
Sbjct: 3381 RMLIIRCLRPDKVIPMLQEFIINRLGRAFIEPPPFDLAKAFGDSNCCAPLIFVLSPGADPMAALLKFADDQGYGGSKLSSLSLGQGQGPIAMKMLEKAVKEGTWVVLQNCHLATSWMPTLEKVCEELS-PESTHPDFRMWLTSYPSPNFPVSVLQNGVKMTNEAPKGLRANIIRSYLMDPISDPEFFGSCKKPEEFKKLLYGLCFFHALVQERRKFGPLGWNIPYEFNETDLRISVQQLHMFLNQYEELPYEALRYMTGECNYGGRVTDDWDRRTLRSILNKFFNPELVENSDYKFDSSGIYFVPPSGDHKSYIEYTKTLPLTPAPEIFGMNANADITKDQSETQLLFDNILLTQSRSAGAGAKSSDEVVNEVASDILGKLPNNFDIEAAMRRYPTTYTQSMNTVLVQEMGRFNKLLKTIRDSCVNIQKAIKGLAVMSTDLEEVVSSILNVKIPEMWMGKSYPSLKPLGSYVNDFLARLKFLQQWYEVGPPPVFWLSGFFFTQAFLTGAQQNYARKYTIPIDLLGFDYEVM---EDKEYKHPPEDGVFIHGLFLDGASWNRKIKKLAESHPKILYDTVPVMWLKPCKRADIPKRPSYVAPLYKTSERRGVLSTTGHSTNFVIAMTLPSDQPKEHWIGRGVALLCQLN 4023          
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 2335.07 bits (6050), Expect = 0.000e+0
Identity = 1292/3075 (42.02%), Postives = 1885/3075 (61.30%), Query Frame = 1
Query:  325 VKAFFATIASLMSTQLRNMVNASLNDFTEFIKIH-------KNGNNFGVEFDELQFT--DTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEM--RGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRC-DKLRELLVSFEVE-----ENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFH-------WPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFK-KKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKX----XXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQ------------EWVNTIDRES-MSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKL-HLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVD-W--------HFEHGFDGVFN--RLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT---DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDI---EMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGD-FKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            ++     I  ++   LR +V  SL  FT+FI           +  ++G +     +     PL IV+L +    + Y    +  + +L+  +   + ++  +P++E  +  ++   G  L L +V  +E LV               +  + Y   Y+KY  L NN    ++  FLK         +++        +   +  +   S  ++    +N+D  K+   K R+ L +  ++      ++E++ SIC  +  I+ K+ E P   E L  ++++++      VF      EE + ++M   DY  +      L T  F+       WP  I    D+   +     E+  +   +    F+E+LE +   +  F    E+    E+   V+    ++ Q+ DC+      N  E +     + +  L+ M+K   PY  LW TA D+   +++W+  P   ++A  +E +++E  K MHK +KQF D P  Q+VA  ++ +I++FK ++P++Q + NPG++ RHW+ +S+ I  +++P    +    L   L  H+E + ++   A KE+ +E+ L KM+++W  + F +  Y+++   IL + D+   LLDDHI+ +Q+M  SP+ KPFE+ +  WE KL    ++++ WL  Q  WLYLEPIFSSEDI  Q+P E +++  ++  W+++M  + +N   +     + +L  L D N LL+ +QKGL++YLE KR  FPRF+FLS+DELLEILS+TKDP  VQPHL+KCFE I RL F E LEI  M SAEGE + +   IYP+     VE WLL+VE  M  SV  +I  +I++Y    R  WVL+WPGQ+ I     YWT EV EA+   N       + + Q+ D+V LVRG L+  +R+ L AL VI+VHA+DVV  +    V SV+ FEW+SQLRYY    ++++  ++ E  YG EYLGN+ RLVITPLTDRCY TL  AL L  GGAP GPAGTGKTET KDL KA+A Q VVFNCSD LD+ AMGKFFKGLA AGAWACFDEFNRI++EVLSVVAQQI +IQ A  Q ++RF+FEG E+ L P+C +FITMNPGYAGR ELPDNLK LFR VAMMVPDYA+I EISLYS GF +A  LA KI  T++L SEQLSSQ HYD+GMRAVK+V++AAGNL+++ P T NE ++ L+AI DVN+PKFL +D+ LF GI+SDLFP +   + D+ I   A++ +  K  L+  E F+ K +Q+YE  +VRHGLM+VG    GK+         +       +  G + E  V+Y ++NPK+ITMGQLYG+FD ++HEWTDG+ + + R  A+A D  +KW MFDGPVDAVWIENMNTVLDDNKKLCL SGEII+++  M ++FE  DL  ASPATVSRCGM+Y+EP+ LG  PF+E +++  LP  +     Q  + LF   ++  ++F+R+  K++I ++  +  + L KL          +  +++  +++ S +  +        ++  F+FS VWS+G++   + R  F  + R        L  + + +KL     FPE   +YD+  +     + +             WV  +D  +  ++ PD     II+PT +T + +Y L + LT+ KPV+ +GPTGTGK++ ++N L++     Y+++ + FSARTSANQTQD+I +KLD+RRKGV+GPP  +  + F+DDLNMPA E YGAQPPIELLRQW+DHG W+D+K      +L+D   + AMGPPGGGRN ++ R+ RHFN L   E ++ +  RIF+ I++ W         +     G  N   L + LV +T+NVY    +  LPTPAKSHY FNLRD S+V +G+L+   + + +  +L+RLW HE  RVF DRL  EEDR  +FD +     + F     K+               + +++GD+M+   D K Y+ ITS   + + +E +++DYN I+ A + LV+F  AM HI R+ R L+Q  G+ALL+G+GGSGR S TR+A+ MA++E F IE+++NYG +EWR+D+K++L+KAG    P+ FLFSD QIK ESF+EDI+ +LN+GD+PN+Y +DE+ +I+  M+    I+E+     +  T   +   +  RV+ N+H+VL MSPIG+ FR RLR FPSL+NCCTIDWF  WP +AL+ VA  FL +I   E  E   + ++ +C F H+SV     E+L  L R+NYVTP SYLEL+  F  L+  K+ EL T KNR  +GL+KL   S++V KMQ EL+ ++P L   +  T   + +++ DT   E  R+ + AE+  AN KA ++Q I DD + DL EA+P L  A+ASL  L +ND+T VR+M+ PP  +KLV+EAVCIM G KP++ P    G  ++DYW     LL D  +FL+ L  F  D++    IK + + YI   +F P  +   S AC  +C+W+ A+ KY + AK V PK+  L  A+ +LE+T + L E K  L EVE  +  +  +  E   +K+ELE   E C ++L RA++LI GL  EK RW E  + L     NI GDVL++A  VAYLG FT  +R ++ E W  +     +P +    ++  LG PVKIR+W IAGLP D+ S++NG+I   S RW   IDPQGQANKWIKNME+ + L + KL+D +F+R++EN+I+FG P LLENVGEEL+P LEP+L K  ++QQG   L+LGD VI Y++DF+ YITT+L NPHY PEISTK+ L+NF ++P GLEDQLLG V A+E+P+LEE KN LI+ +A  +++LK++EDQIL  LSSS+GN +++   I VL +SK+ + EI  K  IAE T+ +ID TR  Y PVAV   ILFFC+SD+AN+DPMYQYSL WF+N+FL  I NSE++++L+ RI  +N + T S+Y N+CRSLFE HKL+F+  +C+ ++  + K+N   WR+LL+GG ++   + NPAP W+SD+ W +++  S LP+       F     ++++++DS  P
Sbjct:  581 LRKLMELIKYMLQDTLRFLVQDSLGSFTQFIGDACCSVLECVDDMDWGEDLVNSPYKPRKNPLFIVDLVLDNSGVHYSTPLEHFEMILLNLFDKGILATHAVPQLEKLVMEDIFISGDPL-LESVGLHEPLVEELRANITNAMHKAMMPLQAYAKEYRKYLELNNN----DISTFLKTYQTQCPSAEEVREVVITHLKEKEILDNSLPSSIIIGPFYINVDNVKQSLSKKRKALATSMLDILAKNLHKEVD-SICEEFRSISRKIYEKPNSIEELAELRDWMKGIPEKLVF-----LEERIVKVMS--DYEVMDEFFYNLTTDDFNDKWAANNWPSKILGQIDMVRQQHVEDEEKFRKIQLMDQNNFQEKLEGLQLVVAGFSIHVEIARAHEIANEVR---RVKKQLKDCQQLAMLYNNRERIFGLPITNYDKLSRMVKEFQPYLDLWTTASDWLRWSESWMNDPLSAIDAEQLEKNVIESFKTMHKCVKQFKDIPACQEVALDIRTRIEEFKPYIPLIQGLRNPGMRNRHWEVLSNEININVRPKANLTFARCLEMNLQDHIESISKVAEVAGKEYAIEQALDKMEKEWSSILFNVLPYKETDTYILKSPDEASQLLDDHIVMTQSMSFSPYKKPFEQRINSWETKLKLTQEVLEEWLNCQRAWLYLEPIFSSEDITRQLPVESKRYQTMERIWRKIMKNAYENREVINVCSDQRLLDSLRDCNKLLDLVQKGLSEYLETKRTAFPRFYFLSDDELLEILSQTKDPTAVQPHLRKCFENIARLLFQEDLEITHMYSAEGEEVKLSFSIYPSSN---VEDWLLEVERSMKASVHDIIEMAIKAYPTMLRTEWVLNWPGQVTIAGCQTYWTMEVAEALEAGNISSKLFPQLSKQLSDLVALVRGKLSRMQRMVLSALIVIEVHAKDVVSKLIDENVVSVHDFEWISQLRYYWTKDDLYIRAVNAEFIYGYEYLGNSGRLVITPLTDRCYLTLTGALHLKFGGAPAGPAGTGKTETTKDLGKALAIQTVVFNCSDQLDFMAMGKFFKGLASAGAWACFDEFNRIDIEVLSVVAQQITTIQKAQQQRVERFMFEGVEIPLVPSCAVFITMNPGYAGRTELPDNLKALFRPVAMMVPDYAMIAEISLYSFGFNEANVLAKKITTTFKLSSEQLSSQDHYDFGMRAVKTVISAAGNLKRENP-TMNEELICLRAIRDVNVPKFLQEDLKLFSGIVSDLFPTIKEEETDYGILDQAIRRSCEKNNLKDVEGFLIKCIQLYETTVVRHGLMLVGPTGSGKSNCYRVLAAAMTLLKGKPSISGGVYE-AVNYYVLNPKSITMGQLYGEFDLLTHEWTDGIFSSLIRAGAIASDTNKKWYMFDGPVDAVWIENMNTVLDDNKKLCLSSGEIIKLTEAMTMMFEVQDLAVASPATVSRCGMVYLEPSILGLMPFVECWLK-RLPAIIKPYEEQF-KSLFTKYLENSINFVRNTVKEVIASTNSNLTMSLLKLLDCFFRPFLPREGLKKIPSEKLSHIPEL--------IEPWFIFSLVWSVGATGDHTSRISFSQWLR--------LKMRLEQVKL----GFPEDGLVYDYRLDDAGISSTEDDDEEEDENKQVSWVKWMDYSAPFTMMPDTNYCNIIVPTMDTVQMSYLLGMLLTNHKPVLCIGPTGTGKTLTVSNKLLKYLPLEYISHFLTFSARTSANQTQDLIDSKLDKRRKGVFGPPLGRNFIFFIDDLNMPALETYGAQPPIELLRQWMDHGGWYDRKVIGAFKNLVDINFVCAMGPPGGGRNAITPRLTRHFNYLSFIEMDEVSKKRIFSIILECWMDGLLGEKSYREPVPGAPNIDDLTEPLVDATINVYGIITSQLLPTPAKSHYTFNLRDLSKVFQGMLMAEPSKVEDKVQLLRLWYHENCRVFRDRLVNEEDR-SWFDELLEAQMEEFGVAFNKVC------------PFQPILYGDFMSPGSDVKSYELITSESKMMQVIEEYMEDYNQINTAKLRLVLFVDAMSHICRISRTLRQALGNALLLGVGGSGRSSLTRLASHMAEYECFQIELSKNYGMSEWREDVKKVLLKAGLQNLPITFLFSDTQIKNESFLEDINNVLNSGDIPNIYSADEQDQIINTMR--PYIQEQG----LQPTKANLMAAYTGRVRSNIHMVLCMSPIGEVFRARLRQFPSLVNCCTIDWFNEWPAEALKSVATTFLSEIPELECSEEVIQGLIQVCVFIHQSVASKCVEYLAELARHNYVTPKSYLELLNIFSILIGQKKMELKTAKNRMKSGLDKLLRTSEDVAKMQEELEIMRPLLEEAAKDTMLTMEQIKVDTAIAEETRKSVQAEEIKANEKANKAQAIADDAQKDLDEALPALDAALASLRNLNKNDVTEVRAMQRPPPGVKLVIEAVCIMKGIKPKKVPGEKPGSKVDDYWEPGKGLLQDPGRFLESLFKFDKDNIGEAVIKAI-QPYIDNEEFQPAAIAKVSKACTSICQWVRAMHKYHFVAKAVEPKRQALREAQDDLEVTQRILEEAKHHLHEVEDGIATMQAKYRECVAKKEELEMKCEQCEQRLGRADKLINGLADEKVRWQETVENLENMLDNIFGDVLVAAGFVAYLGPFTGQYRTTLYEYWVNQLTVHHVPHTSKPTLITTLGNPVKIRSWQIAGLPNDTLSVENGVINQFSQRWTHFIDPQGQANKWIKNMERESGLDVFKLSDRDFLRSMENAIRFGKPCLLENVGEELDPALEPVLLKQTYKQQGNIVLKLGDTVIPYHEDFRMYITTKLPNPHYSPEISTKLTLINFTLSPSGLEDQLLGQVVAEERPDLEEAKNQLIVSNAKMRQELKDIEDQILYRLSSSEGNPVDDMELIKVLEASKMKAAEIQAKVRIAEQTEKDIDLTRMEYIPVAVRTQILFFCVSDLANVDPMYQYSLEWFLNIFLSGIANSERADNLKKRIVNINRYLTFSLYSNVCRSLFEKHKLMFAFLLCVRIMMNEGKINQAEWRYLLSGG-SIQTMFENPAPQWLSDRAWRDILALSNLPTFATFSNDFVMYLSEFQAIFDSAEP 3591          

HSP 2 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 330/653 (50.54%), Postives = 454/653 (69.53%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYS-PPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLD 11353
            L    KL++LRC+R DK+  A+Q F+  +L   FI+P   +L + F +SN  +PLIFVLSPG DP   L KF E+  + + K ++ISLGQGQGP A  M+  +I+ G WV  QNCHLA SWM +LE++ E I  P+  H++FRLWLTS PS  FPVSILQNG KMT EPP+G++ANLL+SY  + +SD+ F   C     + ++L  LC FH    ERRKFGPLG+NIPYEF + DLRI + Q++MFL++Y ++P + L Y  GE NYGGRVTDD DRR ++++L+ FYN  ++  E + +S SGIY+  PP      Y+ YI+SLP+N  PE++GLH+NA+IT    ET  LF+ IL   P+ +S  G+S E+ ++++A++IL ++P   +L+ + K++PV+Y ESMNTVL QE+IR+NKL+ V+  TL ++ KAIKGLVVM+ ELE +  S+    VP  W +K+YPSLKPL S++ DL+ RL+F H WI + +P  FWISGF+F Q+FLTG LQNFARK+ I ID + F+F++   + S++IK RP+ G  ++GLFLEGARWD  N  L ES PK L+  + +IWL P     +     YLCP+YKT  R GTLSTTGHSTN+V+ +++P+N  Q HWI RGVA +C LD
Sbjct: 3604 LDEFQKLLILRCLRGDKVTNAMQDFVATHLEPRFIEPQTANLSAVFKESNSTTPLIFVLSPGTDPAADLYKFAEEMKF-SKKFSAISLGQGQGPRAEAMMRNSIERGKWVFFQNCHLAPSWMPALERLIEHIN-PDKVHRDFRLWLTSLPSNKFPVSILQNGSKMTIEPPRGVKANLLKSY--NSLSDD-FLHSCQKVVEFKSLLLSLCLFHGNALERRKFGPLGFNIPYEFTDGDLRICISQLKMFLDEYEDIPYKVLKYTAGEINYGGRVTDDWDRRCVMNILEDFYNPAVLSSE-HSYSNSGIYHQIPPTYDLNGYLSYIKSLPLNDMPEIFGLHDNANITFAQNETFALFNAILQLQPKSSSMGGQSREELVEDVAENILLQVPGPIELQEVTKKFPVLYEESMNTVLVQEVIRYNKLLEVITQTLSDMLKAIKGLVVMSLELELMSISLYNNTVPELWKSKAYPSLKPLASWIMDLLLRLDFMHSWINDGIPPVFWISGFFFPQAFLTGTLQNFARKFVISIDTITFDFKVLP-EASSEIKERPQTGCYIHGLFLEGARWDSMNFQLAESRPKELYTEMAVIWLLPEANRKVQNQDFYLCPIYKTLTRAGTLSTTGHSTNYVIAVEIPSNQPQRHWIKRGVALICALD 4249          
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A267EPJ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017039g2 PE=4 SV=1)

HSP 1 Score: 4360.06 bits (11307), Expect = 0.000e+0
Identity = 2118/3104 (68.23%), Postives = 2568/3104 (82.73%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTE--ESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYV---------ITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIR------NQPSVEEAETQ-EDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F + RFI+ +EL +  LP+ P +FE  ++  C + H VLK  WLPRCA+ F D    W HLLP++   ++  V++FF+ +A+LMS QLR++V  S+ DF  F++ +  GN+FG +FD+L+F    ++I++L++ EPKI++ P+FKE+KDLLIRC   I+ +SE++PRVEV LFPE+ GQ+L LRTV+ NE+LV  + D  MQ F DNT GP+ YL  YK YG+L+N K + +V+ FLKERH LL+LKKKID YQ LK EV+++R++V L++F LD  +LN D+  R  +LR+ LV FEV+ENRE NRS CR+YD+I+ +V   P  T  LV +Q+FL E+S   V++LKEE  EA  RLMFLLDYA +  ED+K+N+TLF  P +I+ VF++AT R+QNRRE  EEDL+ R+  F E+++   K IE FKKKEVM  +EM +NV+ L  L+  +++ +++L+ LN+EE +L WE + FP L TM +   PY  LW+TA   H+K++ W K  F  L+   I N++  M     KL+K F+D PG Q VA+KV+  ++KF+ HLPV++++C+PG+++RHW+QMSDI+GFD+ P E  E+ L  FL Y L  HLE+L EI + A KEH LE  L KMK +W ++ F L +YRDSGVSILS++D+IQ+LLDDHI+K+QTM+GSPFIKPFE+EM+ WE+KL+SM DI+DVWLKVQ+TWLYLEPIFSSEDILAQMPEEGR+FGIVD TWKE+M+ +V++P CL AT Q+DMLKRLTDS+ LLE IQKGLN+YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI RL+FTEQ EI+GM+SAEGET+  VTKI P KAKGMVEKWLLQVE+VMINSV+KVI +S+ +Y          +  R +WVLDWPGQ+V+CVS IYWT EV +A+   +GL +YL KCNSQI++IV+LVR  LASGERITLGALTVIDVHARDVV  + +  VSS N F WLSQLRY   G +V VCQI+TEL YG EYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQI  IQ+AIAQGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARAL+SKIVATY+LCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQK+PD E+E++LLLKAINDVNLPKFL+QDIPLFEGIISDLFPGV++ K D+ +FF A+KDNL KRKLQ   WF++KILQ+YEMILVRHGLMIVGE  GGKTQ YQ LA AL+D+ +   M+E+KV + IINPKAI+MGQLYGQFDPVSHEWTDGVLA  FREFAVAQ+D R W++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIY+EP+QLGWRP M+S++++ELP  L E+H +LI DLFEWL+DPCL FI+H+C+ LI  S+IH V    +L+  LLDEIR      ++P  E AE   E      +S   ++ WLQG+FLF+FVWS+ + L   GR KFD FFR L  G N  +PKPKS KLTKSN FP+R +IYDFCFEKK+ G W +W++ IDR  +SI  +AKI+E+++ T +TARQT+FL  F+ H  P + VGPTGTGKS + N+Y+V LPK++Y+ N INFSARTSANQTQDI+M+KLDRRRKG+YGPP  K+CV+FVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFD+KDTS   L D L ++AMGPPGGGR+D++SR  RH NV+G++EF+D TM RIFTTI DWHF  GF+G F RLGKL+V++T+ VYK+A+A+FLPTP KSHYVFNLRDF+RV++GVLLVP +++   EKLMRLWVHEVYRVFYDRL   EDRLKFFDIVK T +D F+ N+EKILGHL+LSGKV DEDVR LIFGDYM D +IYDE+T LK L  RME  L +YN +S+ PM LVMFQFA+EHISRVCRVLKQDNGHALLVG+GGSGRQSA ++A  ++D+ IF IEI++NYG NEWRDDLKRL+  AGC+AKP VFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEI+EKMQ AAR EE+ TGRKI++TP+AMYNYFIERV+QNLHIVL+MSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDI+M+++ R  IV MCK +HESVR LS++F + LRRYNYVTPTSYLELI+TF+KL++ KRNEL T++NRYLTGLEKLEFA+ EVGKMQ EL+ LQP+L VTS +T+KLL K+EQD VEVEAK+E+++A++   N  AA +Q IKD+CE DL+EAMP L +A+ +L+TLK +DI  VR++K+PP +IKLVMEAVC+ML EKP RKP+  TG+MIEDYW +S+++L D +FLDRL+ +  D + P  +K++R+ Y+P+PDF+PK+V+NASTACEGLCKW+ A+DKYD  AK+VAPKK KL IAE +L+  + +L  K+A+L EV+ KLQ L D+L+E Q +KKELED I+LC KKL RAE+LIGGLGGEK RWT AA+ML ERY+NI GDVL+S+AVVAYLG FTV +RNSV++ WH+ C E  IPCS SF+M+D+LGEPV IR WNIAGLPVDSFSIDNGI+V NSNRWPL IDPQGQANKW+KNMEK+ +L++IK TD+++VR LENSIQFG PVLLENVGEEL+PILE +L K  ++Q GV+Y++LGD+VIEY+KDF+FYITT LRNPHYLPE+S KV LLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA+NK++LKE+ED+ILEVLSS+QGNILENE+AI +LSSSK LS+EISEKQ +AE TQ+EID+TRNGYKPVA+HGSILFFCISDMANIDPMYQYSL WFINLFLMSI NSEKS +L+ RI  LN+HFT S+YRNICRSLFE  KLLFSL MCIA++KG+NKV+D++WRFLLTGGVALDNP PNPAP W+ DK W+E+VRAS LP++ G  EH ++NT KWK MYDS +P
Sbjct:  301 FASLRFIDTHELDACELPLLPREFEEKVQSLCAKTHEVLKTRWLPRCAKAFQDLHDQWKHLLPQKEADSTALVQSFFSCVAALMSAQLRSLVVNSIEDFVAFLERYSEGNDFGEKFDDLRFVKASILILKLRIEEPKIVFDPAFKEIKDLLIRCIGTIIGASENLPRVEVRLFPELVGQKLMLRTVLTNEQLVHEFTDRAMQAFTDNTKGPQKYLFEYKTYGDLINGKGDADVQNFLKERHSLLSLKKKIDDYQQLKSEVAVMRITVSLNMFTLDCVQLNQDLCARAQRLRDQLVQFEVDENREQNRSTCRKYDEISEEVRSTPETTAELVRLQQFLTESSEVTVYKLKEEINEAAARLMFLLDYAIMSPEDLKVNSTLFLAPANITTVFEMATGRLQNRREAAEEDLKKRVAAFGEKIDGYYKEIESFKKKEVMLPDEMAKNVEQLTRLEVDLENAREELDGLNEEEKLLEWEPTAFPTLRTMFQMKQPYDNLWKTAQQIHLKSEEWQKADFTTLSFEEISNELSNMFSSATKLMKVFSDTPGPQMVANKVRRNVEKFRQHLPVIEIVCSPGLRKRHWEQMSDIVGFDLSPPEGEETPLSTFLDYDLKDHLERLLEISSGAQKEHTLESNLKKMKAEWNDLSFSLIDYRDSGVSILSSVDEIQLLLDDHIMKAQTMRGSPFIKPFEEEMRAWEEKLISMQDIMDVWLKVQSTWLYLEPIFSSEDILAQMPEEGRRFGIVDTTWKEIMSTAVEDPRCLTATDQKDMLKRLTDSHELLELIQKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRLDFTEQQEIVGMVSAEGETVPFVTKIQPHKAKGMVEKWLLQVEDVMINSVRKVIIESVMAYPSDLNFKPKNMQPRRQWVLDWPGQVVLCVSSIYWTSEVAQAMKSQDGLGEYLKKCNSQIEEIVELVRSKLASGERITLGALTVIDVHARDVVRELTEKGVSSPNDFLWLSQLRYTFNGSDVTVCQITTELAYGYEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHCIQVAIAQGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALSSKIVATYKLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKLPD-EDEAVLLLKAINDVNLPKFLAQDIPLFEGIISDLFPGVEIAKPDYSVFFDAIKDNLAKRKLQPVPWFLEKILQVYEMILVRHGLMIVGETLGGKTQGYQALADALSDLNSANLMEEFKVVHRIINPKAISMGQLYGQFDPVSHEWTDGVLATTFREFAVAQNDHRHWILFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYLEPSQLGWRPSMQSYMQHELPKNLTEEHRELITDLFEWLVDPCLSFIKHSCRVLIRLSDIHLVQSFMRLYSCLLDEIRANARDGSEPVEEGAEAAGEMIGAGELSDTQVFQWLQGIFLFAFVWSVSAHLSGDGRKKFDQFFRNLITGTNADFPKPKSCKLTKSNIFPDRGSIYDFCFEKKASGVWIDWMDIIDRSLLSIPKEAKISEVVVQTSDTARQTFFLRTFMGHGVPCMFVGPTGTGKSAICNSYIVSLPKEKYIPNMINFSARTSANQTQDIVMSKLDRRRKGIYGPPMGKKCVLFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDRKDTSAFKLQDVLFVTAMGPPGGGRSDITSRFTRHMNVIGIDEFDDATMSRIFTTIADWHFSKGFEGGFLRLGKLMVTATLQVYKEAVANFLPTPTKSHYVFNLRDFARVVRGVLLVPASHMTEEEKLMRLWVHEVYRVFYDRLIDPEDRLKFFDIVKQTCSDAFRMNVEKILGHLTLSGKVQDEDVRALIFGDYMADSRIYDEVTDLKALTLRMEDLLGEYNEVSRTPMRLVMFQFAIEHISRVCRVLKQDNGHALLVGVGGSGRQSAAKLATSISDYAIFQIEISKNYGSNEWRDDLKRLMRAAGCEAKPTVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEIIEKMQQAARQEERDTGRKIEATPLAMYNYFIERVRQNLHIVLSMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIDMEDDERLQIVAMCKHFHESVRLLSQQFRDELRRYNYVTPTSYLELIQTFRKLISMKRNELTTMRNRYLTGLEKLEFAAGEVGKMQKELQDLQPKLKVTSEETEKLLVKIEQDAVEVEAKKEVVSADEAITNEAAAAAQAIKDECEEDLSEAMPALEEAIRALNTLKPSDINEVRALKSPPAIIKLVMEAVCVMLAEKPVRKPEPGTGRMIEDYWDTSMRILNDTRFLDRLRTYDKDHITPAIMKRIRDVYMPKPDFEPKVVKNASTACEGLCKWVRAMDKYDAVAKVVAPKKEKLKIAEADLQEQMTKLNAKRAELKEVQDKLQALYDELEENQNKKKELEDQIDLCEKKLVRAEKLIGGLGGEKDRWTAAAEMLGERYHNIIGDVLLSSAVVAYLGAFTVDYRNSVIDEWHQLCKEKQIPCSASFRMVDVLGEPVLIREWNIAGLPVDSFSIDNGIMVKNSNRWPLMIDPQGQANKWVKNMEKNKKLAVIKPTDSSYVRVLENSIQFGIPVLLENVGEELDPILENVLNKQTYKQAGVEYIKLGDSVIEYSKDFRFYITTSLRNPHYLPEVSVKVVLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLILESAENKKQLKEIEDKILEVLSSAQGNILENESAITILSSSKKLSEEISEKQAVAETTQIEIDETRNGYKPVALHGSILFFCISDMANIDPMYQYSLTWFINLFLMSIVNSEKSNELDERISNLNEHFTNSIYRNICRSLFEKDKLLFSLIMCIAIMKGQNKVDDKVWRFLLTGGVALDNPNPNPAPEWLQDKNWAEIVRASSLPNLHGFMEHVRDNTAKWKEMYDSTAP 3403          

HSP 2 Score: 1074.31 bits (2777), Expect = 0.000e+0
Identity = 507/659 (76.93%), Postives = 560/659 (84.98%), Query Frame = 2
Query: 9380 PDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            PD FR L+GLD L+VLRC RPDK+VPAVQSFI DNLGQT+I+PP FDL  SF DSNCCSPLIFVLSPGADPM +L K GED+G+    I  ISLGQGQGPIA +MI QAI+DGTWVVLQNCHLATSWM +LEKIC E+IIPENTH+NFRLWLTSYPSE FPVSILQNGVKMTNEPPKGLRANLLRS+LNDPISD KFF GC +N RWH MLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRIS+RQMQMFLN+Y ELPL+ALTYLTGECNYGGRVTDDKDRRLL SLL IFY   +V  E Y FS SG YY+P +G  Q Y++YIRSLP+NP PEVYGLH+NADITKDNQETNQLF GILLTLPR++ GEGKSPE +IQELA DIL KLP+NFDLEM+M++YPV Y+ESMNTVLRQELIRFN+LISVVR TL NLQKAIKGLVVM++ELE VF SML+GKVP  WAAKSYPSLKPLGSYVNDL+ RL F   W+++  P TFWISGFYFTQSFLTGVLQN+ARKYTIPID V FEFE+T       I  +PEDGA V GLFLEGARWD E  +L ES PKILF+++P++WLKP K   ID++ TY CPVYKTSARRG LSTTGHSTNFVL I L       HWINRGVA+LCQLDD
Sbjct: 3409 PDRFRALEGLDSLVVLRCFRPDKMVPAVQSFIVDNLGQTYIEPPTFDLAGSFADSNCCSPLIFVLSPGADPMASLTKLGEDKGFTPEAIGRISLGQGQGPIAEQMIRQAIKDGTWVVLQNCHLATSWMTALEKICNEVIIPENTHENFRLWLTSYPSESFPVSILQNGVKMTNEPPKGLRANLLRSFLNDPISDPKFFSGCQENKRWHKMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQMQMFLNEYEELPLDALTYLTGECNYGGRVTDDKDRRLLNSLLNIFYVPAVVTDENYRFSASGHYYAPKEGPYQSYVDYIRSLPLNPLPEVYGLHDNADITKDNQETNQLFDGILLTLPRESDGEGKSPEATIQELAADILAKLPKNFDLEMVMEKYPVEYTESMNTVLRQELIRFNRLISVVRETLQNLQKAIKGLVVMSSELENVFTSMLVGKVPAVWAAKSYPSLKPLGSYVNDLLARLKFLQTWVDSGAPPTFWISGFYFTQSFLTGVLQNYARKYTIPIDTVSFEFEVTK--EPEYINEKPEDGAYVSGLFLEGARWDHEGGVLTESYPKILFDTLPVLWLKPAKTADIDKTGTYDCPVYKTSARRGVLSTTGHSTNFVLLIFLATKQPPQHWINRGVAALCQLDD 4065          
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A1I8J3L2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4336.18 bits (11245), Expect = 0.000e+0
Identity = 2116/3127 (67.67%), Postives = 2565/3127 (82.03%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKK-----------------------IDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTE--ESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYV---------ITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIR------NQPSVEEAETQ-EDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F + RFI+ +EL +  LP+ P +FE  ++  C + H VLK  WLPRCA+ F D    W HLLP++   ++  V++FF+ +A+LMS QLR++V  S+ DF  F++ +  GN+FG +FD+L+F    ++I++L++ EPKI++ P+FKE+KDLLIRC   I+ +SE++PRVEV LFPE+ GQ+L LRTV+ NE+LV  + D  MQ F DNT GP+ YL  YK YG+L+N K + +V+ FLKERH LL+LKKK                       ID YQ LK EV+++R++V L++F LD  +LN D+  R  +LR+ LV FEV+ENRE NRS CR+YD+I+ +V   P  T  LV +Q+FL E+S   V++LKEE  EA  RLMFLLDYA +  ED+K+N+TLF  P +I+ VF++AT R+QNRRE  EEDL+ R+  F E+++   K IE FKKKEVM  +EM +NV+ L  L+  +++ +++L+ LN+EE +L WE + FP L TM +   PY  LW+TA   H+K++ W K  F  L+   I N++  M     KL+K F+D PG Q VA+KV+  ++KF+ HLPV++++C+PG+++RHW+QMSDI+GFD+ P E  E+ L  FL Y L  HLE+L EI + A KEH LE  L KMK +W ++ F L +YRDSGVSILS++D+IQ+LLDDHI+K+QTM+GSPFIKPFE+EM+ WE+KL+SM DI+DVWLKVQ+TWLYLEPIFSSEDILAQMPEEGR+FGIVD TWKE+M+ +V++P CL AT Q+DMLKRLTDS+ LLE IQKGLN+YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI RL+FTEQ EI+GM+SAEGET+  VTKI P KAKGMVEKWLLQVE+VMINSV+KVI +S+ +Y          +  R +WVLDWPGQ+V+CVS IYWT EV +A+   +GL +YL KCNSQI++IV+LVR  LASGERITLGALTVIDVHARDVV  + +  VSS N F WLSQLRY   G +V VCQI+TEL YG EYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQI  IQ+AIAQGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARAL+SKIVATY+LCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQK+PD E+E++LLLKAINDVNLPKFL+QDIPLFEGIISDLFPGV++ K D+ +FF A+KDNL KRKLQ   WF++KILQ+YEMILVRHGLMIVGE  GGKTQ YQ LA AL+D+ +   M+E+KV + IINPKAI+MGQLYGQFDPVSHEWTDGVLA  FREFAVAQ+D R W++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIY+EP+QLGWRP M+S++++ELP  L E+H +LI DLFEWL+DPCL FI+H+C+ LI  S+IH V    +L+  LLDEIR      ++P  E AE   E      +S   ++ WLQG+FLF+FVWS+ + L   GR KFD FFR L  G N  +PKPKS KLTKSN FP+R +IYDFCFEKK+ G W +W++ IDR  +SI  +AKI+E+++ T +TARQT+FL  F+ H  P + VGPTGTGKS + N+Y+V LPK++Y+ N INFSARTSANQTQDI+M+KLDRRRKG+YGPP  K+CV+FVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFD+KDTS   L D L ++AMGPPGGGR+D++SR  RH NV+G++EF+D TM RIFTTI DWHF  GF+G F RLGKL+V++T+ VYK+A+A+FLPTP KSHYVFNLRDF+RV++GVLLVP +++   EKLMRLWVHEVYRVFYDRL   EDRLKFFDIVK T +D F+ N+EKILGHL+LSGKV DEDVR LIFGDYM D +IYDE+T LK L  RME  L +YN +S+ PM LVMFQFA+EHISRVCRVLKQDNGHALLVG+GGSGRQSA ++A  ++D+ IF IEI++NYG NEWRDDLKRL+  AGC+AKP VFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEI+EKMQ AAR E    GRKI++TP+AMYNYFIERV+QNLHIVL+MSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDI+M+++ R  IV MCK +HESVR LS++F + LRRYNYVTPTSYLELI+TF+KL++ KRNEL T++NRYLTGLEKLEFA+ EVGKMQ EL+ LQP+L VTS +T+KLL K+EQD VEVEAK+E+++A++   N  AA +Q IKD+CE DL+EAMP L +A+ +L+TLK +DI  VR++K+PP +IKLVMEAVC+ML EKP RKP+  TG+MIEDYW +S+++L D +FLDRL+ +  D + P  +K++R+ Y+P+PDF+PK+V+NASTACEGLCKW+ A+DKYD  AK+VAPKK KL IAE +L+  + +L  K+A+L EV+ KLQ L D+L+E Q +KKELED I+LC KKL RAE+LIGGLGGEK RWT AA+ML ERY+NI GDVL+S+AVVAYLG FTV +RNSV++ WH+ C E  IPCS SF+M+D+LGEPV IR WNIAGLPVDSFSIDNGI+V NSNRWPL IDPQGQANKW+KNMEK+ +L++IK TD+++VR LENSIQFG PVLLENVGEEL+PILE +L K  ++Q GV+Y++LGD+VIEY+KDF+FYITT LRNPHYLPE+S KV LLNFMITP GL+DQLLGIVAAKEKPELEEKKN LI+ESA+NK++LKE+ED+ILEVLSS+QGNILENE+AI +LSSSK LS+EISEKQ +AE TQ+EID+TRNGYKPVA+HGSILFFCISDMANIDPMYQYSL WFINLFLMSI NSEKS +L+ RI  LN+HFT S+YRNICRSLFE  KLLFSL MCIA++KG+NKV+D++WRFLLTGGVALDNP PNPAP W+ DK W+E+VRAS LP++ G  EH ++NT KWK MYDS +P
Sbjct:  301 FASLRFIDTHELDACELPLLPREFEEKVQSLCAKTHEVLKTRWLPRCAKAFQDLHDQWKHLLPQKEADSTALVQSFFSCVAALMSAQLRSLVVNSIEDFVAFLERYSEGNDFGEKFDDLRFVKASILILKLRIEEPKIVFDPAFKEIKDLLIRCIGTIIGASENLPRVEVRLFPELVGQKLMLRTVLTNEQLVHEFTDRAMQAFTDNTKGPQKYLFEYKTYGDLINGKGDADVQNFLKERHSLLSLKKKTPRPFTDRQLDQFELSEEAAHKKIDDYQQLKSEVAVMRITVSLNMFTLDCVQLNQDLCARAQRLRDQLVQFEVDENREQNRSTCRKYDEISEEVRSTPETTAELVRLQQFLTESSEVTVYKLKEEINEAAARLMFLLDYAIMSPEDLKVNSTLFLAPANITTVFEMATGRLQNRREAAEEDLKKRVAAFGEKIDGYYKEIESFKKKEVMLPDEMAKNVEQLTRLEVDLENAREELDGLNEEEKLLEWEPTAFPTLRTMFQMKQPYDNLWKTAQQIHLKSEEWQKADFTTLSFEEISNELSNMFSSATKLMKVFSDTPGPQMVANKVRRNVEKFRQHLPVIEIVCSPGLRKRHWEQMSDIVGFDLSPPEGEETPLSTFLDYDLKDHLERLLEISSGAQKEHTLESNLKKMKAEWNDLSFSLIDYRDSGVSILSSVDEIQLLLDDHIMKAQTMRGSPFIKPFEEEMRAWEEKLISMQDIMDVWLKVQSTWLYLEPIFSSEDILAQMPEEGRRFGIVDTTWKEIMSTAVEDPRCLTATDQKDMLKRLTDSHELLELIQKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRLDFTEQQEIVGMVSAEGETVPFVTKIQPHKAKGMVEKWLLQVEDVMINSVRKVIIESVMAYPSDLNFKPKNMQPRRQWVLDWPGQVVLCVSSIYWTSEVAQAMKSQDGLGEYLKKCNSQIEEIVELVRSKLASGERITLGALTVIDVHARDVVRELTEKGVSSPNDFLWLSQLRYTFNGSDVTVCQITTELAYGYEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHCIQVAIAQGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALSSKIVATYKLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKLPD-EDEAVLLLKAINDVNLPKFLAQDIPLFEGIISDLFPGVEIAKPDYSVFFDAIKDNLAKRKLQPVPWFLEKILQVYEMILVRHGLMIVGETLGGKTQGYQALADALSDLNSANLMEEFKVVHRIINPKAISMGQLYGQFDPVSHEWTDGVLATTFREFAVAQNDHRHWILFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYLEPSQLGWRPSMQSYMQHELPKNLTEEHRELITDLFEWLVDPCLSFIKHSCRVLIRLSDIHLVQSFMRLYSCLLDEIRANARDGSEPVEEGAEAAGEMIGAGELSDTQVFQWLQGIFLFAFVWSVSAHLSGDGRKKFDQFFRNLITGTNADFPKPKSCKLTKSNIFPDRGSIYDFCFEKKASGVWIDWMDIIDRSLLSIPKEAKISEVVVQTSDTARQTFFLRTFMGHGVPCMFVGPTGTGKSAICNSYIVSLPKEKYIPNMINFSARTSANQTQDIVMSKLDRRRKGIYGPPMGKKCVLFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDRKDTSAFKLQDVLFVTAMGPPGGGRSDITSRFTRHMNVIGIDEFDDATMSRIFTTIADWHFSKGFEGGFLRLGKLMVTATLQVYKEAVANFLPTPTKSHYVFNLRDFARVVRGVLLVPASHMTEEEKLMRLWVHEVYRVFYDRLIDPEDRLKFFDIVKQTCSDAFRMNVEKILGHLTLSGKVQDEDVRALIFGDYMADSRIYDEVTDLKALTLRMEDLLGEYNEVSRTPMRLVMFQFAIEHISRVCRVLKQDNGHALLVGVGGSGRQSAAKLATSISDYAIFQIEISKNYGSNEWRDDLKRLMRAAGCEAKPTVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEIIEKMQQAARQE----GRKIEATPLAMYNYFIERVRQNLHIVLSMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIDMEDDERLQIVAMCKHFHESVRLLSQQFRDELRRYNYVTPTSYLELIQTFRKLISMKRNELTTMRNRYLTGLEKLEFAAGEVGKMQKELQDLQPKLKVTSEETEKLLVKIEQDAVEVEAKKEVVSADEAITNEAAAAAQAIKDECEEDLSEAMPALEEAIRALNTLKPSDINEVRALKSPPAIIKLVMEAVCVMLAEKPVRKPEPGTGRMIEDYWDTSMRILNDTRFLDRLRTYDKDHITPAIMKRIRDVYMPKPDFEPKVVKNASTACEGLCKWVRAMDKYDAVAKVVAPKKEKLKIAEADLQEQMTKLNAKRAELKEVQDKLQALYDELEENQNKKKELEDQIDLCEKKLVRAEKLIGGLGGEKDRWTAAAEMLGERYHNIIGDVLLSSAVVAYLGAFTVDYRNSVIDEWHQLCKEKQIPCSASFRMVDVLGEPVLIREWNIAGLPVDSFSIDNGIMVKNSNRWPLMIDPQGQANKWVKNMEKNKKLAVIKPTDSSYVRVLENSIQFGIPVLLENVGEELDPILENVLNKQTYKQAGVEYIKLGDSVIEYSKDFRFYITTSLRNPHYLPEVSVKVVLLNFMITPLGLQDQLLGIVAAKEKPELEEKKNQLILESAENKKQLKEIEDKILEVLSSAQGNILENESAITILSSSKKLSEEISEKQAVAETTQIEIDETRNGYKPVALHGSILFFCISDMANIDPMYQYSLTWFINLFLMSIVNSEKSNELDERISNLNEHFTNSIYRNICRSLFEKDKLLFSLIMCIAIMKGQNKVDDKVWRFLLTGGVALDNPNPNPAPEWLQDKNWAEIVRASSLPNLHGFMEHVRDNTAKWKEMYDSTAP 3422          

HSP 2 Score: 1074.69 bits (2778), Expect = 0.000e+0
Identity = 507/659 (76.93%), Postives = 560/659 (84.98%), Query Frame = 2
Query: 9380 PDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            PD FR L+GLD L+VLRC RPDK+VPAVQSFI DNLGQT+I+PP FDL  SF DSNCCSPLIFVLSPGADPM +L K GED+G+    I  ISLGQGQGPIA +MI QAI+DGTWVVLQNCHLATSWM +LEKIC E+IIPENTH+NFRLWLTSYPSE FPVSILQNGVKMTNEPPKGLRANLLRS+LNDPISD KFF GC +N RWH MLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRIS+RQMQMFLN+Y ELPL+ALTYLTGECNYGGRVTDDKDRRLL SLL IFY   +V  E Y FS SG YY+P +G  Q Y++YIRSLP+NP PEVYGLH+NADITKDNQETNQLF GILLTLPR++ GEGKSPE +IQELA DIL KLP+NFDLEM+M++YPV Y+ESMNTVLRQELIRFN+LISVVR TL NLQKAIKGLVVM++ELE VF SML+GKVP  WAAKSYPSLKPLGSYVNDL+ RL F   W+++  P TFWISGFYFTQSFLTGVLQN+ARKYTIPID V FEFE+T       I  +PEDGA V GLFLEGARWD E  +L ES PKILF+++P++WLKP K   ID++ TY CPVYKTSARRG LSTTGHSTNFVL I L       HWINRGVA+LCQLDD
Sbjct: 3428 PDRFRALEGLDSLVVLRCFRPDKMVPAVQSFIVDNLGQTYIEPPTFDLAGSFADSNCCSPLIFVLSPGADPMASLTKLGEDKGFTPEAIGRISLGQGQGPIAEQMIRQAIKDGTWVVLQNCHLATSWMTALEKICNEVIIPENTHENFRLWLTSYPSESFPVSILQNGVKMTNEPPKGLRANLLRSFLNDPISDPKFFSGCQENKRWHKMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQMQMFLNEYEELPLDALTYLTGECNYGGRVTDDKDRRLLNSLLNIFYVPAVVTDENYRFSASGHYYAPKEGPYQSYVDYIRSLPLNPLPEVYGLHDNADITKDNQETNQLFDGILLTLPRESDGEGKSPEATIQELAADILAKLPKNFDLEMVMEKYPVEYTESMNTVLRQELIRFNRLISVVRETLQNLQKAIKGLVVMSSELENVFTSMLVGKVPAVWAAKSYPSLKPLGSYVNDLLARLKFLQTWVDSGAPPTFWISGFYFTQSFLTGVLQNYARKYTIPIDTVSFEFEVTK--EPEYINEKPEDGAYVSGLFLEGARWDHEGGVLTESYPKILFDTLPVLWLKPAKTADIDKTGTYDCPVYKTSARRGVLSTTGHSTNFVLLIFLATKQPPQHWINRGVAALCQLDD 4084          
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A4S2M5I4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003580 PE=4 SV=1)

HSP 1 Score: 4321.54 bits (11207), Expect = 0.000e+0
Identity = 2122/3138 (67.62%), Postives = 2560/3138 (81.58%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKK-------------------------KIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY---DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQ-EYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRN---QPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWV--------------------NTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            F   RF+ ++++     P++P  FE +I   C +   +L+++W+P+CA+ FID R  W+HLLP +ST + EPV++FFA +A+LMS QLR++V+ SL D  E ++ H++GN+F   +DEL+F   PL+++ L+V+EPKI++ PSF+E +D L+ C+Q I  ++E +PRVEV +FP +   R FLR+V F E+LV  Y D+ M  F+ N++GPK+YL++Y+ YGNLLNNKAELE+R FLKERH LLA+KK                         KI+A+QDL+ E+++LR++VPLSLF +D + +N ++  R  KLR++LVSFE++ENR++NRSICRRYD+I N++SE P DTE LV +Q ++RE + T VF+LKEE  +A ERL FLLDYA +  +DIKLN+TLF+WP HI +V DV T R+   RE  EEDL+ R    E+R+      I   +K+E +T EEM ++VQ LDE   +++      EQ+NKEE+++ W+ +QFP L  + + +DP+ RLWRTALDF   N  WL+ P+H LNA  IE  + +M K MHKL K   D PG  KVA K+K KI KF+  LPV+ V+CNPGIQ RHWDQMSDI+GFDIKP  ++ L+ FL YGL   LE+LEE+GAAAAKEHQLE T+AKMKE+W+ M+FEL  YRD+G+SILSA+DDIQ+LLDDHIIK+QTM+ SP+IKPFEKEM  WE KL+ MNDI+DVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFG+VDV W+E+M E+  NPSCLVAT QRDML+RLTD+  LLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGI+RL FTEQ EIIGMISAEGET+  VTKI+PAKAKGMVEKWLLQVE+VM++S++KVI+DSI  Y  T R +WVLDWPGQ+VICVSCIYWT+EV EA+   + L  Y  KC+ QIDDIV+LVRG L+SGERITLGAL V+DVHARDVV  M   +++S  AFEWLSQLRYY   +   +V VCQI+TEL YG EYLGNTPRLVITPLTDRCYRTLM A+KLNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY+AM KFFKGLAQ+GAWACFDEFNRI+LEVLSVVAQQI  IQ AI+ GLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGF+DAR+LASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQK  + E+E++LLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLP  D+D F + +   L +R+LQ   W+ DKILQIYEMILVRHGLMIVG+P  GKTQAY+TLA  LT +A  G M+ E+ V YGIINPKAITMGQLYGQFD VSHEW+DG+LA+MFRE+AVAQD +R+W++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS++MNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRP + S+IEY++P C+  + I+LI DLFEWL+DPCL F+R NC++L    ++H V QL  LF  LLDEIR         +A     +  + +SAQ +YL +Q LFLFS VWSIGS+L    R +FD FFR+L  G+N  +PKPK+IKLTK NS PERLT+YDF F+K+S G+WQEW                     NT    S +   ++  +EII+ T ETAR  +FL+L+  +  P+++VGPTGTGK+ + N YLV LPK++Y+ N ++FSARTSANQTQDIIM++LDRRRKGVYGPPP K C+VFVDDLNMP KEKYGAQPPIELLR W+DHGHW+D+KD +K  L D  +++AMGPPGGGRND++SR+ RH NVLGVNEF+DNTM+RIF+ IVD HF  GF+  F RLGK++V +T+ VYK+ + SFLPTPAKSHYVFNLRDF+RVI+GV LVPHT+L   EKLMRLWVHEVYRVFYDRL   ED  KFF+IV+ T +DCF+TN++K+LGHLSLSG+V  EDVRGL+FG+YM DD IYDE+T  K L  RME +L+DYNS+SK PM+LVMF+FA+EHISRV RVL+Q++GHALLVG+GGSGRQSATR+A  + D+++F+IEITRNYG NEWR+DLKRL+IK GCD +  VFL SD+Q+K+ESFMEDISMLLN GDVPNL+P DEKAE+++K+Q  AR E    GRK+D+TP+AMYNYF ERV+++LHIVLAMSPIGD+FR+RLRMFPSLINCCTIDWF  WPEDALEMVANK+ E+IE  +N RE+ V +CK++HESVR+LSE FL  LRR++YVTPTSYLE+I TFKKLL  KR EL T +NRYLTGL+KLEFA+ EVGKMQIEL+ LQP L+ TSA+TD LL K+ QD+VEVEA+RE++AA+Q  AN  AA S+ IKD+CEADLAEAMPIL+DA+ASLDTLKQ+DITLV+SMKNPP ++KLVMEAVCIMLGEKP+R+PD  TG+M ED+W  S+KLLGD KFLDRL+N++ D + P  IKK+R+ YIP  DFDPKIVRNASTACEGLCKWIIA+DKYD  AKIVAPKK KLA+AE ELE+ + +LAEKKA LDEV+AK Q L DQLDE Q +K++LEDNIELC+KKLDRAE+LI GLGGEK+RWT+AA ML  RY+NI GDVL+SA VVAYLG FTV FR  + + WH+ CI++ +PCSE F++ D LG+PVKIR+WNIAGLPVDSFSIDNGIIV NS+RW LCIDPQGQANKWIKNMEKS  L+++KL+D N++RTLEN+IQFG PVL+ENVGE+L+P+LEPILQ+T+F+ QG  Y+RLGDNVIEY+ DF+FYITTRLRNPHYLPE+S KVCL+NFMITP GL DQLLG+V A EKPELE  KN LI+ SADNKR+LKELED+ILEVLS SQGNILENETAINVLSSSK LS+EI+EKQ IAE TQ+EID  RN YKPVA HGS+LFFCISD+ +IDPMYQYSL WFI+LFL SI NSEKS  LE RIE LND+FT SVYRNICRSLFENHKLLFSL MC AL+K KNKV++ +WRFLLTGGVALDNP+PNPAP+W+SDK W+E+VRASELP + G  +  QN  ++W+ MYDS  P
Sbjct:  296 FAQLRFVEVDKIRQLDEPLEPEAFEGIIASHCKKTRDILRSNWIPKCAQAFIDHRNTWAHLLPAKSTDSMEPVRSFFACMAALMSKQLRSIVDQSLKDLLEMLQEHQDGNSFEEPYDELKFLRRPLLLIRLRVSEPKIVFAPSFRETRDCLLHCFQAITDAAEELPRVEVEIFPALANDRHFLRSVSFREQLVIEYTDKAMAVFRANSIGPKDYLDIYRPYGNLLNNKAELELRNFLKERHTLLAVKKRKGKAWLNEPDLVEQVNNSLLTVQQKIEAFQDLRAEITMLRLTVPLSLFCVDCKSVNEELANRAWKLRDILVSFELDENRDVNRSICRRYDEIMNRLSETPPDTESLVQLQAYMREVNNTMVFKLKEEVADAAERLNFLLDYAFLSQDDIKLNSTLFYWPEHILSVLDVTTTRVNMLRENAEEDLKHRTATLEQRILNCWDRITAMRKREGITQEEMVKSVQLLDEFLVELEALISDAEQVNKEEALVQWDPTQFPQLVELRRQMDPFDRLWRTALDFDTCNKNWLQAPYHTLNAYEIEAHVSDMYKTMHKLTKVLADLPGPSKVAQKMKAKIIKFQQFLPVIHVVCNPGIQPRHWDQMSDIVGFDIKPQSDTQLIVFLEYGLKDFLEQLEEVGAAAAKEHQLETTMAKMKEEWRLMRFELLPYRDTGISILSAIDDIQVLLDDHIIKAQTMRNSPYIKPFEKEMVAWETKLILMNDILDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGVVDVIWREIMTEAGVNPSCLVATDQRDMLRRLTDAYILLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGINRLSFTEQQEIIGMISAEGETVPFVTKIFPAKAKGMVEKWLLQVEDVMLSSLRKVISDSIYGYSATAREKWVLDWPGQVVICVSCIYWTEEVQEAMG-NDSLASYKEKCDKQIDDIVRLVRGPLSSGERITLGALIVVDVHARDVVAQMVDHEINSTQAFEWLSQLRYYFDSEDATKVTVCQITTELDYGYEYLGNTPRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYRAMSKFFKGLAQSGAWACFDEFNRIDLEVLSVVAQQIFCIQSAISAGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFIDARSLASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKYLE-EDEAVLLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPTGDYDTFLTVMTQRLEQRQLQPVPWYTDKILQIYEMILVRHGLMIVGDPLSGKTQAYKTLADTLTQLAETGLMESEHPVKYGIINPKAITMGQLYGQFDQVSHEWSDGILAVMFREYAVAQDSKRRWILFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSSQMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPMVRSYIEYKVPECMGGELIELIDDLFEWLVDPCLAFVRSNCRQLFPVPDLHAVKQLIVLFDCLLDEIRQWAINEQAAQAAEAPPNPQQTMSAQTVYLQIQALFLFSIVWSIGSALPTESRIRFDAFFRDLVSGVNSEHPKPKTIKLTKGNSVPERLTVYDFWFDKRSAGSWQEWSQFILPSLEAIPKAEGIVGGENTGSPASPTPQNESDSSEIIVTTIETARMNFFLNLYTINRIPLLLVGPTGTGKTAIANGYLVSLPKEKYIPNTLSFSARTSANQTQDIIMSRLDRRRKGVYGPPPGKECIVFVDDLNMPMKEKYGAQPPIELLRMWMDHGHWYDRKDNTKQILADVRMIAAMGPPGGGRNDITSRLTRHMNVLGVNEFDDNTMLRIFSNIVDAHFSKGFEPQFQRLGKIMVQATLQVYKQTMQSFLPTPAKSHYVFNLRDFARVIRGVQLVPHTHLTEQEKLMRLWVHEVYRVFYDRLIFPEDETKFFEIVRQTCSDCFRTNMDKVLGHLSLSGRVSVEDVRGLLFGNYMQDDNIYDEVTDAKQLTARMEGYLEDYNSLSKTPMNLVMFKFAIEHISRVSRVLQQESGHALLVGVGGSGRQSATRLATHINDYDLFVIEITRNYGVNEWREDLKRLMIKTGCDGRSTVFLISDSQLKEESFMEDISMLLNCGDVPNLFPPDEKAEVIDKVQVHARNE----GRKLDATPLAMYNYFTERVRRHLHIVLAMSPIGDSFRSRLRMFPSLINCCTIDWFHVWPEDALEMVANKYFEEIEFADNARESSVYLCKYFHESVRKLSERFLEILRRHSYVTPTSYLEMILTFKKLLTRKRAELTTTRNRYLTGLQKLEFAASEVGKMQIELRNLQPLLMETSAETDILLRKIAQDSVEVEAQREVVAADQLMANQAAAASKAIKDECEADLAEAMPILQDALASLDTLKQSDITLVKSMKNPPSVVKLVMEAVCIMLGEKPDRRPD-GTGRMTEDFWGPSLKLLGDLKFLDRLRNYNIDHIPPLVIKKIRDNYIPNTDFDPKIVRNASTACEGLCKWIIALDKYDAVAKIVAPKKEKLAVAEAELELQMARLAEKKAALDEVQAKFQALQDQLDEMQTKKQDLEDNIELCSKKLDRAEKLISGLGGEKTRWTDAAAMLKHRYHNIIGDVLLSAGVVAYLGPFTVDFRAGISQEWHELCIKLEVPCSEVFRIADTLGDPVKIRSWNIAGLPVDSFSIDNGIIVTNSDRWSLCIDPQGQANKWIKNMEKSRELNVVKLSDANYLRTLENAIQFGMPVLMENVGEQLDPVLEPILQRTVFKSQGALYMRLGDNVIEYHPDFRFYITTRLRNPHYLPEVSVKVCLINFMITPLGLGDQLLGLVTAAEKPELEATKNELIVTSADNKRQLKELEDKILEVLSVSQGNILENETAINVLSSSKKLSEEITEKQAIAEATQLEIDAARNAYKPVAEHGSLLFFCISDLNSIDPMYQYSLTWFISLFLASIANSEKSNILEERIELLNDYFTNSVYRNICRSLFENHKLLFSLLMCYALMKSKNKVDETVWRFLLTGGVALDNPHPNPAPSWLSDKCWAEIVRASELPGLDGFMDDVQNRPEEWREMYDSMEP 3426          

HSP 2 Score: 1012.68 bits (2617), Expect = 0.000e+0
Identity = 480/701 (68.47%), Postives = 550/701 (78.46%), Query Frame = 2
Query: 9380 PDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITS--FDNST----------------------------------------DIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            P  F  L GL+KL VLRCIRPDK+VP VQ FI +N+G TFI+PP FDL  SF DSNCCSPLIF+LSPGADPMNAL++FG D GY   +I +ISLGQGQGPIAAKMI Q  +DGTW+VLQNCHLA SWM +LEKICEE+I+P   H +FRLWLTSYPS DFPV+IL+NGVKMTNEPPKGLR+NLLRSYLNDPISD  FFDGC+    WH MLFGLCFFHALVQERRKFGPLGWN+PYEFNESDLRISVRQMQMFL+ Y ELPLEALTYLTGECNYGGRVTDDKDRRLLISLL IFYN  IVE+++Y  S SGIYY PPDG    ++EYIR LPINP PEVYGLH+NADITKDNQET QLFSG+LLTLPRQ  G GKS E ++ ELA DIL KLP +FDL+ +++RYPV+Y ESMNTVLRQELIRFN+L +VVRSTL++L+KAIKGLVVM+ +LE++FNSML+GK+P+ WAAKS+PSLKPLGSY+ DL+ RL FF DW+  + P  FWISGFYFTQSFLTGVLQN+ARKYTIPID +GF F +T   F++++                                        D   +PEDGA + GLFLEG RWD     L ES PKILF++IP+IWL+P KL  I+   TY CPVYKTSARRG LSTTGHSTNFV  I L   L + HWINRGVA+LCQLDD
Sbjct: 3432 PGKFSRLVGLEKLTVLRCIRPDKVVPGVQDFIAENMGATFIEPPTFDLAGSFADSNCCSPLIFILSPGADPMNALIRFGADMGYTGDRIQTISLGQGQGPIAAKMISQGTEDGTWIVLQNCHLAVSWMPALEKICEEVIVPSKVHTDFRLWLTSYPSSDFPVTILENGVKMTNEPPKGLRSNLLRSYLNDPISDPAFFDGCSKGPIWHKMLFGLCFFHALVQERRKFGPLGWNVPYEFNESDLRISVRQMQMFLDQYDELPLEALTYLTGECNYGGRVTDDKDRRLLISLLGIFYNRRIVEEDRYKLSSSGIYYCPPDGPHSEFVEYIRQLPINPLPEVYGLHDNADITKDNQETFQLFSGVLLTLPRQQGGSGKSSEATVLELAADILSKLPPDFDLKEVIQRYPVVYKESMNTVLRQELIRFNRLTAVVRSTLLDLKKAIKGLVVMSADLEDIFNSMLVGKLPSVWAAKSFPSLKPLGSYIQDLVLRLKFFADWLTYDSPPVFWISGFYFTQSFLTGVLQNYARKYTIPIDTLGFSFAVTDRYFNHTSLLENAPSVPEFIPRPPPVRRASMVSMVQIPLLKTRPTEQFDGFAKPEDGAFISGLFLEGGRWDPVEGQLAESKPKILFDTIPVIWLRPEKLSNINVEGTYACPVYKTSARRGVLSTTGHSTNFVQYIQLKTALPEQHWINRGVAALCQLDD 4132          
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: K1PBH3 (Dynein heavy chain 3, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10010858 PE=4 SV=1)

HSP 1 Score: 4232.56 bits (10976), Expect = 0.000e+0
Identity = 2070/3093 (66.93%), Postives = 2522/3093 (81.54%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQ--RLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAK--GMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDD--KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F + RF+N+ EL+   LP+ P +FE++IK++C + H VL+ +W+P CA++F+DK  LW HL+P  +  ++E V+ FFA +A+LMS QLR+M+  SL DF  F  IHK GN FG  FDELQ+  T +MI++L+V EPKI++ P F+E++D+++RC+  I+ S E + RVE  LFP+MR    +L LR+V   E LVT Y+D  M+ FK NTVGP+ YLN YKKY +LLNN A+ +V AFL+E H + A KKKI+++QDLKDE+SLLR++VPLS+F LD + LN D+  R  +L+E L+ FEV+ENRE+NR ICRRYD++  KVS++P  TE +V +QE+L+ +S   V++LK+E E+A  RLMFLLDYA  P EDIKLN+T+FHWP HI  VF+++T+RI NRR+  EEDLR R   FEE+L +  K +E FKKKE +  E MR N + L  +   ++  +D+LEQ+NKEE +L WEQS FP L TM    +PY RLW TA  FH +++ WL GPF  LN+  IEN++ +M + M+KL KQF+D  G ++VA  VK K+DKFK HLP+L  ICNPGI++RHW+ MS+I+G DIKP  E+SL + L +GL KHL +LEEIGAAAAKEH LEK L KMK +WK+M FE+  YR++GV IL+A D+IQ+LLDDHI+K+QTM+GSPFIKPFE+EMK WE+KLVSM DI+D WLK QATWLYLEPIFSSEDILAQMPEEGRKFGIVD  W+++M E++K+  CLVAT Q +ML R  D+N LLEEIQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI RL+F +  EI+GM+SAE E +   TKI PAKAK  GMVEKWLLQVE+VMI+S++KVI D+ E+Y  T R RWVL+WPGQ+VIC S IYWT EVTEA+    GL +YL+ CN QID IV+LVRG L SG R+TLGALTVIDVHARD V+ MAK +V+  N F WL+QLRYY    +V V  I+T++ YG EYLGN+ RLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQI SIQ A+A  LKRF+FEGTELSL+PTCT+FITMNPGYAGRQELPDNLKVLFR+VAMMVPDY +IGEISLYSMGF+DAR+LA+KIVA Y+LCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K PD E+E +LLLKAI DVNLPKFL+QD+PLFEGIISDLFPGV+ PK D+ +F  A+K+N  KRKLQ   WF+DKI+Q+YEMILVRHGLMIVGEP GGKT+ YQ LA AL D+   G  +E+K  Y IINPKAITMGQLYG FDPVSHEWTDGVLA  FRE+A   +  RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIY+EP Q+GWRPF ES+++YELP  L++++  +I DLFEWL+DPCL++IRHNCK  +  SE+H V  + +L+  L DEIR       AE  E  +   +S Q I LW+QGLFLFS +W++G ++    R KFD +FR +  G +  +PKPKS K++KSN  PER TI+DFCFEKK+ G+W +W++TID+ +++I   AK++++II T ETARQ +FL  ++THE+P++ VGPTGTGKS + NNYL+ LPKD Y+ N INFSARTSANQTQ IIM+KLDRRRKGVYGPP  K+ VVFVDDLNMPAKEKYGAQPPIELLRQW+DH HW+D KDT+KL L D LL+SAMGPPGGGRND++SR  RH N++ ++EF+D+T+ RIFT I DWHF  GFD  F R GKLLV++TM VYK A+ +FLPTP+KSHYVFNLRDF+RVI+GVLLVPH  +   +KL RLWVHEVYRVFYDRL  ++DR  FF IVK   ++ FK NI+KILGHLS SG VVD++VR L FGDYM  +  K YDE+T LK L   ME +LD+YN +SKAPM LVMF+FA+EHISRV RVL QDNGH LLVGIGGSGRQSA ++A FMAD+++F IEIT+NY  NEWR+DLKRLL+KAG + KP+VFLF+D QIK ESFMEDISM+LNTGDVPNL+ SDEKAE++EKMQ  AR E    G+KID+TP++MYNYFI+RVKQNLHI+LAMSPIGDAFRNRLRMFPSLINCCTIDWFQ+WP DALEMVANKFLE++E+++N R+A V MCK +HESV++LS  F   LRR+NYVTPTSYLELI TFK LL  KR+E++TL+NRYLTGLEKLEFA+ +V  MQ EL+ALQPELI TSA+T+KL+ K+EQDTVEVEAK+E++AA++  AN  AA +Q IKDDCE+DLAEA+P L  A+++L+TLK  DITLV+SMKNPP  +KLVME++C+MLG K ERKPD  TGKMIED+W  S KLLGD KFLDRLK +  D++ P  IK++R+KYI  P+FDP +++NASTACEGLC+W+ A+D YD  AK+VAPKK KLA AE EL + +++L EK+AQL EV  KLQ L D+ +   Q+KKELE NI++C KKLDRAE+LIGGLGGEK RWTEAA++L ER  NITGDVL+S+A VAYLG FT+ FR  VV+ WHK CI   IPCSE+F +   LG+PV IRAWNIAGLPVD+FS+DNGIIV++S RWPL IDPQGQANKW+KNME+SN+L IIKL+D N++RTLENSIQFGTPVLLENVGEEL+PIL+PILQK  FRQQGVDY+RLGDNVIEY+KDF+ YITT  RNPHYLPEIS KVCL+NFMITPQGLEDQLLGIVAAKEKPELEEKKN LI+ESA+N++KLKE+ED+ILEVLSSS+GNILE+ETAI +LSSSK+LS+EIS KQ IA  T+ +ID+TRNGY+PVA+H SILFFCISD+ANI+PMYQYSL WFINL+L SI+NS  S+DLE RI  LND FT S+YRN+CRSLFE  KLLFS  +CI ++KG+ +V++++WRFLLTGGVAL+NP PNPAP W+++K W E+VRAS LP++KGL EH ++N ++WK MYDS +P+
Sbjct:  316 FSDLRFVNLKELMEADLPLLPSEFESLIKKQCWDAHEVLRKNWIPTCAKVFLDKNELWQHLVPPGADDSTELVEEFFACVAALMSIQLRSMIINSLADFLSFFAIHKKGNEFGDVFDELQYVQTQIMIIKLRVEEPKIVFDPPFREIRDIILRCFSEIIASGEGLTRVECELFPDMRSATPKLLLRSVKIEESLVTDYVDRAMEIFKHNTVGPQKYLNTYKKYSDLLNNNADQDVSAFLRETHSIEAFKKKINSFQDLKDEISLLRITVPLSMFCLDCQNLNQDLGARSQRLKERLIIFEVDENRELNRGICRRYDEMAEKVSDVPDTTEEIVGLQEYLKTSSDVTVYKLKDEIEDAASRLMFLLDYAIFPSEDIKLNSTVFHWPDHIKTVFELSTSRIANRRDHIEEDLRKRTQAFEEKLNDYMKEVESFKKKEFLGEEAMRNNTEQLATINENLERARDELEQINKEEQLLEWEQSSFPNLQTMFTLKEPYERLWNTAYQFHQRHEQWLNGPFQNLNSEEIENEVGDMWRTMYKLTKQFSDQAGPRRVADTVKNKVDKFKQHLPILNTICNPGIRDRHWEMMSEIVGTDIKPQGETSLNNMLEFGLAKHLARLEEIGAAAAKEHSLEKALEKMKLEWKDMMFEMIPYRETGVCILTAPDEIQVLLDDHIVKAQTMRGSPFIKPFEQEMKEWEEKLVSMQDILDEWLKCQATWLYLEPIFSSEDILAQMPEEGRKFGIVDSYWRDIMTEAIKDTHCLVATDQPNMLSRFRDANVLLEEIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPMRVQPHLKKCFEGISRLDFNDAQEILGMVSAENEIVPYNTKIIPAKAKASGMVEKWLLQVEDVMISSLRKVIMDANEAYTSTPRNRWVLEWPGQVVICSSSIYWTSEVTEAMKKKGGLDEYLLTCNGQIDQIVELVRGKLESGHRVTLGALTVIDVHARDTVKEMAKAKVTDPNDFMWLAQLRYY-WENDVIVRMITTDIKYGYEYLGNSGRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIASIQQAVAAHLKRFMFEGTELSLDPTCTLFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYGMIGEISLYSMGFIDARSLANKIVAVYKLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKQPD-ESEPVLLLKAIMDVNLPKFLAQDVPLFEGIISDLFPGVECPKPDYGVFMEALKENTRKRKLQCVPWFLDKIIQVYEMILVRHGLMIVGEPLGGKTKGYQVLAEALGDLQTSGLYEEFKTVYRIINPKAITMGQLYGCFDPVSHEWTDGVLANTFREYASNPNTDRKWILFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYLEPHQMGWRPFKESYMQYELPEKLSQENRDMINDLFEWLVDPCLEYIRHNCKLFVNASEMHLVQSMMRLYTCLQDEIRTTLEHTPAEGDE-PNPNALSNQQITLWMQGLFLFSMIWTVGGTMDGDSRKKFDAYFRNIVNGTDANHPKPKSCKISKSNMIPERATIFDFCFEKKASGSWCDWMDTIDKSTLAIPASAKVSDLIIQTSETARQIFFLQTYITHEQPMLFVGPTGTGKSAITNNYLLTLPKDVYIPNCINFSARTSANQTQGIIMSKLDRRRKGVYGPPMGKKSVVFVDDLNMPAKEKYGAQPPIELLRQWLDHNHWYDPKDTTKLFLTDVLLVSAMGPPGGGRNDITSRFTRHLNMISIDEFDDSTLTRIFTNITDWHFGKGFDASFVRNGKLLVAATMAVYKDAVTNFLPTPSKSHYVFNLRDFARVIRGVLLVPHEKMSEIDKLHRLWVHEVYRVFYDRLIDKQDRETFFQIVKEQCSNHFKANIDKILGHLSKSGSVVDDNVRSLFFGDYMQAEGGKAYDEVTDLKELTSTMENYLDEYNLVSKAPMKLVMFKFAIEHISRVSRVLLQDNGHCLLVGIGGSGRQSAAKLATFMADYDLFQIEITKNYTANEWREDLKRLLMKAGSEGKPIVFLFADTQIKSESFMEDISMILNTGDVPNLFASDEKAELIEKMQAIARNE----GKKIDATPLSMYNYFIDRVKQNLHIILAMSPIGDAFRNRLRMFPSLINCCTIDWFQSWPSDALEMVANKFLEEVELEDNIRKASVSMCKHFHESVQELSIVFFERLRRHNYVTPTSYLELIMTFKALLGVKRDEILTLRNRYLTGLEKLEFAASQVSVMQEELQALQPELIKTSAETEKLMIKIEQDTVEVEAKKEVVAADEAVANEAAAAAQAIKDDCESDLAEAIPALESAISALNTLKPADITLVKSMKNPPPAVKLVMESICVMLGIKSERKPD-GTGKMIEDFWGPSQKLLGDLKFLDRLKGYDKDNIAPPIIKRIRDKYISNPEFDPILIKNASTACEGLCRWVKAMDIYDKVAKVVAPKKAKLAEAEGELSVQMQKLDEKRAQLKEVTDKLQALNDEFEAMTQKKKELETNIDICEKKLDRAEKLIGGLGGEKDRWTEAARLLGERVTNITGDVLLSSATVAYLGAFTIDFRQDVVKEWHKVCISKEIPCSETFSLNGTLGKPVTIRAWNIAGLPVDAFSVDNGIIVSSSRRWPLMIDPQGQANKWVKNMERSNKLGIIKLSDANYLRTLENSIQFGTPVLLENVGEELDPILDPILQKLTFRQQGVDYIRLGDNVIEYSKDFRLYITTSYRNPHYLPEISVKVCLVNFMITPQGLEDQLLGIVAAKEKPELEEKKNQLIVESAENQKKLKEIEDKILEVLSSSEGNILEDETAIKILSSSKVLSEEISAKQEIAVQTEKDIDETRNGYRPVAIHSSILFFCISDLANIEPMYQYSLTWFINLYLQSIQNSAPSDDLEERIFNLNDDFTNSIYRNVCRSLFEKDKLLFSFVLCIGIMKGQLRVDEDVWRFLLTGGVALENPNPNPAPEWLTEKSWGEIVRASNLPNLKGLWEHVRDNINEWKKMYDSLTPQ 3400          

HSP 2 Score: 1034.25 bits (2673), Expect = 0.000e+0
Identity = 491/659 (74.51%), Postives = 559/659 (84.83%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNAS--KIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQ 11347
            LP  + +L GLDK++VLR  RPDK+VPAVQ FI DNLGQ++I+PP FDL  SF DSNCC+PLIFVLSPGADPM ALLKFGEDQG + +   I SISLGQGQGPIAAKMI++AI DGTWVVLQNCHLATSWM  LEKICEE+I+PE TH+ FRLWLTSYPS+ FPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISD  FF GCN   ++H MLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRIS+RQM MFLNDY ELPL ALTYLTGECNYGGRVTDDKDRRLL+S+L IFY   I+    Y FSPSG+YY+P +G  Q YI+YIR+LPINP PEV+GLHENADITKDNQET  LF  ILLTLPRQAS  GKS  D IQ+LA DIL KLP++++LE +MK+YPV+Y+ESMNTVLRQELIRFN+L SVVR++LINLQKAIKGLVVM+ +LEEVF SMLIGKVP+ WAAKSYPSLKPLGSY+NDL+ RL FF DWI+N  P TFW+SGFYFTQSFLTGV QN+ARKYTIPID VGFEFE+   +   + K  PEDGA VYGL++EGARWD++  ++GESLPKILF+ +P IWL+PN++       TY CPVYKTSARRG LSTTGHSTNFVL I++P + S+NHWINRGVAS+ Q
Sbjct: 3404 LPSPYDVLVGLDKMVVLRVFRPDKVVPAVQDFIVDNLGQSYIEPPTFDLPGSFADSNCCAPLIFVLSPGADPMAALLKFGEDQGLSRADNTIQSISLGQGQGPIAAKMIEKAIVDGTWVVLQNCHLATSWMPKLEKICEEVIVPEATHERFRLWLTSYPSDQFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDPSFFGGCNKPQKFHKMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISLRQMLMFLNDYDELPLPALTYLTGECNYGGRVTDDKDRRLLLSILSIFYTEKIITNPDYKFSPSGLYYAPEEGPHQSYIDYIRTLPINPLPEVFGLHENADITKDNQETQLLFDNILLTLPRQASKGGKSTADVIQDLAADILGKLPKDYNLEFVMKKYPVLYNESMNTVLRQELIRFNRLTSVVRASLINLQKAIKGLVVMSADLEEVFQSMLIGKVPSVWAAKSYPSLKPLGSYINDLLARLKFFADWIDNGAPPTFWLSGFYFTQSFLTGVSQNYARKYTIPIDTVGFEFEVLKEEKLMENK--PEDGAYVYGLYIEGARWDRDTMLMGESLPKILFDQMPCIWLQPNRVEDFAVKKTYRCPVYKTSARRGVLSTTGHSTNFVLFIEIPTDKSENHWINRGVASVSQ 4060          

HSP 3 Score: 201.445 bits (511), Expect = 3.470e-47
Identity = 93/143 (65.03%), Postives = 113/143 (79.02%), Query Frame = 2
Query: 10928 LTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            +  V QN+ARKYTIPID VGFEFE+   +   + K  PEDGA VYGL++EGARWD++  ++GESLPKILF+ +P IWL+PN++       TY CPVYKTSARRG LSTTGHSTNFVL I++P + S+NHWINRGVASLCQLDD
Sbjct: 4055 VASVSQNYARKYTIPIDTVGFEFEVLKEEKLMENK--PEDGAYVYGLYIEGARWDRDTMLMGESLPKILFDQMPCIWLQPNRVEDFAVKKTYRCPVYKTSARRGVLSTTGHSTNFVLFIEIPTDKSENHWINRGVASLCQLDD 4195          
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A2C9KDA1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078588 PE=4 SV=1)

HSP 1 Score: 4229.48 bits (10968), Expect = 0.000e+0
Identity = 2055/3095 (66.40%), Postives = 2526/3095 (81.62%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEI----RNQP--SVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT-DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F + RF+N   L+   LP+ P +FE+++K +C E H  L+ +W+P CA+LF+D + +W  L+P     N+E V+ FF+ +ASLMS QLR+MV  SL+DF  F K H++GN+FG  +DEL +   P+MIV LK+ EPKII++P+F+EL+D+++RC+  I+ S E + RVE  LFP+MRGQRL LR+V  +E LVT ++D+ M+ F+ N +GP+ YLNVYK Y +LLNNKAE +V AFL+E+H + A K+KID+YQ LKDE++ +R++ PL +F LD   LN+D+  R  +L+E L++F V+ENRE+N+S+ + Y+DI  +V  IP  T+ LV +QEFL+ +S   V++L +   EA  RLMFLLDYA  PYEDIK+NT  FHWP  I+ + D + NRI N+R+Q EE+L+ R+  FE ++E   K +E FKKKE M+ EEM+ NV+ L +LQ  ++  + +LE L  E+ +L WE + FP LA M +  +PY +LW+TA +F++KN+ W  GPF  LN+  I+N++ EM + M+KL K F D PG + +A+ VK KIDKFK ++P+LQ ICNPGI++RHWDQMS+I+GFDI+P E++SL   L YGLHKHLEKLEEIG +AAKE+ LEK L KMK+DWK++KFEL  YRD+GV+ILS+LDDIQ LLDD+I+K+QTM+GSP+IKPFE EMKLWE+KLV M DIID WLKVQATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK++M E+  N +CLVATGQ +ML RL ++N LLE+IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI +L+FTE  EI+GM+SAE ET+  +T I PAKAKGMVEKWLLQVE+VMINS++KVI DSI +Y  T R RWV +W GQ+V+CVS +YWT EVTEA+   NGLK YL +CN QID IV+LVRG L SG RITLGAL VIDVHARDV+ ++AK Q+ S   F WLSQ+RYY    +++V  I+TE+ YG EYLGN+PRLVITPLTDRCYRTLM ALKLNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSV+AQQIQSIQ AIA  LKRF+FEGTELSLNPTCT+FITMNPGYAGRQELPDNLKVLFR+VAMMVPDY +IGEI LYSMGFVDAR+LA+KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P+ ++E++LLLKAI+DVNLPKFL+QD+PLFEGIISDLFPGV LP+ D+ +F   +K+ + K++LQ NE+FI+K++Q+YEMILVRHG+MIVGEP GGKTQ+YQ LA  L ++       EY+  Y IINPKAITMGQLYG FDPVSHEW+DGVLA  FRE+A +QD  RKW++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQM+NKMNLIFEPADLEQASPATVSRCGM+Y+EP Q+GWRP ++S++ + LP  L ++  +L+ DLFEWL++PCLDF++ +CK  +  SE+H V  L +L+ +++DEI    +  P     EA T E S  + +++Q + LWLQG+FLF  VW+IG  ++   +  FD FFR L  G++  +PKPKSIK+TKSN+FPER T+YDF F+KKSGG W +W++TID+ S+ I+  +K++ + IPT ETARQ +FL+L+L HE P +++GPTGTGKS + N+YL+ LPK+ Y+ N INFSARTSANQTQDIIM+KLDRRRKGV+GPP  K+ VVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHW+DKKDT+KLHL+D L +SAMGPPGGGRND++SR  RH N++ V+EF DN M +IFT I DWHF +GFDG F R GKLLVS+TM VYK AI++FLPTP KSHYVFNLRDFSRVI+GVLLVP   + +GEKLMRLWVHEVYRVFYDRL  +EDR  FF IV+    D FK NI+KILGHLS SGKV D D+R L FGD++  ++K+Y EIT LK L   ME +L++YN+ISKAPM LVMF+FA+EH+SRV RVL QDNGHALLVGIGGSGRQSA ++A FMA++++F IEITRNY  ++WR+DLK+LL KAG + KP VFLFSDNQIK ESFMEDISM+LNTGDVPN++PSDEKAE++EKMQ+ AR+E    GR++D TP+ MYN+FI+RVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMD+  +   V MCK +HESVR  SE++ + LRR+NYVTPTSYLELI TFK LL+ KR+EL+ +KNRYL GLEKLEFA+ +V  MQ EL  LQPELI TSA+T+KL+ K+EQDTVEVEAK+E++AA++  AN  AA +Q IKDDCE DLAEA+P L  A+ +L+TLK +DI+ V+SMKNPP  +KLVME+VC+MLG K ERKPD S +GKMIEDYW  S+KLLGD KFLD+L+ +  D+++P  IK++REKYI  PDFDP +++NASTACEGLCKW+ A+D YD  AK+VAPKK KLA AE EL + +++L EK+AQL  V  KLQ L D+ +   Q+KK+LE NI+LC+KKLDRAE+LIGGLGGEK RWTEAAK L + Y NITGDVL+S+ VVAY G FTV FR  + + WH++C++  IPCS+ F +   LGEPVKIRAWNIAGLPVD FS+DNGIIV+ S RWPL IDPQGQANKWIKNMEK+N+L+IIKL+D N++RTLENSIQFGTP+LLENVGEEL+P+LEP+LQK  FRQQGVDY+RLGDN+IEY+ DFK YITT LRNPH+LPE+S KVCLLNFMITPQGLEDQLLGIVAAKEKPELEEKKN LI+ESA N+++LKE+ED+ILEVLSSSQGNILE+ETAI VLSSSK+L++EIS KQ IA  T+ EID+TRNGYKPVA+H SILFFCISD+ANI+PMYQYSL WFINL+L SI NS+KSEDLE RI  LN HFTLS+Y N+CRSLFE  KLLFS  +CI ++KG+ KV++ +WRFLLTGGVALDNP PNPAP W+SDK WSE+VRAS LPS+KGL++H   + ++WK  YD  +P 
Sbjct:  255 FCHLRFVNTEILLQAELPLLPSEFESLVKTQCWEAHEFLRKNWIPSCAKLFVDYKEMWQGLVPPGEYDNTELVQEFFSCVASLMSLQLRSMVINSLSDFLNFFKHHESGNDFGEYYDELAYVHRPIMIVRLKIEEPKIIFEPTFRELRDIILRCFSEIIASGEGLNRVECELFPDMRGQRLLLRSVRIDESLVTDFVDKAMEIFRMNIIGPQKYLNVYKSYSDLLNNKAEQDVAAFLREKHSISAFKQKIDSYQSLKDEIASMRITAPLCMFCLDCVSLNMDLCLRALRLKEKLITFVVDENRELNKSLNKCYEDIQERVQVIPESTKDLVDLQEFLKTSSDITVYKLLDRVAEASHRLMFLLDYADFPYEDIKINTITFHWPSQINAILDHSQNRIMNKRDQIEEELKKRVAGFEAKIETYVKEVESFKKKEFMSSEEMKNNVEILSQLQENLEAARVELEGLQDEQRLLEWEVTDFPQLAAMFQTKEPYDKLWKTAYNFYLKNELWTHGPFKNLNSEEIDNEVSEMWRTMYKLTKAFADQPGPRHIANSVKTKIDKFKTNMPILQTICNPGIRDRHWDQMSEIVGFDIRPQEDTSLSTMLEYGLHKHLEKLEEIGGSAAKEYSLEKALTKMKDDWKDLKFELVPYRDTGVNILSSLDDIQALLDDNIVKAQTMRGSPYIKPFEVEMKLWEEKLVLMQDIIDEWLKVQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMKETKMNTNCLVATGQNNMLGRLKEANVLLEDIQKGLNAYLEKKRLYFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIAKLDFTENEEIVGMVSAENETVPFMTTIIPAKAKGMVEKWLLQVEDVMINSLRKVITDSIHAYKTTHRKRWVAEWAGQVVLCVSSMYWTTEVTEAMKNENGLKLYLERCNRQIDQIVELVRGKLDSGTRITLGALIVIDVHARDVLAHLAKNQIRSPADFNWLSQMRYYFDSRDIFVHMITTEIAYGYEYLGNSPRLVITPLTDRCYRTLMGALKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVIAQQIQSIQQAIAAHLKRFIFEGTELSLNPTCTIFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYGMIGEIQLYSMGFVDARSLANKIVAVYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKFPN-QDEAVLLLKAISDVNLPKFLAQDVPLFEGIISDLFPGVQLPQPDYGVFLETMKEVILKKELQPNEFFIEKVMQVYEMILVRHGMMIVGEPLGGKTQSYQVLADTLGELMDSKLFDEYRTIYRIINPKAITMGQLYGCFDPVSHEWSDGVLANTFREYASSQDSFRKWILFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMNNKMNLIFEPADLEQASPATVSRCGMVYLEPHQMGWRPSVQSYMMFHLPKKLRQEQKELVHDLFEWLVEPCLDFVKRHCKTFLPISEMHQVQMLMRLYTAMMDEIIETCKAWPDEGSAEAATYEQSP-EHLTSQQVTLWLQGIFLFCVVWTIGGLVVGDSKKAFDEFFRTLISGVDDNHPKPKSIKITKSNTFPERNTVYDFAFQKKSGGGWIDWMDTIDKSSLLIAAGSKVSTLTIPTAETARQQFFLNLYLMHEIPCLLIGPTGTGKSAITNSYLLALPKESYIPNCINFSARTSANQTQDIIMSKLDRRRKGVFGPPMGKKSVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWYDKKDTTKLHLVDVLFISAMGPPGGGRNDITSRFTRHMNIVSVDEFEDNIMYKIFTAITDWHFGNGFDGSFVRNGKLLVSATMGVYKDAISNFLPTPTKSHYVFNLRDFSRVIRGVLLVPPAEMTDGEKLMRLWVHEVYRVFYDRLIDDEDRNMFFKIVRNNCQDSFKQNIDKILGHLSKSGKVTDVDIRSLFFGDFLNPENKVYSEITDLKQLTTIMEHYLEEYNTISKAPMKLVMFKFAIEHMSRVSRVLLQDNGHALLVGIGGSGRQSAAKLATFMANYDLFQIEITRNYSNSDWREDLKKLLKKAGVEGKPTVFLFSDNQIKDESFMEDISMILNTGDVPNIFPSDEKAEVIEKMQSVARLE----GRQMDGTPLVMYNFFIDRVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDDTMKLETVNMCKHFHESVRIASEKYYDVLRRHNYVTPTSYLELILTFKSLLSVKRDELMMMKNRYLIGLEKLEFAASQVSVMQQELTDLQPELIKTSAETEKLMIKIEQDTVEVEAKKEVVAADEAVANEAAAAAQAIKDDCEGDLAEAIPALEAAITALNTLKPSDISNVKSMKNPPSAVKLVMESVCVMLGIKSERKPDPSGSGKMIEDYWGPSMKLLGDLKFLDKLRTYDKDNISPPIIKRIREKYIANPDFDPTLIKNASTACEGLCKWVRAMDIYDKVAKVVAPKKAKLAEAEGELAVQMEKLNEKRAQLQAVTDKLQALNDEFEVMTQKKKDLEGNIDLCSKKLDRAEKLIGGLGGEKDRWTEAAKALGDLYINITGDVLISSGVVAYHGAFTVDFRQMMTKEWHEQCVKRNIPCSKVFSLTTTLGEPVKIRAWNIAGLPVDGFSVDNGIIVSKSRRWPLMIDPQGQANKWIKNMEKANKLNIIKLSDGNYMRTLENSIQFGTPILLENVGEELDPVLEPVLQKLTFRQQGVDYMRLGDNIIEYSPDFKMYITTGLRNPHFLPEVSVKVCLLNFMITPQGLEDQLLGIVAAKEKPELEEKKNQLILESAANRKQLKEIEDKILEVLSSSQGNILEDETAIKVLSSSKVLAEEISTKQEIAVATEKEIDETRNGYKPVALHSSILFFCISDLANIEPMYQYSLTWFINLYLQSINNSKKSEDLEERIINLNKHFTLSIYNNVCRSLFEKDKLLFSFVLCIGIMKGQGKVDENVWRFLLTGGVALDNPLPNPAPAWLSDKAWSEIVRASGLPSLKGLKDHVNKHPEQWKKFYDHPTPH 3343          

HSP 2 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 486/666 (72.97%), Postives = 557/666 (83.63%), Query Frame = 2
Query: 9359 NHRNCFLPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            NH+   LP  +  L GLD ++VLRC RPDKIVPAVQ+FI DN+GQ++++PP FDL  SF DSNCC+PLIF+LSPGADPM ALLKFGED+GY  + I +ISLGQGQGPIAAKMID+AI DG+WVVLQNCHLATSWM  LEKICEE+I+PE T+++FRLWLTSYPS+ FPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISD  F++GCN    WH M+FGLCFFH LVQERRKFGPLGWNIPYEFNESDLRIS+RQMQMFLNDY +LPL ALTYLTGECNYGGRVTDDKDRRLL SLL +FY   IV  +KY  S SGIY++PP+G  Q YI+YIRSLP+   PEV+GLHENADITKDN+ETN LF  IL+TLPRQA G G+S  DS+Q LA DIL KLP+NFDLE +M +YPV+Y ESMNTVLRQELIRFN LISVVR TLIN+QKAIKGLVVM++ELEEVFNSML+GKVP  WA+KSYPSLKPLGSYV DL+ RL FF DWI+  VPS+FW+SGFYFTQSFLTGV QNFARK TIPID VGFEF I      T    +P DGA VYGLF+EGA+WD++  ++GES  KILF+++P IWL+PN+     +   Y CPVYKTSARRGTLSTTGHSTNFV+ I LP++  ++HWINRGVA LCQLDD
Sbjct: 3344 NHK---LPTPWDSLSGLDNMVVLRCFRPDKIVPAVQNFIVDNMGQSYVEPPTFDLPGSFADSNCCAPLIFILSPGADPMMALLKFGEDRGYKPNMIQTISLGQGQGPIAAKMIDRAISDGSWVVLQNCHLATSWMPKLEKICEEVIVPETTNEDFRLWLTSYPSDSFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDVNFWEGCNKPKIWHKMMFGLCFFHGLVQERRKFGPLGWNIPYEFNESDLRISMRQMQMFLNDYEDLPLPALTYLTGECNYGGRVTDDKDRRLLNSLLSVFYCEKIVYDDKYKLSSSGIYFAPPEGPYQSYIDYIRSLPLIVLPEVFGLHENADITKDNKETNLLFDSILMTLPRQAGGGGQSSGDSMQSLASDILSKLPQNFDLEFVMNKYPVIYEESMNTVLRQELIRFNNLISVVRKTLINMQKAIKGLVVMSSELEEVFNSMLVGKVPASWASKSYPSLKPLGSYVADLLARLKFFQDWIDKGVPSSFWLSGFYFTQSFLTGVSQNFARKTTIPIDLVGFEFSIL----KTTPTEKPADGAYVYGLFMEGAKWDRDKMVIGESAQKILFDTMPFIWLQPNRTDLFKKLPCYSCPVYKTSARRGTLSTTGHSTNFVMYIQLPSDKPESHWINRGVACLCQLDD 4002          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3007.24 bits (7795), Expect = 0.000e+0
Identity = 1572/3151 (49.89%), Postives = 2146/3151 (68.11%), Query Frame = 1
Query:   58 HIIVHQKKIRV*SCR*GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKD----NTVGPKNYLNVYKK-YGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDN-----------------PG----------AQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAI-TVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICL-NEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYF--LDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHG-FDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDD-----KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLRE----HFQNNTDKWKSMYDSQSP 9366
            HI+    KI +  C   F +   ++++   S G P+  G  +N +  +C  + + L  +W P+   L   K T+            +E + AF+   ++L+S QL+ +V  S+  F                FD L     PL  + L   E K+ + PSF+++++ ++  +  I  + + +  V+  L              + + KLV         T K+    N   P  +   Y   Y  L+N  A+  V  F++E H      + I+ +Q L  E+S L       +  LD   L   + K+ +   ++L+   +   R+    IC  ++ I  K  + P  TE ++ +  ++  A T  +  L  +  E  +R  +LL   T   ED++LN+ +  WP +I+ +FD+    ++  +++ E++L+ +  K   +LE++ + +E+F   E   ++ M++ V  +  +Q  + + +D +  +NKEE++  W+Q+ +P +  M +N++PY +++   L +      W+ G F +LN  ++E ++ E  + ++K++K F                    PG             +  KV  +I +FK H+P++ ++CNPGI+ RHW+QMS+I+  D+ P   ++L   L   L  ++E  E I AAA+KE  LEK L  M E W  + F    +R+SGVSIL+A+D+IQ +LDD I+K+QTM+GSPFIKPFEKE+K WE++L+ + D ID WLKVQA WLYLEPIFSS+DI+ QMPEEG+ F  VD  W+EVM   VK+P  L AT    +L++L +SN+LLE+I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE + ++  I  ++A+G VEKWL+QVE+VM++S++ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT+EV EAI +   GLK+Y  +  SQ+ DIV+LVRG L    R TLGAL  IDVHARDVV  M +  VS    F+WL+QLRYY     V VC I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F    ++   K  +Q  + F+DK++Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G   E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FRE+A A+   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMSN+M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S++   LP  L  +++  L+ +LF WLI P L  +R NC++++ T+  + VV L +LF  LL E    P  EE              +NI  W+   F FS VWSIG S     R +FD F RE+  G    +P P ++   +   F ++  +YD+ +E K  G W  W  +I   ++    + K+ +II+PT +T   T F  L +F +  +P++ VGPTGTGKSV +   L+  L K+RYL   INFSARTSANQ+Q+IIM +LD+RRKGV+GPP  K+C++FVDD+NMPA E +GAQPPIELLRQ+ DHG+W+D KDTSK+ L+D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D+TM RIF+ +V ++  +  F      +G  +V++T+ VYKKA+ + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHEV+RVFYDRL  ++DR   + ++K    + FK + + +  HL    K+ +ED+R L+FGDYMT D     ++Y E+ S+++ ++ +E++L +YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FMAD  +F  EI++NYG NEWR+DLK LL KAG   +  VFL +D QIK+E+F+ED+  +LNTG+VPNL+  DEK EI+E M +A R   +   + ++ +P+A++ +F+ R ++NLH+V+A SPIGDAFRNRLR FPSLINCCTI+WFQ WPE+ALE VANKFLE +EM ++ R+ ++++CK +H S   LSE+FL+ L R+NYVTPTSYLELI  F+ LL  KR+ ++  K RY  GL+KL FA  +VG+M+ EL  LQP+L        K++  +E ++V+VEAK +++  E+E A+ KAAE+Q +K++CE+DLAEA+P L  A+++LDTLK +D+T+V+SMKNPP  +KLVM AVC+M   KPE+  D + TG+ I DYW  S KLLGD  FL  LK +  D++    + K+R +Y+  PDFDP  V  AS+A EGLCKWI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + + +L+  ++LC +KL+RAE+LIGGLGGEK+RW++AA  L   Y N+TGDVL+SA V+AYLG FT  FR +  + W K C    IP S+ F +   LG+P+KIRAWNI+GLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ N L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K IF+Q G+D +RLG++VIE++ DF+FYITT+LRNPHYLPE++TKV LLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+ED+ILE L SS+GNILE+E+AI +L S+K++S EIS+KQ IAE T+++I ++R GY+P+A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI++S KS+ LE R+ YL +HFT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP ++GLR     HF         +YDS+ P
Sbjct:  152 HILHPVMKIILDICYVTFSDLLLVDLSACRSSG-PVSCGSLKNKVALECERIETKLMNTWFPKVIHLLTSKDTV--------QGITTEKLDAFYNCASTLLSNQLKAVVERSVVAFVNL-------------FDPLSTHKLPLFRMNLTFEEEKMDFYPSFQDMEEAVLEIFTSISNTMQKVQTVQSWLSET--------NNSVIDAKLVDHVRAWAETTLKNAVWKNLEAPNQHFQNYSNNYDWLVNRTAQDLVEKFIQEEHSFDQYTQVIEKFQALSREISSLPSVAHFDMIRLDCEELKQGLAKKAETFAQILLEQLINTQRQQCLEICEEFETIQKKAMKKPETTEDMIEMIAYISHARTKGLEELHSKIMETHQRFTYLLHVHTFSAEDLELNSKMVLWPQNINPIFDLNNELLEQAKQKGEQELQGKREKLMLKLEKLGRRMEEFA--ECSELDMMQQYVTEIKTVQKWLQEVEDSISFINKEEALYKWDQTVYPEIDVMKENIEPYQKVFGLVLKWQRTEKRWMDGSFLDLNGESMEAELDEFFREIYKMLKSFQQKQKKAEQGRERQVAMKRRPGEGDDDHLESPTALMCIKVIEQIKEFKEHIPMVSILCNPGIRARHWEQMSEIVNHDLTPNSGTTLRKVLKQNLSAYMEHFETISAAASKEFSLEKALQNMVETWDIISFSHHAHRESGVSILTAVDEIQTMLDDQIVKTQTMRGSPFIKPFEKEIKAWEERLIRIQDTIDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGQLFQTVDKHWREVMRHCVKDPKVLPATSLTGLLEKLQESNNLLEQIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIAKLDFLPNLDIQAMYSSEGERVELIQLISTSEARGAVEKWLVQVEDVMLSSIRDVINRSRLAYPETKRSQWVREWPGQVVLCTSQMYWTQEVHEAIRSGVGGLKNYYNQLQSQLKDIVELVRGKLPKQTRTTLGALVTIDVHARDVVMEMIEKGVSHETDFQWLAQLRYYWNNDNVRVCIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIEMKLEFFDFEGTELRLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLVAAGNLKLKFPD-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGISLPAADYQLFLDCAQECCKKHNVQPVKVFLDKMIQTYEMMIVRHGFMLVGEPFAGKTKVLHVLADTLTLMNERGYNDEEKVQYRTVNPKSITMGQLFGQFDPVSHEWTDGIVANTFREYASAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWLPLVTSWLN-TLPQPLQTQENSTLLLELFNWLIPPALRMLRKNCREVVSTTNSNTVVSLTRLFEMLLTE----PVTEEP-----------GNKNIRTWIMAAFAFSLVWSIGGSCDRDSRERFDQFLREILSGKLEEHPIPAAVSKWEC-PFNDKGLVYDYSYEFKGKGCWIHWNESIKNVTLG-DKNTKVQDIIVPTIDTIFCTLFTTLIIFFSPFRPLLFVGPTGTGKSVYVKEKLMNNLNKERYLPFFINFSARTSANQSQNIIMARLDKRRKGVFGPPMGKKCIIFVDDMNMPAMEVFGAQPPIELLRQYFDHGNWYDLKDTSKITLVDVQLISAMGPPGGGRNAVTPRFLRHFNICSMNAFSDDTMSRIFSNVVAFYLRNNDFPNDCFSIGNQIVAATLEVYKKAMENLLPTPAKSHYTFNLRDFSRVVQGCLLLKKESLENKRTMIRLFVHEVFRVFYDRLVDDQDRDWLYKLMKNIVKEHFKESFDTVFEHL----KLCEEDMRSLLFGDYMTPDVEASERLYAEVPSMESFSQVVESYLTEYNQTHKNRMNLVIFRYVLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATFMADMTLFQPEISKNYGMNEWREDLKLLLKKAGVKGQKTVFLLTDAQIKEEAFLEDVDSVLNTGEVPNLFAVDEKQEIMEVM-HAVRPIAQAGNKSLEFSPLALFAFFVNRCRENLHVVVAFSPIGDAFRNRLRQFPSLINCCTINWFQPWPEEALERVANKFLETLEMSDHERQEVMLICKTFHTSAIHLSEKFLSELGRHNYVTPTSYLELIAAFRLLLTNKRDTVMNAKKRYTNGLDKLAFAESQVGEMKKELVDLQPKLEQAKIDNIKMVQVIEVESVQVEAKSKVVRVEEEAASQKAAEAQALKNECESDLAEAIPALEAALSALDTLKPSDVTIVKSMKNPPSGVKLVMAAVCVMKDIKPEKINDPAGTGQKILDYWGPSKKLLGDMNFLRDLKVYDKDNIPAPVMHKIRSEYMTNPDFDPTKVAKASSAAEGLCKWITAMEVYDRVAKVVAPKKANLIVAQQSLAATMALLNQKRAELKEVEDRLAALKKTLEEKTEEQAQLQFQVDLCARKLERAEKLIGGLGGEKTRWSKAADDLQNTYDNLTGDVLISAGVIAYLGAFTAGFRQNCTKEWTKLCKSKNIPSSDDFSLSKTLGDPIKIRAWNISGLPTDSFSIDNGVIVSNSRRWPLMIDPQGQANKWVKNSERENNLNVIKLTDADYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQIFKQGGMDCIRLGESVIEFSSDFRFYITTKLRNPHYLPELATKVSLLNFMITPEGLEDQLLGIVVAKERPELEEERNALILQSAANKKQLKEIEDKILETLQSSEGNILEDESAIQILDSAKIMSNEISKKQQIAEKTELKIAESREGYRPIAKHSSILFFSIADLANIDPMYQYSLNWFVNLYINSIQDSNKSKILEKRLRYLINHFTYNLYCNVCRSLFEKDKLLFSFLLCSNLLLAKKEIEYAEFMFLLTGGVGLQNNVPNPDPNWLQDKSWDEICRASDLPGLQGLRYPPFCHFL-------PIYDSKEP 3239          

HSP 2 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 387/655 (59.08%), Postives = 491/655 (74.96%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGC-NDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLT-LPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L    K+I+ RC+RPDKI PA+ ++IT  LG+ F++PPPFDL  S+NDSN   PL+FVLSPGADPM +LLKF  D+    +   SISLGQGQGPIA KMI  A+++GTWV LQNCHLA SWM +LEKICE+   PE  H +FRLWLTSYPS  FPV+ILQNGVKMTNEPP GLR NLL+SYL+DP+SD +FF  C N    W  +L+G+CFFHALVQER+KFGPLGWNIPY FNESDLRIS+RQ+Q+F+N Y E+P EA+TYLTGECNYGGRVTDD DRRLL+++L  FYN DI+E  +Y FSPSG YYSPP    + Y+E+IR+LP   +PEV+G+HEN DI+KD Q+T  LF  ++LT       G     + ++ ++A+DI  KLPENF+++  + ++PV+Y ESMNTVL QE+ R+N L + +R +L NL KAIKGLVVM+ ELE +  S+L+GKVP  WA +SYPSLKPLGSY+ D + RL F  DW +   P+ FW+SGF+FTQ+FLTG +QN+ARKY+IPID + F++E+  FD S      PEDG  V+GLFL+GARWDK++ +L E  PK+LF+S+PIIW+KP          T+L  +  TS R+GTLSTTGHSTNFV++I LP +    HWI RGVA LCQLD+
Sbjct: 3252 LSDFQKMIIYRCLRPDKIEPAISNYITGKLGKKFVEPPPFDLSKSYNDSNSTIPLVFVLSPGADPMASLLKFANDKNMGGANFKSISLGQGQGPIAVKMIQSAMKEGTWVCLQNCHLAVSWMSTLEKICEDFS-PETCHPDFRLWLTSYPSPMFPVTILQNGVKMTNEPPTGLRLNLLQSYLSDPVSDPQFFSACSNKELVWEKLLYGVCFFHALVQERKKFGPLGWNIPYGFNESDLRISIRQLQLFVNSYEEVPFEAITYLTGECNYGGRVTDDWDRRLLLTILADFYNKDIIENPRYMFSPSGKYYSPPKSIYEDYVEFIRNLPATQHPEVFGMHENVDISKDLQQTKLLFDSLILTQGGGSKGGASSGGDSTLMDIANDIRTKLPENFNIDSALNKFPVLYEESMNTVLVQEMERYNNLCNTIRVSLQNLLKAIKGLVVMDAELEAIAGSLLVGKVPEKWAKRSYPSLKPLGSYITDFLTRLKFLQDWYDTTKPNVFWLSGFFFTQAFLTGAMQNYARKYSIPIDLLSFDYEVLPFDTSA---TSPEDGVYVHGLFLDGARWDKKSGVLAEQHPKVLFDSVPIIWIKPK------HCCTFLL-LSCTSERKGTLSTTGHSTNFVISIMLPTSKRPQHWIKRGVAMLCQLDN 3895          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1941.39 bits (5028), Expect = 0.000e+0
Identity = 1076/2700 (39.85%), Postives = 1622/2700 (60.07%), Query Frame = 1
Query: 1381 SIEDFKKKEVMTMEEMRRNVQFLDELQG-----QIDDCKDQLEQLNKEE-------SMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDII--GFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVS-ILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTE----QLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESY--VITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITV------PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLR-YYDRG-GEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDR--ESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYN-SISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMD--ENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEG-WHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALD--NPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            S E+FKKK   TM++      F   +       QI   + QLE L +EE       S+   EQ     +  + K++D   ++W  +  +    D W  G F  L    +E+    M K ++KL ++  D     ++    K +I++FK  +P++  + +P +++RHW+Q+   +   FD   + E +L   +  GL +H E++ EI  AA KE  +E++L  + + W+E   ++  Y+D G   +  AL+D Q+ L        TMK S F++ FEKE+  WE  L  + ++I++ L VQ  W+YLE IF  EDI  Q+P E  +F  ++ +WK +M    K+ + L  T    +L++L++ NS LEEIQK L+ YLE KR  FPRF+FLSND+LLEIL ++++P  VQPHLKKCF+ I  L   +    + E  GM SA+GE    V   +P   +G VE WL  VE  M  ++K  + +   +   +  KR +WV DWPGQ++I  S I WT +VT+ +         + LK    K  S +      +RGNL+   R+ + AL  ++VHARDV++ +AK     VNAF+WL QLR Y+++   +  + Q +T   YG EYLGN+ RLVITPLTDRCY TL +AL L+ GG+P+GPAGTGKTET KDL K +    +V NCSDGLDYK+MG+ + GLAQ GAW CFDEFNRI +EVLSVVAQQI SI  A++ GL  F+FEG ++ L  +C +FITMNPGYAGR ELPDNLK +FR ++M+VPD  LI EI+L+  GF + + LA K+   Y L  +QLS Q HYD+G+RA+ S+L  AG  R+  PD  +E ILL+ ++ D+N+ K  S D+PLF GII DLFP V+ P  D+      +++ L +  LQ   + + K++Q+YE    RH  MIVG+    K+  +Q L  AL+ +   G      V    +NPKA+++G+LYG++D  ++EWTDGVL+ + R     +    KW++FDGPVD +WIE+MN+V+DDNK L L++GE I M  +++L+FE  DL  ASPATVSRCGM+Y + + LGW+P+++S+I+      +  DH+   + LF+  I   + F R +CK+L+  +E++ V+ L +L+ SL        S E      D++      + + LW    F+FS +WSI +S+ E GR K D F RE+ G                  +FP + TIY++  + K+    + W +  D+  +      +A   +I++PT +T R  + ++  +  + PV++ GP GTGK+ +  + L  L   ++    IN S++T++N  Q II +++++R KG Y P   K+ + F+DDLNMPA + +G+QPP+ELLR WID+G W+D++       +D  LL++MGPPGGGR  +S R+   FN++ +    ++ +  IF T+++   +  F      +G +L  +T+ +Y    A FLPTPAK HY+FNLRD S+V +G+L          + + RLW+HE +RVF DRL  + D   F  ++            EK+     L+   +  + +  IFGD++ +  +Y+++   K L   ME+ L+DYN +    PMSLV+F+ A+EH++RV RV+ Q  G+ LLVGIGGSGRQS +R+AA++ ++ +F +E+T+ Y + E+R+D+K+L    G D KP VFLF+D QI  ESF+EDI+ +L++G+VPNLY SDE  E+   + ++AR E       +  T  AM+NY IERV+ NLHIVL MSP+G+ FRNR+R +P+L+NC T+DWF  WP+DAL  VA ++L+ + +   E  +  +  +    H+SV Q S+     L+R+NYVTPT+YLEL+  +KKLL  KR EL    ++   GL K++    +V  M +EL+  + ++     Q ++ L  + Q   E + ++  ++A  E    +  + + + ++ + DL EA+P L +AM +L++L + D+T ++S   PP L++ VM+AV I+ G +P               W  + + LG+  F+ +L +F  D+++ + +KK+ + Y  +PDF P+I+   S A + LC W+ A++ Y    ++V PK+ +L  A  +L      LAE + +  EVE KL+ L +Q DE   +K++L    E    KLDRA +L+ GL GE+ RW +  + L +    + GD L++AA ++Y+G F   +R  ++   W K+  ++ +PCS  F     L +P  +R WNI GLP D+FS +NG+IV   NRWPL +DPQGQA KWIKNME    L +I L   +F+R LEN++QFG+PVLL+NV EEL+P L PIL K+     G   L+LGD  +EYN DF+FYITT+L NPHY PEISTK  ++NF +  QGLE QLLGIV  +E+PELEE+K+ L+I  A  KRKL+ELED+IL +L+ + G++L++   +N L +SK+ + E+S++   +E T+++ID  R  Y+P A   SILFF ++DM  IDPMYQ+SL+ +I+LF +SIE S++S  LE RI  LND+ T +VYR  CR LFE HKLLFS  MC  +L+   K+N + + F L GG+ LD      NP  +W++D  W  +    +L +  GL   F+     W   Y S  PE
Sbjct: 1143 SAEEFKKKMQTTMQDFNSTGPFGSNVSSEAALEQISVLRAQLESLKEEEGTIRHGLSIFKTEQPTSKDMQNLEKDIDYLLQVWEISQQWDTHWDEWKAGQFASLQTENMESTAQTMYKNLNKLSRELKDK--QWEIVEFSKNRIEQFKRTIPMILDLRDPAMRDRHWNQIKQEMQRSFD-HNSAEFTLEKIVALGLEQHAERICEISGAARKELSIEQSLEGIAKTWEETSLDIAPYKDKGTEEVFQALEDNQVTLS-------TMKASRFVRAFEKEVDRWERCLSLVLEVIEMILTVQRQWMYLEIIFLGEDIRKQLPHESTEFDDINSSWKTIMDRLNKDNNALRGTHHPGLLEKLSEMNSKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSRNPDAVQPHLKKCFDNIKSLRINKVRNNKSEAAGMFSADGE---FVEFTHPVLLEGPVEAWLCDVERTMRWTLKDTLRNCRTALKKMTGKRDKWVKDWPGQMLITASQIQWTTDVTKCLITGKESADKSALKSMKKKQVSMLHRYSDAIRGNLSKILRLKIVALVTVEVHARDVIDKLAKAGCCDVNAFDWLCQLRLYWEKDVDDCIIRQTNTHFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKGLGMYVIVVNCSDGLDYKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGLTNFIFEGRDICLVSSCGIFITMNPGYAGRTELPDNLKSMFRPISMVVPDSTLIAEITLFGEGFNNCKVLAKKVFTLYCLAVQQLSKQDHYDFGLRALTSLLRYAGKKRRVRPDIADEEILLM-SMKDMNIAKLTSTDLPLFNGIIQDLFPAVETPTIDYGKLKETIEEELHQSGLQVTPFTVTKVIQLYETKNSRHSSMIVGKTGSSKSVTWQILQKALSAMHRKGEPGFNLVHEYPLNPKAVSLGELYGEYDLSTNEWTDGVLSSLMRIACADEKPDEKWIVFDGPVDTLWIESMNSVMDDNKVLTLINGERIAMPEQVSLLFEVEDLAVASPATVSRCGMVYNDYSDLGWKPYVQSWIDKRQK--MEVDHL---KRLFDRYIKKTISFKRTHCKELVPITELNGVISLCRLYDSL-------ASPENGVNPADNEN---YGRMVELW----FIFSLIWSICASVDEDGRKKIDNFLREMEG------------------TFPNKDTIYEYYVDTKN----KTWASFEDKLPKGWRYPSNAPFYKIMVPTVDTVRYHFLVNSLVCGQYPVLLTGPVGTGKTSVAQSVLQGLDPAKWTMLTINMSSQTTSNNVQAIIESRVEKRTKGTYVPVGGKKMLAFLDDLNMPAVDDFGSQPPLELLRLWIDYGFWYDRQMK-----MDMFLLASMGPPGGGRTHISGRLQSRFNLINMTFPAESQIKHIFGTMINQKLQE-FQEEVKPIGSILTQATLELYYAISARFLPTPAKIHYLFNLRDISKVFQGLLRSHRDFHDTKQSITRLWIHECFRVFSDRLVDQADTEAFVALLA-----------EKLGSLFDLTYHNICPNKQQPIFGDFLKEPHVYEDLLDFKALKGFMESQLEDYNLTPGVVPMSLVLFRDAIEHVTRVVRVISQPRGNMLLVGIGGSGRQSLSRLAAYICEYMVFQVEVTKQYRKQEFREDIKKLYRLTGVDNKPTVFLFNDTQIIDESFLEDINNILSSGEVPNLYKSDEFEEVQSALSDSARKE------NVLETADAMFNYLIERVRNNLHIVLCMSPVGEPFRNRIRQYPALVNCTTLDWFSEWPQDALLEVAERYLDGLILGNVEKIQTKVARIFVTMHQSVAQFSQRMKLELKRHNYVTPTNYLELVSGYKKLLAEKRAELGEQVSKLRNGLFKIDDTRSKVEAMSVELEDAKKKVAEIQKQCEEYLVVIVQQKREADEQQMAVSAHSEKIGAEEIKCKAMAENAQRDLDEALPALEEAMKALESLNKKDMTEIKSYGRPPALVETVMQAVMILRGCEPT--------------WAEAKRQLGESNFIKQLVHFDKDNISDRVLKKIGQ-YCTQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKRARLHGAMTQLAEKQAALAEAENKRREVEEKLKQLKNQYDEKLNQKEDLRKKSEDMELKLDRAGKLVSGLAGERVRWEQTVESLEKDMGYLVGDCLLAAAFLSYMGPFLSNYREELLTNIWMKQFRDLEVPCSPGFNFATFLSKPTAVRDWNIQGLPSDAFSTENGVIVTRGNRWPLMVDPQGQALKWIKNMESKRGLKVIDLQMPDFLRILENAVQFGSPVLLQNVQEELDPSLAPILNKSFTHIGGRVLLKLGDKEVEYNPDFQFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDSLVINIASGKRKLQELEDEILRLLNEATGSLLDDVQLVNTLQTSKITATEVSDQLETSEQTEIKIDTAREAYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNLSIEKSQRSHKLEERIINLNDYHTYAVYRYTCRGLFERHKLLFSFHMCAKILEVAGKLNMDEYSFFLRGGLVLDKEGQMDNPCTSWLADSNWDNITELDKLANFHGLMSSFEKYPKDWHQWYTSSEPE 3749          

HSP 2 Score: 521.161 bits (1341), Expect = 1.773e-147
Identity = 276/656 (42.07%), Postives = 396/656 (60.37%), Query Frame = 2
Query: 9407 LDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPR----QASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIEN-NVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNN-LSQNHWINRGVASLCQLDD 11356
            L K++++R +R D++   V SFI +NLG  F++PP  D+ +   DS   +PLIFVLSPG DP  AL++  E  G   S   ++SLGQGQ PIA +MI + +++G WV L NCHL+ SWM  L+K+ E++ + E++H +FRLWL+S P  +FP++ILQ G+KMT EPPKG+++N+ R Y    +     F  C+    +  +LF LCFFH+++ ER+KF  LGWNI Y FN+SD  +S   M ++L++Y E+P +AL YL    NYGG VTDD DRRLL + +  ++    V    +  S    YY P DG+   Y EYIR LP   +PEV+G H NADI     ET  LF  +L   P+     A+G G S ED + E++ D+ +K+PE  D E   K      S  +N VL QE+ R+N L+  +R++L  L+K IKGLVVM++ LEE+F  +   +VP  W  K+YPSLKPL S+  DL QR+  F  W E  + P  FW+SGF F   FLT VLQ+ AR++ + +D + +EF +++ D++ ++   P+DG  + GL+LEGA WDK+N  L E+ P  L   +P I  +P +       + Y CP Y    R G         +FV+ +DL +  +S  HWI RG A L  LD+
Sbjct: 3764 LQKMLIVRSLRQDRVSFCVNSFIINNLGSRFVEPPVLDMKAVMEDSTTKTPLIFVLSPGVDPTGALVQLAEASGMGPS-FHALSLGQGQAPIATRMIKEGVKNGHWVFLANCHLSLSWMPQLDKLVEQLQV-EDSHPDFRLWLSSSPHPEFPIAILQAGIKMTTEPPKGVKSNMKRLY---QLVTESQFSRCSRPVVYRKLLFSLCFFHSILLERKKFLQLGWNIVYSFNDSDFEVSENLMSLYLDEYEEIPWDALKYLIAGVNYGGHVTDDWDRRLLTTYINDYFCEGAVNTPFFKLSSLPTYYIPRDGSQDTYREYIRQLPPVEHPEVFGQHPNADIASQISETRTLFDTLLSLQPQVTSTTATGAGPSREDKVLEISADVRQKVPELVDYESTQKLLQDDPS-PLNVVLLQEIQRYNALLHTIRTSLTELEKGIKGLVVMSSSLEEMFQCIHDARVPPLW-EKAYPSLKPLASWTRDLCQRVEQFAHWAETAHPPVLFWLSGFTFPTGFLTAVLQSSARQHNVSVDTLSWEFIVSTVDDN-NLLFPPKDGVFIRGLYLEGAGWDKKNSCLVEAEPMQLVCPMPTIHFRPVENRKKVAKNMYSCPCYYFPVRSG----GAGRPSFVVGVDLKSGAVSYEHWIKRGTALLMSLDN 4407          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1565.82 bits (4053), Expect = 0.000e+0
Identity = 969/2687 (36.06%), Postives = 1514/2687 (56.35%), Query Frame = 1
Query: 1459 QGQIDDCKDQL-------EQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEY----RDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPS----CLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEF---TEQLEIIG-MISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITK-RGRWVLDWPGQIVICVSCIYWTKEVTEAITV-----PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDR-RKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFI---------RHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERL-TIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDK-KDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRG-LIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVI--MCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVV-EGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASEL-PSIKG-LREHFQNNTDKWKSMYDSQSPE 9369
            +G++  C ++L       + L   E + +   + +P L  + + +    +++     +      W +  +  LN   ++       K + KL K     P    VA  ++G++ +FK  LP+L  + N  +++R+                    +    Y L+  L+    IG+           + ++ + W+ MKF +  Y    ++ G  IL ++D+IQ  LDD+ +  Q+M GS FI PF   ++ WE  L  ++++I+VW+ VQ  W+YLE IF   DI +Q+PEE +KF  +D  +K++M+++V++P     CLV     D L+ L+D    LE  QK LNDYL+ KR  FPRFFF+S+DELL IL  + +P  VQ H+ K ++ I  L F   T    + G ++SAEGE + +     P  A+G VE W+  V   M  + + +  ++I  Y   K R  W+LD+ G +V+  + ++WT EV +            +K Y  K + QID++V+ +   L   +R  L  + +IDVHARD+V++  +  ++    FEW SQLR+Y   +  +++V Q S E  YG EY+G   RLVITPLTDR Y TL  AL + LGGAP GPAGTGKTE+ KDLAKA+   CVV NC +G+DY A+GK F GLAQ GAW CFDEFNRI+  VLSV++ QIQ+I+ A+   LKRF FEG E+SL+    +FITMNPGYAGR ELP+++K LFR V ++VPD   I EI L+S GF+ A+ LA K+   Y+L  EQLS Q HYD+G+RA+KSVL  AG L++  PD  NE ++L++A+ D+NLPKF+ +D+PLF G+ISDLFPG+D P+  +  F  AV+  L + K       +DK++Q+YE ++ RH  M+VG   GGK+    TL  A T +     M         +NPKA+++ +LYG  DPV+ +WTDG+L+ +FR+     D + R++++FDG VDA+W+ENMN+V+DDNK L L +GE I++ N   L+FE  DL+ ASPATVSRCGM++++P  L + P+ + ++    P    ++   L R LFE  +   ++ +             K ++  ++++ VVQL  +  +LL+        E+  ++E               L+  F+ +   S+G++LLE+GR KFD   ++L+  ++    K     L      P  L T++DF F+  +   W  W + + +   +  PD K  +I++PT +T R  + L+  +  ++PV++VG +GT K+    N+L  L  D  +   INFS+RT++   Q  +   +++R K  YGPP  K  +VF+DDLNMP  ++YG Q PI LL+  +D G  +D+ K+ +   L D   ++AMG  GGGRN+V SR I  F+V  +    +  +  I+++I+  H    F+     +   L   T+ +YK  I    PTP+K HY+FNLRD SRV  G+ L          + +R+W +E  RVFYDRL  E D+      +K    + F              G  +D  +R  ++FGDY T     + ++Y++I          +  L++YN  +K  M+LV+F  A++H++RV R+++ D GHALLVG+GGSG+QS T++AAF A  ++F I ++R Y ++ +R+DLK L +K G + K  VFLF+D  + +E F+E I+ +L +G VP L+P DEK  +L    N  R E  K G     +  +++ YFI +   NLHIVL MSP+GD  R R R FP L+N   IDWF  WP  AL  VA  FL +  M        VI  +C   H SV + S  F   LRR NYVTP +YL+ I T+  LL  K   ++    R   GL+KLE AS ++  +  +L   +  L   S+  + LL ++  +T   E K+++   + ++   +       K D E+ LAEA+P L  A  +L  L ++D+T +RS   PP  +++V E + +M G K             E  W ++  ++ +  FL  L     DS++   +K +R  ++   +   + ++  S A  G+ K++ AV  Y   A+ + PK+ K+A  EK    + ++L + +++L+ ++ +L  L ++       K+ L++  +L  ++L  A++LI GLG E  RWTE  + L ++   + GD L+SAA ++Y G F   FRN +V E W K  +E  IP S+ F++  +L + V+I  W    LP D  S+ NGI+   ++R+P+CIDPQ QA  WIK  E+ N L I    D +F++ LE +I++G P L ++V E ++P+++ +L+K +   +G   + LGD  ++Y+ +FK Y+ T+L NP Y P +  K  ++N+ +T +GLEDQLL ++   E+ ELEE++  LI E++ NKR LK+LED +L  L++S GN+L+N   ++ L  +K  + E+ EK  +AE T  +IDK R+GY+P A  G+ILFF +++MA ++ MYQYSL  F+ +F  S+  S  +  L  R+  + +  TL+VY   C  LFE HKLLFS  M I + + + +   E   F L G ++L+        +W+ D+ W ++VR +EL P+  G L E  + N  +WK+ +D  SPE
Sbjct: 1119 KGRLRYCSEELAKIEAGRQDLVGAEKLFDLPITTYPELLNVQREMRALRQIYEV---YKAAKTEWSQTLWVNLNIQLLQEGTEGFIKSLRKLPKDVRAMP----VAFFLEGRMKEFKESLPLLLDLKNEALRDRY--------------------LFLHCYRLY-LLKDWSLIGSPQG--------VKEVVDTWEVMKFSVQRYFKGTQERGY-ILGSVDEIQQNLDDNAVNLQSMAGSRFIGPFLNVIQQWEKNLSLISEVIEVWMLVQRKWMYLESIFIGGDIRSQLPEEAKKFDHIDKMFKKIMSDTVRDPGIKRCCLVPNRLSD-LQNLSDG---LERCQKSLNDYLDSKRNAFPRFFFISDDELLSILG-SSEPACVQEHMIKMYDNIASLRFDSGTNGETVAGALVSAEGEVMELKQ---PVPAEGRVEDWMTAVLLEMRRTNRLITKEAIFYYCQKKSRVDWMLDYQGMVVLAGNQVWWTWEVEDVFQKMSSGEKQAMKQYAKKMHQQIDNLVRRITQPLKKNDRRKLNTVLIIDVHARDIVDSFVRDSITDAGEFEWESQLRFYWDKKPDDLFVRQCSAEFSYGYEYMGLNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTESTKDLAKALGLLCVVTNCGEGMDYMAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALILQLKRFQFEGQEISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLLAKVLAKKMTVLYKLAREQLSKQSHYDFGLRALKSVLVMAGELKRGSPDL-NEDVVLMRALRDMNLPKFVFEDVPLFLGLISDLFPGLDCPRVRYPNFNDAVETILEENKYSLLPNQVDKVVQMYETMMTRHTTMVVGPTGGGKSVVINTLCQAQTRLGLLTKMYA-------LNPKAMSVIELYGILDPVTRDWTDGILSNIFRDINRPTDKKERRYILFDGDVDALWVENMNSVMDDNKLLTLANGERIRLQNHCALLFEVGDLQYASPATVSRCGMVFVDPKNLRYAPYWQKWVNSRPP----KEQADL-RKLFEKYVPSIIEMVVEGITDGKQGEKLKTIVPQTDLNMVVQLSMMLDALLEP-------EDLSSEE---------------LECFFIEALYCSLGAALLETGRKKFDDLVKKLSCLVSVQDEK----TLAGPGEIPGYLPTLFDFHFDGTTK-KWMPWSSLVAKYIHN--PDTKFIDILVPTVDTTRVNWLLEQMVKVKRPVVLVGESGTSKTATTQNFLNNLNPDFTMVLTINFSSRTTSMDLQRSLEASVEKRTKETYGPPMGKSLLVFMDDLNMPRVDEYGTQQPIALLKLLLDRGGMYDRGKELNCKQLKDLGFIAAMGKAGGGRNEVDSRFISLFSVFNIPFPEEEALHLIYSSILKGH-TRPFEECIRNMCDKLTFCTLELYKTIIKDLPPTPSKFHYIFNLRDLSRVYNGLTLTNAERFLTEAQFVRVWRNECLRVFYDRLINETDKALVQGHIKSLIQEHF--------------GSELDSAMRDPILFGDYRTALSESEPRVYEDIQDYDACKALFQEILEEYNE-NKTRMNLVLFDDALDHLTRVHRIIRMDRGHALLVGVGGSGKQSLTKLAAFTAGCDVFEIVLSRGYSESNFREDLKTLYVKLGIENKRTVFLFTDAHVAEEGFLELINNMLTSGMVPALFPDDEKESVL----NQIRDEAVKMGS--GHSKESVWQYFINKSASNLHIVLGMSPVGDVLRTRCRNFPGLVNNTGIDWFLPWPPQALHAVAQSFLGESPMIPAAHSETVIGHVC-MVHGSVGEFSTLFQQKLRRSNYVTPKNYLDFISTYSTLLQDKDQFILAQCKRLEGGLDKLEEASVQLADLNKKLAEQKVVLAEKSSACESLLQEISTNTAIAEEKKKLAEEKAKEIEEQNKVILVEKKDAESSLAEALPALEAARIALQDLDKSDVTEIRSFAKPPKQVQVVCECILVMRGHK-------------EINWKTAKGMMSEANFLRSLMEMDCDSISGGQVKTVR-GFLKNLNTSSEEMQAISKAGSGMLKFVEAVMGYCDVAREIKPKREKVARLEKNFFQSKRELEKIQSELEAIQKELGALGEKYSAAMGEKQLLQEEAQLMERRLIAADKLISGLGSENQRWTEDLEELKKKRVRLLGDCLISAAFLSYEGAFNWDFRNEMVYEVWQKDVLERGIPLSQPFRIESLLTDEVEISRWGSESLPPDELSVQNGILTTRASRFPMCIDPQQQALNWIKKKEEKNNLKISSFNDPDFLKQLEMAIKYGFPFLFQDVDEYIDPVIDNVLEKNVKGAEGRQVIVLGDKEVDYDPNFKLYLNTKLANPKYSPAVFGKAMVINYTVTLKGLEDQLLSVIVGFERKELEEQRERLIQETSQNKRLLKDLEDSLLRELATSTGNMLDNVELVHTLEETKSKAGEVFEKLKLAETTSADIDKLRDGYRPAAKRGAILFFVLAEMALVNSMYQYSLASFLEVFDYSLRKSLPNSILPKRLSNIMNTLTLNVYNYGCTGLFERHKLLFSFNMTIKIEQAEGRAPQEELEFFLKGNLSLEKSKRKKPCDWLPDQGWEDIVRLNELFPNEFGALIEDIEKNPKEWKNWFDLDSPE 3681          

HSP 2 Score: 432.565 bits (1111), Expect = 1.270e-120
Identity = 231/650 (35.54%), Postives = 362/650 (55.69%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDY-----TELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPF----SPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQA-SGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGV 11332
            KL++LRC R D++  AV  ++T  +G+ ++ PP     + F  S   SP++F+LSPG +P N L+K  E  G+  +++  +++GQGQ  +A ++++ A+  G W++LQNCHL   W+K LEK  E I  P   H +FRLWLT+ P  DFP+ ILQ  +K+  EPP GL+ N+  +Y    +        C  +  + ++++ L FFHA+VQERRK+G +GWN+PY+FNESD  + +  +  +L          +P  +L YL GE  YGGR  D  DRR+L   +   Y  D +     PF    +    Y  PPDG+ ++Y+E I SLP+   PEV+GLH NA+I    Q    +++ ++   P+   SG G S ++ I ++A DI  KLP  FDL++I K+     S + + VL QEL RFN+L+  +  +L  LQ+A+ G V M++EL+EV  ++  G++P  W   +  +LK LG+++    +R   +  W+E   P+  W+SG +  +S+LT ++Q   R+   P+D       +T + +  ++  +P  G  V GL+LEGA WD E   L  S PK L   +PI+ + P +   +   +T   PVY TS RR  +         V   DL      +HW+ +GV
Sbjct: 3698 KLLLLRCFRVDRVYRAVSDYVTATMGEKYVQPPVISFEAIFEQSTPNSPIVFILSPGCEPANDLMKLAERSGFGTNRLKFLAMGQGQEKVALQLLETAVSRGQWLMLQNCHLLVKWLKDLEKALERITKP---HPDFRLWLTTDPIRDFPIGILQKSLKVVTEPPNGLKLNMRATYFKIQLET---LMSC-PHPAYRSLVYVLAFFHAVVQERRKYGKIGWNVPYDFNESDFLVCMEILNTYLTKAHNQGEGSIPWGSLKYLIGEVMYGGRAIDSFDRRILTVYMD-EYLGDFIFDTFQPFHFFHNKDVDYRIPPDGSKEVYVEEIESLPLANTPEVFGLHPNAEIGYYTQAARDMWTHLIELQPQTGDSGGGISRDEYIAQVARDIQNKLPSAFDLDVIRKKLGPDVSPT-SVVLLQELERFNRLVLRMSRSLSELQRALAGEVGMSSELDEVARALFNGQIPAIWRKLAPDTLKSLGNWMIHFRRRHQQYSSWVEVGEPAVMWLSGLHIPESYLTALVQATCRRNGWPLDRSTLYTHVTHYRSEDEVTEKPGQGCYVSGLYLEGADWDVEQGCLVRSKPKELVVQLPILKVIPIEAHRLRLQNTLRTPVYTTSMRRNAM-----GVGLVFEADLFTTEHHSHWVLQGV 4333          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1501.88 bits (3887), Expect = 0.000e+0
Identity = 914/2701 (33.84%), Postives = 1463/2701 (54.17%), Query Frame = 1
Query: 1375 TKSIEDFKKKEVMTMEEMRRNVQF----------LDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVIC---NPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIF-SSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEI------IGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAIT-----VPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLP-KADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEH-GFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVR-GLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIE-MDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDF-KFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKC---IEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPIL-QKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            T  +E FK +E       R+N  F          LD    QI + +  + +L +   +       +  L    K +     LW          + W   P+ E+N   +E +    +K +  L K+        +      G     KN L  L+ I    NP I+ RHW Q+    G      E+++L D L   LH   +++  I   A KE  +EK L ++   W  M+F    +  + V +L + +D+   L+D+ ++ Q +  S  +  F +E+  W+ +L   + +I +W +VQ TW +LE IF  SEDI +Q+PE+ ++F  +D  +KE+  ++ K P+ + AT +  +  RL D    L   +K L +YL+ KRL FPRF+F+S+ +LL+ILS   DP +VQ HL K F+   +++F    +       IGM S E E +       P    G VE WL +V + M  +V+  + +++ +Y    R +W+ D+P Q+ +  + I+WT +V  A +       N +K+Y  K  SQ++ ++ ++ G L+ G+R  +  +  IDVHARDVV  +   +V +  AF WLSQLR+   +R    +      +  Y  EYLGNTPRLVITPLTDRCY TL  +L L + GAP GPAGTGKTET KDL +A+     VFNCS+ +DYK+ G  +KGLAQ GAW CFDEFNRI +EVLSVVA Q++SIQ AI    KRF F G E++L P+  +FITMNPGYAGR ELP+NLK LFR  AM+VPD+ LI EI L + GF++AR LA K +  Y+LC E LS Q HYD+G+RA+KSVL  AG+L++  P+   + + L++A+ D N+PK ++ D+P+F G+I DLFP +D+P K D D F   V++++   KLQ  + F+ K++Q+ E++ VRH + +VG    GK+Q  ++L            M+   V +  +NPKA+T  +L+G  +P + EW DG+ + + RE A       KW++ DG +D +WIE++NTV+DDNK L L S E I ++  M L+FE + L  A+PATVSR G++Y+  A LGW P + S+I+ +  I   + ++ +   LF+  +  CLD +R   KK+I   E   V  L  L   LL      P                  + +Y   +  F+F+ +W+ G +L +     + V F +              +   K+  FP + T++D+  + ++   ++ W   + R  M   P+  +   ++ T ET R +YF++  L   +P+++VG  GTGKSVL+   L  L  D+Y   N+ F+  T++   Q ++   L+++    YGPP  KR + F+DD+NMP  + YG   P  L+RQ +D+ HW+D+       +     +S M P  G    ++ R+ RHF+V  ++    + +  I+ +I+  H    GF  V  + G  LV   ++ +++  A+FLPT  K HY+FNLRD S + +G+L      +   + L+++++HE  RV+ D++  ++D    FD ++      F  ++E+ L       KV++      L  G     +  Y  + S ++L K +   LD YN ++ A M+LV+F  AM HI R+ R+L+   G+ALLVG+GGSG+QS TR+AAF++  E+F I + + YG  + + DL  L IKAG      VFL +D Q+  E F+  ++ LL +G++P+LYP DE   I+  ++N  R      G+ +  +    + +FIERV++ L + L  SP+G   R R R FP+++NC  IDWF  WP++ALE V+ +FL+++E ++   ++++     + H SV + S+++L   RRYNY TP S+LE IK ++ LL  KR +L     R   GL+KL   S +V  ++ +L A + +L   +   D+L+  V  +T +V  ++ +   E+E     A      + DCE DLA+A P L  A  +L+TL +N++T ++S  +P   +  V  AV +++        D S        W ++  ++     FLD L NF+ ++++   +K + + Y+ +P+F P++V   S A  GLC W+I + K+      V PK+  L  A  EL    ++L+  KA+++ +   L  LT + ++    K + +   E   + +  A +L+GGL  E  RW EA     ++   + GDVL+  A V+YLG FT  +R+ +++   K     +++ IP +     + +L +   + AW   GLP D  S +N  I+ +  RWPL +DPQ Q  KWIKN    N L +I++    ++ ++E ++  G  VL+EN+ E ++P+L P+L Q+TI + +   Y+++GD   EYN  F+  + T+L NPHY PE+  +  L+NF +T  GLEDQLL  V + E+P+LEE K+ L  +    K  LK LED +L  LSS+ GN L +   +  L  +K  + EI EK   A+VT+ +I++ R  Y+P A   S+L+F ++D+  I PMYQ+SL  F  +F  ++  +   E L+ R+  L D  T SV++   R LFE  KL ++  +   +L    ++N     FLL   V    P      +++S   W  +     +   + L    +++  +WK   + + PE
Sbjct: 1068 TFDVEQFKFRE-----HFRKNGPFRFDIVNPYEMLDTTHKQIQEMESIMAKLIESAGLFEVNIPDYKQLKQCRKEVSILKELWDVVSVVRFNLEAWRTTPWREINVEEMELECKRFSKELRLLDKE-------ARAWDAFCGLDSTVKNTLTSLRAIAELQNPAIRPRHWQQLMTATGVRFSMDEDTTLTDLLNLNLHHFEDEVRAIVDRAVKEMGMEKVLTELDATWTAMEFGYESHPRTSVPLLKSDEDLVETLEDNQVQLQNLMSSKHVAFFLEEVSSWQKRLSVADSVISIWFEVQRTWSHLESIFIGSEDIRSQLPEDSKRFEGIDTDFKELAYDAHKTPNVVEATNKPGLYSRLEDIQGRLALCEKALAEYLDTKRLAFPRFYFISSADLLDILSNGTDPHQVQRHLSKLFDNTAKMKFETDADGKPSKTGIGMFSKEEEYVPFNE---PCDCTGQVEMWLNRVLDTMRATVRHEMTEAVVAYEDKPREQWLFDYPAQVALTCTQIWWTSDVGLAFSRLEEGYENAMKEYYKKQVSQLNTLITMLIGQLSPGDRQKVMTICTIDVHARDVVAKIIAQKVENSQAFVWLSQLRHRWDEREKHCFANICDAQFLYSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIRDKKKRFNFMGEEINLFPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFIEARLLARKFITLYQLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPERPEDQV-LMRALRDFNVPKIVTDDMPVFMGLIGDLFPALDVPRKRDLD-FEKFVRESVLDLKLQAEDNFVLKVVQLEELLAVRHSVFVVGNAGTGKSQVLKSLNKTYQ------NMKRRPV-WADLNPKAVTNDELFGIINPATREWKDGLFSNIMRELANVSHAGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLNPTMRLVFEISHLRTATPATVSRAGILYINQADLGWNPPVSSWID-KREIQSEKANLTI---LFDKYLPACLDTLRSRFKKIIPIPEQSMVQMLCHLLECLLTPEHTPPDCH---------------KELY---ELYFVFAAIWAFGGALFQDQLVDYRVEFSKWW------------VTEFKTIKFPSQGTVFDYYIDPET-KKFEPWSKMVPRFEM--DPEIPLQACLVHTTETIRVSYFMERLLERRRPIMLVGNAGTGKSVLVGGKLGSLDPDKYTIKNVPFNYYTTSAMLQAVLEKPLEKKAGRNYGPPGSKRLIYFIDDMNMPEVDAYGTVQPHTLIRQHMDYNHWYDRSKLQLKEIHSVQYVSCMNPTSGSFT-INPRLQRHFSVFALSFPGVDALNTIYCSILGQHLSREGFSAVVQKSGPQLVQLALDFHQRVTATFLPTAIKFHYIFNLRDLSNIFQGMLFCKSECMKTPQDLVKVYLHESNRVYRDKMVEDKD-FSTFDKLQSEMVGKFYEDMEEALEE----AKVMNMYCHFALGIG-----EPRYMPVQSWESLNKTLLEALDSYNEVNAA-MNLVLFGDAMSHICRINRILESPRGNALLVGVGGSGKQSLTRLAAFISSLEVFQITLKKGYGITDLKSDLGALCIKAGVKNIGTVFLMTDAQVADEKFLVLVNDLLASGEIPDLYPDDEVENIINSVRNEVR------GQGLLDSRENCWKFFIERVRRQLKVALCFSPVGSKLRVRSRKFPAVVNCTVIDWFHEWPQEALESVSLRFLQEVEHIEPEVKDSVSKFMAYVHVSVNKTSKDYLANERRYNYTTPKSFLEQIKLYRNLLALKRKDLTMKMERLENGLQKLNSTSAQVDDLKAKLAAQEVDLKQKNEDADRLIQVVGVETEKVSREKAVADEEEEKVASIAVVVTRKQKDCEEDLAKAEPALIAAQEALNTLNKNNLTELKSFGSPVAAVTNVTAAVMVLMAPGGRVPKDRS--------WKAAKVMMAKVDAFLDSLMNFNKENIHENCLKAI-QPYLQDPEFKPELVAAKSNAAAGLCSWVINIVKFYEVYCEVEPKRQALNKANAELASAQEKLSVIKAKINHLNENLAKLTAKFEKATADKLKCQQEAETTARTISLANRLVGGLASENVRWAEAVNNFKQQERTLCGDVLLITAFVSYLGYFTKRYRHELMDNTWKPYLSQLKVPIPVTPGLDPLSMLMDDADVAAWQNEGLPADRMSTENATILTSCERWPLMVDPQLQGIKWIKNKYGDN-LQVIRIGQRGYLDSIERALSAGEVVLIENLEEAVDPVLGPLLGQETIKKGR---YIKIGDKECEYNPRFRLILHTKLANPHYQPELQAQCTLMNFTVTRDGLEDQLLAAVVSMERPDLEELKSNLTKQQNGFKITLKTLEDNLLSRLSSASGNFLGDTELVENLEITKRTAAEIEEKVKEAKVTEAKINEAREHYRPAAARASLLYFIMNDLNKIHPMYQFSLKAFSVVFQKAVLKAAPDEALKQRVLNLIDSITSSVFQYTTRGLFECDKLTYTAQLAFQILLMNKEINPSELDFLLRYPV---QPGVTSPVDFLSHHSWGGIKALCSMDEFRNLDRDIESSAKRWKKFVECECPE 3673          

HSP 2 Score: 405.216 bits (1040), Expect = 2.448e-112
Identity = 232/672 (34.52%), Postives = 371/672 (55.21%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGY--NASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSED-----FPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQA---SGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIEN-NVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSST---YLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQL 11350
             P  ++    L KL ++R +RPD++  A++ F+ + LG  ++     D   SF +S   +P+ F+LSPG DP+  + K G   GY  +     ++SLGQGQ  +A + +D A ++G WV+LQN HL   W+ +LEK  E+    E + +NFR+++++ PS        P  IL+N +K+TNEPP G+ ANL ++  N    +    + C   + + ++LF LC+FHA+V ERRKFGP GWN  Y FN  DL ISV  +  +L   +++P + L YL GE  YGG +TDD DRRL  + L+ F   +++E E Y  +P   +  P +     Y +YI       +P +YGLH NA+I    Q + +LF  +L   PR A    G G S ++ ++ + ++ L+KLPE F++  +M +  V        V  QE  R N L   ++ +L  L   +KG + M N++E + N++ + +VP+ W  ++YPS+  L  +  DL+ R+     W  + N+P   W++GF+  QSFLT ++Q+ AR+   P+D++  + ++    N  D    P +GA V+GLF+EGARWD +  ++ ++  K L  +IP+I++K    V +D+  T   Y CPVYKT  R  T         +V   +L    + + W   GVA L Q+
Sbjct: 3677 FPQEWKNKTSLQKLCMMRALRPDRMNYAIRDFVEEKLGSKYVMGRSVDFAVSFEESGAATPMFFILSPGVDPLKDVEKHGRTMGYTFDNQNFHNVSLGQGQEVVAEQALDLAAREGHWVILQNIHLVAKWLGTLEKKLEQH--GEGSSQNFRVFISAEPSSSPEGHIIPQGILENSIKITNEPPLGMHANLHKALDN---FNQDTLEMCARENEFKSILFSLCYFHAVVAERRKFGPQGWNRSYPFNTGDLTISVNVLYNYLEANSKVPYDDLRYLFGEIMYGGHITDDWDRRLCRTYLEEFIKPEMMEGELY-LAPG--FPLPGNMDYNGYHQYIDDALPAESPYLYGLHPNAEIGFLTQTSEKLFRTVLEMQPRDAGSGEGSGTSRDEKVKAVLEETLEKLPEEFNMVELMGK--VEERSPYVVVALQECERMNILTQEIKRSLKELNLGLKGELTMTNDMENLQNAIYLDQVPDSWTKRAYPSMCGLALWFTDLLNRIRELESWSSDFNLPPAVWLAGFFNPQSFLTAIMQSTARRNEWPLDKMSLQCDVLK-KNREDFSSPPREGAYVHGLFMEGARWDTQAGVIVDARLKELTPAIPVIFIKA---VPVDKQETRNVYQCPVYKTRQRGPT---------YVWTFNLKTKENPSKWTLAGVALLLQI 4325          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 872/2592 (33.64%), Postives = 1396/2592 (53.86%), Query Frame = 1
Query: 1762 VKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIG--FDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSIL--SALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNP----SCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQ----IDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY-----DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVF-EGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKL-QHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGI------INPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTG-GINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFD-KKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF--EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTD----------------DKIYDEITSLKNLAKRMETFLDDYN-SISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLE--DIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEAD-------LAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPN-WMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            +K  ID F    P+L+++ N  +  RHW +++++ G  F+++ T+   L + +   L K+ E++E+I  +A KE  +E+ L ++  +W    F   +++  G  +L   +  +I   ++D ++   ++  + +  PF+ +++ W   L +  DII+ W+ VQ  W+YLE +F   DI  Q+P+E ++F  +D +W ++M  + + P    SC+       +L  L D    LE  QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  + F ++                                  +V +V+I+  K+V +  I   V+ K     +    Q+ +    + WTK+  EA+T     +  + K        ++ ++ +   +L + ER     L  I VH +D+ +++  L + S + FEWL Q R+Y     DR   + +        Y NE+LG T RLVITPLTDRCY TL  AL +++GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ +KGLAQ+G+W CFDEFNRI+L VLSV AQQI  +     +  K F F +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FR+VAMMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P T+ ES ++++ + D+NL K + +D PLF  +I DLFPG+ L KA +    +A+   +T+  L  H  W + KI+Q++E   VRHG+M +G    GK+                 T+ +   D G       +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+     W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + L W P +E ++     +  +    +++R LF         F   +    ++  E   ++Q   +   L+     QP  +  E   +              ++ L++F+ +WSIG+ L +  R K + + R      ++  Y  P S           + T++D+     + G W  W   ++          + + I++P  +  R  + +       K V+++G  GT K+V+I  YL +   + + A ++NFS+ T+    Q  + + +D+R    YGPP  K+  +F+DD+NMP   ++G Q   E++RQ ++   +F+ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I   H+  + GF+    ++   LV  T  +++      LPTPA  HY+FNLRD SR+ +G+L V    +   + L+ LW HE  RV  DR T  ED + +FD             +E+ LG       VV  +V    F D++ D                 K+Y+ I S  +L  R+  FL  YN SI  A M LV F  AM H+ ++ R+++   G+ALLVG+GGSG+QS TR+A+F+A + IF I +TR+Y      +DLK L   AG   K + F+ +DN+IK ESF+E ++ +L++G+V NL+  DE  EIL  +    + E  +       T   ++ YF+ RV+QNLH+VL  SP           FP+LI+ CT+DWF  WP+DAL  V+  FL   DI+     +  +V     + + V +   ++    RR  +VTP SYL  I+ +K +  +K   L ++K    TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+  A  ++    Q+  +    ++Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP+LI  +M+ V ++   +       +    I   W  S+KL+    FL  L+ F  D++N + ++ L   Y   PD++ +  +       GLC W  A+  +    + V P K  L + E  L I    L + +A+LD  +A+L  +  + ++    K+ L ++ E C  K+  A  LI GL GEK+RWTE +K  + +   + GDVL++ A ++Y G F   FRN ++  W K+     IP   +  + ++L +   +  WN+ GLP D  SI NGIIV  + R+PL IDPQ Q   WI+N E  N L I  L    F   LE+S+  G P+L+E+VGEEL+P L+ +L+K   +      +++GD  ++  K F+ Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG V   EK ELE+ +  L+ +   NKRK+KELED +L  L+S++G+++++E+ I VLS++K  S+E+++K  IA  T+V+I+  R  Y+PVA  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+  S KS     RI  + +H T  V+    R L+E HK LF+L + + +    N++  E +  L+ GG +LD     P P+ W+ D  W  +V  S+L     + +    +  +W+S +D ++PE
Sbjct: 1069 LKKTIDDFSECCPLLELMANRAMMTRHWKRITEVTGHTFEVE-TDTFKLRNIMEAPLLKYKEEIEDICISAVKERDIEQKLKQVIAEWDNKTFTFAQFKTRGELLLRGDSTSEIISNMEDSLMVLGSLMSNRYNTPFKAQIQKWVQNLSNTTDIIENWMTVQNLWIYLEAVFVGGDIAKQLPKEAKRFSNIDKSWVKIMTRAHEMPNVVQSCVGDETMGQLLPHLLDQ---LEICQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVVFHDKTR--------------------------------RVNHVLIS--KQVKHHCILFKVMFK----FVFLLAQVGLLGIQMIWTKDSEEALTNARFDRKIMTKTKQSFLELLNTLIDMTTKDLGTMERTKYETLITIHVHQKDIFDDLCHLNIRSPSDFEWLKQCRFYFIEDLDR---MMINITDVGFKYQNEFLGCTDRLVITPLTDRCYITLAQALGMSMGGAPAGPAGTGKTETTKDMGRCLGKYVVVFNCSDQMDFRGLGRIYKGLAQSGSWGCFDEFNRIDLSVLSVAAQQIAVVLTGKKERKKTFTFTDGDIVEMNPEFGIFLTMNPGYAGRQELPENLKINFRTVAMMVPDRQIIIRVKLASCGFIDNVELARKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRSNP-TDTESTIVMRVLRDMNLSKLIDEDEPLFLSLIEDLFPGIQLDKAGYPELEAAIDKQVTEAGLINHPPWRL-KIIQLFETQRVRHGMMALGPSGAGKSTCIH-------------TLMKAMTDCGQPHREMRMNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKIVFEPHNIDNASPATVSRNGMVFMSSSVLNWSPILEGWL-----MKRSAQESEVLRHLFSSSFPTLYQFSIQSLDFKMDMLEAFVIMQCINMLQGLI-----QPKDQGGELSREH-------------MERLYVFALMWSIGALLEQDDRKKMEHWLRHHDSIHLDLPYIPPDS-----------QDTMFDY--HVTNDGQWVHWNLRVEEYIYPKDITPEYSSILVPNVDNVRTDFLIQTIAKQGKAVLLIGEQGTAKTVIIKGYLSKSNPESHTAKSLNFSSATTPLMFQRSVESYVDKRMGTTYGPPAGKKMSIFIDDINMPVINEWGDQVTNEIVRQLMEQKGFFNLEKPGEFTNIVDIQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGTGHYCSQRGFEEDVRKVVSRLVPLTRRLWQMTKVKMLPTPANFHYIFNLRDLSRIWQGMLNVNADVIHTPKVLLCLWKHECKRVIADRFTSPED-VAWFD-------SMLANLVEEELGEEYRD--VVKPEVDAY-FVDFLQDAPEATGEEPENADFDMPKVYEPIASFPSLRDRLNMFLGLYNESIRGAGMDLVFFTDAMIHLVKISRIIRTPRGNALLVGVGGSGKQSLTRLASFIAGYGIFQITLTRSYNTANLMEDLKNLYRTAGQQGKGISFIITDNEIKDESFLEYMNNVLSSGEVSNLFARDEMDEILSDLIPVMKREFPRR----PPTNENLHEYFMSRVRQNLHVVLCFSP-----------FPALISGCTMDWFSRWPKDALVAVSEHFLSSYDIDCTPQVKGEVVQCMGSFQDGVAEKCVDYFQRYRRSTHVTPMSYLSFIQGYKAI--YKEKHLESVKFAMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEV---TVKAHAAEKVKIEVQKVKD----KAQAIVDSISADKAIAKEKLEAAKPALEEAEAALQTIKPSDIATVRTLARPPHLIMRIMDCVLLLFQRRLNAVKIDAEKNCITPSWQESLKLMTAGNFLGSLQQFPKDTINEEVVE-LLTPYFDMPDYNIETAKRVCGNVAGLCSWTKAMATFFSINREVLPLKANLVVQENRLAIAHADLQKAQAELDAKQAELDVVQAEYEKAVTEKQMLLEDAERCRHKMQTASSLISGLAGEKARWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRNLLLSDWQKEMRARCIPFGINLNLTEMLIDAPTVSEWNLQGLPNDDLSIQNGIIVTKAARFPLLIDPQTQGKIWIRNKEAKNELQITSLNHKYFRNHLEDSLSLGRPLLIEDVGEELDPALDNVLEKNFIKTGSTYKVKVGDKEVDVMKGFRLYVTTKLPNPAYTPEISARTSIIDFTVTMRGLEDQLLGRVILTEKQELEKDRMDLVEDVMANKRKMKELEDSLLYRLTSTKGSLVDDESLIVVLSNTKRTSEEVTQKLQIAAETEVKINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLRQFLGLFDLSLARSSKSPITSKRIGNIIEHMTYEVHNYAARGLYEEHKFLFTLLLTLKIDMQSNRIKHEEFLTLIKGGASLDLKACPPKPSKWIPDMTWLNLVELSKLWQFSDILDQIGRHEKQWRSWFDKEAPE 3528          

HSP 2 Score: 417.542 bits (1072), Expect = 4.358e-116
Identity = 232/661 (35.10%), Postives = 377/661 (57.03%), Query Frame = 2
Query: 9401 QGLD---KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSY--LNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDY---TELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPR-QASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYS-ESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARK-YTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQL 11350
            Q LD   +L+++R   PD+ +   + +I D++G+ + +    DL  ++ +S+  +P+I +LS G+DP + ++  G+ Q     + A +S+GQGQ   A K++ Q + +G W +LQNCHL   +   L+++ + +   ++ H++FRLW+T+    +FP+++LQ  +K TNEPP+GL+A L R+Y  +N  + D       ++  +W  ML+ + F H+ VQERRK+GPLGW+IPYEFN++D   +V+ +Q  L+D      +    + Y+ GE  YGGRVTDD D+RLL +  +++++  +   E   F     Y+ P   +   Y++YI+ LP    PEV+GLH NADIT  ++    +   IL   P+  +SG G++ E ++  LADD+L+KLP ++    +MKR   M   E MN  LRQE+ R  +++++VRSTL +L+ AI G +VM+  L +  + M   ++P  W   S+ S   LG +  +L++R   F  WI    P+ FW++GF+  Q FLT + Q   R      +D +    E+T +    DI   P++G  VYGL+LEGA WD+ N  L +S PK+LF  +P++ +       +  S  Y CP+YK  AR           N +  +DL  +    +WI RGVA LC +
Sbjct: 3538 QSLDCFKRLLLIRSWCPDRTIAQARKYIVDSMGERYAEGVILDLERTWEESDPRTPIICLLSMGSDPTDIIIALGKRQKV---ETAYVSMGQGQEVHARKLLQQFMANGGWALLQNCHLGLDF---LDELMDTVTETDSIHESFRLWITTETHRNFPITLLQMSIKFTNEPPQGLKAGLKRTYQGINQELLD------VSNMVQWRPMLYSVAFLHSTVQERRKYGPLGWSIPYEFNQADFNATVQFVQNHLDDMDMKRGVSWTTVRYMIGEIQYGGRVTDDYDKRLLNTFAKVWFSETMFNHE---FQFYKDYHIPRCTSVDQYLQYIQGLPAYDTPEVFGLHPNADITYQSKLAKDVLDTILSIQPKDSSSGGGETREAAVGRLADDMLEKLPPDYSPFEVMKRLETMGRLEPMNIFLRQEIDRMQRVLALVRSTLTDLKLAIDGTIVMSENLRDALDCMYDARIPARWKKASWAS-STLGFWFTELLERNQQFQAWIFEGRPNCFWMTGFFNPQGFLTAMRQEITRANKGWALDRMVLCNEVTRW-MKDDITQPPQEGVYVYGLYLEGAGWDRRNCRLVDSKPKVLFEMMPVVRMYAEN-NGVKDSRLYSCPIYKKPART--------DQNIIAAVDLRTSQRPEYWILRGVALLCDV 4172          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2528.82 bits (6553), Expect = 0.000e+0
Identity = 1329/2678 (49.63%), Postives = 1795/2678 (67.03%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPE--MRGQRLFLRTVIFNE---KLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNG-LKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYP-KPKSIKLTK---------SNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISP----DAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF--EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS-GKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRN 8055
            + + R +N+ E+      ++   F+ V+ R        L + WL     ++         L+PK +  N   + ++F   A+LM++ L+ +   S+ D+T+ I   + G               P  ++ L +++  I ++P FK+ + +L+  +  ++++   +PRVE  L+ +  M      L+ V+  E   +L +    E +Q     ++ P+ +L  Y+ +  L+  +AE +V  FL E H     ++ +  Y++L   +      V    +F L    L   + KR + L   L+    +E+++  + +C  ++ I  K    P +T+ L+ ++E++++    E+ +L+ +  EA + L+FLLD+A++   +++ N T F W   +  +F      +  + EQ +E L+ R  +FEE LE   K  E+F    +  + ++ + ++    L  +++   + +E  N EE    W  SQ+P    +   L PY RL+  A++F  K+  W++GP  ++N   +E D+    + ++KL +    +P A  +  ++K  ++ F+ HLP+ QV+CNPG++ RHWD +S+++GF +   E+  L  FL   L   L K  +I   A+KE+ LEK L KM  +W EM+F L  YRDSG SILSA+DDIQMLLDDHI+K+QTM+GSPFIKPFE +MK WE KL+ + +I+D WLKVQATWLYLEPIFSS DI+AQMPEEGR+F  VD TW++++ +++ +   L       ML+RL  S  LLE I KGLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI R+EFTE L+I  M S+EGE + ++  I  +KA+G VEKWLL++E VMI SV  VI +++E+Y  T R  WV  WPGQ V+CVS  +WT EV EAI      L+ YL +CN QID++V LVRG L+   R+TLGAL V+DVHARDV+  + K  ++  + F+WLSQLRYY   G +    I+  LPYG EYLGNTPRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G    +FEGTEL LNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P +ENE IL+L++I DVNLPKFL+ D+PLFEGI SDLFPGV LPK D+ +   A+K+N  K  LQ  ++F +KILQIYEM++VRHG MIVGEPFGGKT AY+ LAAAL DI     M E KV   ++NPKAITMGQLYGQFD +SHEW+DGVLA+ +R FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQ+++  NLIFEP DLE ASPATVSRCGMIYMEP  LGWRP + S++    P  L+  H  LI  LFE L+  CL F+R + K+L  TS+ + V  L  L    +D+             +++ +K +  +++  W++G+FLFS VWS+G+S    G+  FD   REL  G  PL     K   L++         S  FP   ++Y++ F ++  G W+ W      E++S++P    D   N+II+PT +T R T  +++ +TH+KPV+ VGPTGTGKSV I N+L++ L K+ Y    INFSA+T+A QTQ+IIM KLDRRRKGVYGP   KR V+FVDD+NMPA+E+YGAQPP+ELLRQW+DH +W+D KD S + L +  +L AMGPPGGGRN V++R +RHFN + +NEF+D +M  IF+ I+ WHF     F   F+ L + LV STM VYK A  + LPTP KSHY+FNLRDFSRVI+GV L           + RLWVHEV RVFYDRL  + DR      ++ T     K +  ++  H S   G+V D+D+R L+F D+     D K Y E++ ++ L   +E  L+++N++SK PM+LV+F+FA+EH+ R+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD E+F +EI++ Y  NEWR+DLKR+L ++    +  VFLF+D QIKQESF+EDI+ LLN+G++PNL+  DEK EI EKM+   R  +K   ++ D +P+A+ N F++R +  LH+VLAMSPIGDAFRNRLR FPSL+NCCTIDWFQ+WP DAL+ VA ++LED+E+ E T  + + MCK +H S   LS++F    +RYNYVTPTSYLELI TFK LL  KR E++ +K RY  GLEKLE A+ +V  MQ EL ALQP+L+    Q    +A +E+++ EV     ++ A++  AN +A  ++ IKD+C+ADLAEA+PILR A+A+LDTL Q DIT+V++MK+PP  +KLVMEA+ I+ G KP+R PD S +G+M+ED W  + +LLGD KFL  L +F  D++    +K +R KYI   +FDP  +RNASTA EGLCKW+IA++ YD  AK+VAPKK+KL  AE EL + +  L  K+  L EV+ KL  L   L+  +Q+K +LE+ +++CTKKLDRAEQLIGGLGGE+SRW EAA++L  RY ++TGD L+S+ +VAYLG F  +FR 
Sbjct:  170 YCDLRLVNVEEIRGGTAALELSSFQKVVMRHVDLAKETLLSKWLSEIQTIYYQSNK--KKLVPKLT--NVTRLASYFNCAAALMTSLLQKLALNSIYDYTDLICSTQTGT-----------VKHPGFVLRLILSKDTIKFEPDFKDFQVVLLNVFDVMMKTLATVPRVETKLYSDWPMDKAHTHLQPVVLREVLEELQSHVRAEIIQ----QSLLPREHLRHYEPFEGLVGGQAERDVERFLSEEHTFSEHEQLVSHYRELSHSILYSSQLVVRLGMFELHCDELVAALAKRAENLGSRLLGRMSQEHQKFIQRLCEEFESIAEKALSTPINTKALMELKEYIQKVEVQEMSQLQVKLNEAKDHLLFLLDHASLSPSEMRHNNTAFQWCGRMPGIFTEHRRILTEKTEQYQESLKFRRRRFEEDLEAYAKQAEEFST--LGDLADVNKYLKKAQVLHTKLEAATEMIESFNAEEEAFAWPTSQYPQKKKIQDVLMPYLRLYEMAVEFTSKHKAWMEGPLADVNPDVVEQDVGNYWRGLYKLERSLQASPQALLIQQQLKSNVEAFRTHLPMAQVLCNPGLRGRHWDALSEVVGFPLLTQEQVCLEKFLEMNLESFLSKFNDISDTASKEYSLEKALEKMVREWDEMQFTLIVYRDSGTSILSAVDDIQMLLDDHIVKTQTMRGSPFIKPFESDMKEWERKLLLLQEILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFTTVDKTWRDLIKQTLTDTHVLAVVSIDKMLERLQKSTELLELILKGLNDYLEKKRLFFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGISRVEFTEALDITHMKSSEGEVVQLIETISTSKARGQVEKWLLELEAVMIRSVHNVIGEAMEAYPSTPRAEWVRAWPGQTVLCVSQAFWTSEVHEAIRGGQQVLERYLAQCNGQIDEVVGLVRGQLSQQSRVTLGALVVLDVHARDVLVALLKGGIAHDSDFQWLSQLRYYWEDGHLQTRMINAGLPYGYEYLGNTPRLVITPLTDRCYRTLFGALNLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLLSCGAWACFDEFNRIDLEVLSVVAQQILTIQRGINTGSDTLMFEGTELKLNPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPDYAMIAEIMLYSFGFVSARPLSVKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYP-SENEDILMLRSIVDVNLPKFLAHDLPLFEGITSDLFPGVKLPKPDYVVLLEAIKENCEKMNLQMTDFFAEKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAAALGDICEKALMAENKVQITVLNPKAITMGQLYGQFDAISHEWSDGVLAVSYRAFATSTSPDRKWLVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHILGWRPLLTSWLNAR-PPPLSAPHKALICALFERLVPCCLQFVRKSTKELSPTSDTNLVCSLMNLMDCQMDDF-----------HDETKIKAMDDRDVSAWIEGIFLFSLVWSVGASCSTHGQVLFDQLLRELMSG--PLSADTSKRFHLSENVEPPAEPFSVPFPAAGSVYEYRFIQEGKGRWELWT-----EALSLAPPIPRDMNFNDIIVPTLDTIRFTALMEMLVTHQKPVLFVGPTGTGKSVYITNFLLKHLDKNTYKPLTINFSAQTTAAQTQNIIMGKLDRRRKGVYGPAQGKRMVLFVDDVNMPAREEYGAQPPVELLRQWLDHSNWYDLKDCSMIKLENVQILGAMGPPGGGRNAVTARFLRHFNTVTINEFDDKSMFTIFSRIMGWHFTARFAFPTDFSVLTEQLVQSTMEVYKAATQNLLPTPTKSHYLFNLRDFSRVIQGVCLSLPETCPVAASIQRLWVHEVLRVFYDRLVDDADRTWLVAFIRKTIHTYMKEDFTQLFQHDSNGDGQVEDDDLRSLMFCDFSDSKDDAKRYVEVSDVERLRLVVEGHLEEFNNLSKKPMNLVLFRFAIEHVCRISRILKQPRSHALLVGVGGSGRQSLTRLAAHMADCELFQVEISKGYATNEWREDLKRILRRSTDGEQNGVFLFTDTQIKQESFLEDINNLLNSGEIPNLFAPDEKQEICEKMRQIDRQRDKD--KQTDGSPLALLNMFVDRCRDQLHVVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPGDALQAVATRYLEDVEVSEETLASCIDMCKLFHTSTIALSQKFQAEQQRYNYVTPTSYLELISTFKDLLEKKRLEVMRMKRRYEVGLEKLESATSQVAGMQAELAALQPQLLEAGIQVVNTMAVIERESEEVSRTERVVKADEAVANEQAMAAKVIKDECDADLAEALPILRSALAALDTLTQQDITVVKTMKSPPAGVKLVMEAISILKGVKPDRVPDPSGSGRMVEDLWGPAKRLLGDMKFLQSLHDFDKDNIPVAIMKTIRAKYITNLEFDPDKIRNASTAAEGLCKWVIAMESYDKVAKVVAPKKVKLNQAEAELAVAMGSLRRKQEALREVQDKLAGLQQTLEANKQKKADLENQVDMCTKKLDRAEQLIGGLGGERSRWMEAARLLGIRYNDLTGDTLVSSGIVAYLGAFISSFRQ 2804          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1966.04 bits (5092), Expect = 0.000e+0
Identity = 1148/3006 (38.19%), Postives = 1750/3006 (58.22%), Query Frame = 1
Query:  481 PLMIVELKVAEPKIIYQPSFKELKD---LLIRCYQFIVQSSEHI-----------PRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFK---RC-DKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYAT-IPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEES-SLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDS-GVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEF-----------TEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLD-WPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNS-------QIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY-DRGGEVWVCQIS-TELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQE----YKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQD-DRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKD-RYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDT-----LLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEK--ILGHLSLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEM-DENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPN-PAPNWMSDKLWSEMVRASE-LPSIKGLR 9309
            PL + E  +    +++ PS  E +D   ++I  ++  V S +++           P +      +  G+   L T+  ++K +   +    +  +        Y + ++++         L++ A   + H +   ++ +  Y +   +   ++    L + ++D  +L   +     RC + + +LL       +R+   +I     D   K+  +P+ T   V    FL E     +  L+EE +  V+    +  +    P ED+ + +TL      + N  D A        E+  + L   +L+    ++ + +  +D    ++ + +   R +  L E     D+ + Q  Q    +     E + F  L  +   L     +W +  ++ +    WL+  F  L+   + +++ +  KI+++L K    N     V   +K K++  +  LPV+  + NP ++ RHW+ + +IIG  ++  E   +L   +   +  + E+++++   A+ E  LE  L K+++ WK  +F +  +RDS  V IL+  D+IQ+LLDD II   T+  S ++ P +  +  W+ +L+  N  ++ W+  Q  WLYLE IFS+ DI  Q+P E + F  VD +WK++M +  + P+ L A  Q  +L    ++N+LLE+IQK L  YLE KR+ FPRF+FLSNDELLEIL++T++PQ VQPHL+KCF+ I RLEF           T   +I+ M+S EGE +S+   +   KA+G VE WL +VE  M  S++++   +I  Y    R  WV+   P Q+V+ V+ + W +++T+ +    G  D+L    +       +++ +  LVRGNL    R  + AL  +DVHARD+V +M + +V + N FEW  QLRYY D   +  V +++ ++  YG EYLG  PRLVITPLTDRCY  LM AL+L+LGGAP GPAGTGKTET KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ +I+ A A  + RF+FEG E+ L  TC  FITMNPGYAGR ELPDNLK LFR +AMMVP+YALI E+ LYS GF  +R LA K+   Y+LCSEQLS Q HYD+GMRAVKSVL  AG+L+++ P    E ++L++A+ D NLPKFL+ D  LF GI+SDLFPGV++P  D+    S++++ L  RKLQ     + K++Q+YE +LVRHG+M+VG   GGKT  Y  L+ AL  +   G  +      KV   ++NPK+I+MG+LYG+ + ++ EW DG++A+  R  AVA D +  KW++ DGPVDA+WIEN+NTVLDDNK LCL + E I+++ ++++IFE  DL+ ASPATVSRCGM+Y++  +L W P++++++   +     ED  Q I  LFE  ++  L F+   C + +   +I  V  L  L  SLL   +  P ++     E S +  I  Q         F+F ++W++G +L+E+   +FD F +         + +    KL  S      L  Y   ++ K    W+  V      +   + +    E+++PT +T R  Y ++  L  +  V+  G TG GKSV+    L ++ ++ +Y+   INFSA+TS+ +TQ+II +KL+++RK + G P +KR ++FVDDLNMP  ++YG+QPPIELLRQ+ D G ++D++      + D       +     PPGGGRN V+ R IRHF++L +   +++++ +IF  I+   F   F     ++   +V + + +Y +     LPTPAKSHY+FNLRD S+ ++G+L      + +  ++ RL+ HE  RVF+DRL   ED+  F  ++    +  F   +E    + H              ++FGD+M       D++Y+++T ++ L   ++ +LDDYN  S   M LV FQ A+EH++R+ R+++Q+ G+ALLVG+GG+G+QS TR+A  M  +  F IE++R Y  + + +DL++L   AG + K  VFLF+D QI  E F+EDI+ +LN+G+VPNL+  DE    LEK+  A R + K+ G   +     +  +FI RV+  LHIVL MSP+GDAFR R RMFPS++NCCTIDWF  WP +AL  V+  F   +++  +  +E +  MC   H SV +L+E +   LRR  Y TPTSYLELI  +  +L  KR++L   ++R   GL KL   ++ V K+Q+EL AL+P L   S   + L+ K+  D    +  R ++  ++  A VKA E+Q +  D + DL EA+P L+ A  +LD+L ++DI+ VR   NPP  ++ VMEA+CI+L +KP+              W S+ +LLGD  FL RL ++  ++++   I+KL+  YI   DF P+ V   S AC+ +C W+ A+D Y    K V PK+ +LA A+ EL+ T+  L +K+ +L +VE ++  L DQ D +   K+ L  N+ L   ++ RA +L   LG E+ RW E+         N+ G+V +++A VAY G FT  +R  +++ W  +C E+ IP + +F ++ ILG+P +IR WN  GLP D+ S +NGI+V    RWPL IDPQ QAN+WI+N E  N L IIKLTD NF+RTLEN+I+ G PVLLE + E L+P LEPIL K  F   G   +RLGD+ ++Y+K+F+FY+TT++ NPHYLPE+  KV ++NF +T  GLEDQLL  V   EKPELEE++N LI+    +K +LK +ED+IL++L +S+GNIL+NE  I  L  SK+ S  I  +   AE T+  I+  R  Y+PVA  GS+++F I+ ++ IDPMYQYSL +F  LF M+IE SEK  DL  R+E L     L+ Y NI R LFE HKL+FS  +CI +L+    V+D  W   L G   +D   P  P   W+++  W+      + LP  KGL+
Sbjct:  467 PLFLTEFMLEPESLMFAPSQNEFQDGLSVVIDSFKDTVLSVDNLVTDIYFDAFTQPIINKKHEEKSCGEGPSLETIFQDDKHLHKIIGGVQEVIRTAFNAAGLYADTFEQFRLFYKENESLDLEALKNKEHDVAFFEESLAKYHEQHKDAVAIKERRDLGMLLVDATKLKKKLIPSPLRCQNAINDLLPVL----SRKKTDAIISEARDGQFKLEIVPSTTFEFVNSLTFLDEIQD-RIQVLEEEMQIVVQMYQLIEQFKVPTPPEDLVVYSTLEQSIISVQNTIDKAVGERDGNLEKFCQHLDKDILELNMEVKIVKQRAQDPMILDITSDKTKVREI--LKEQMIATDEFQQQALQYRAYQKNFKVEVTNFDALNEVCDELKRKQMMWDSLDEWEVFTKEWLECQFETLDPEQLNSEVAKYAKIVNQLEKGLPPN----NVVPLLKKKVEFIREKLPVVAFLRNPSLKARHWEMLEEIIGAPLRDKETPLTLAGLIELEVFHYAEQIQDVSGQASGEASLESILKKVEDGWKTAEFVVLPHRDSKDVFILAGTDEIQILLDDSIINISTITSSRYVGPIKSRVDEWQRQLLLFNQTLEEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMQVDKSWKDIMRKIYRLPNALRAATQPGLLDTFKNNNALLEQIQKCLEAYLESKRVVFPRFYFLSNDELLEILAQTRNPQAVQPHLRKCFDAIARLEFALAPAEGEQERTFTNDILAMVSPEGEKVSLGKGL---KARGNVEDWLGKVEEAMFQSLRRLTKMAIGEYQSMPRTEWVVSGLPSQVVLTVAQLMWCRDLTQCLE--GGDHDHLQSVANFEKENFERLNSLACLVRGNLPKIHRCIITALITVDVHARDIVTDMVQEKVETANNFEWQRQLRYYWDLELDNCVARMALSQYVYGYEYLGACPRLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLITIRNAKAAKVPRFMFEGREIKLIQTCAAFITMNPGYAGRTELPDNLKALFRPIAMMVPNYALIAEVILYSEGFESSRVLARKMTQMYKLCSEQLSQQDHYDFGMRAVKSVLVMAGSLKRENPHL-REDVVLIRALRDSNLPKFLADDAMLFSGILSDLFPGVEIPNHDYGSLQSSIENALKARKLQAVPSMVHKVIQLYETMLVRHGVMLVGPTGGGKTTVYTALSDALGSLHEAGESKHNPFYQKVHTTVLNPKSISMGELYGEVNNLTLEWRDGLMALSVR-VAVADDSEDHKWIVCDGPVDALWIENLNTVLDDNKMLCLANSERIKLTPQIHMIFEVQDLKVASPATVSRCGMVYIDSEELKWMPYVQTWMNGIIDK-FGEDTGQYIMALFENYVEDGLRFVNKKCTQAMPQVDISKVTTLSCLLESLLLG-KGGPDLK----MEHSRLTSIVCQT--------FVFCYLWAVGGNLVENCWDQFDTFVKHQ-------FEENHDAKLPSSGD----LWSYYMDYDSKRLDPWERIV-----PNFRYNKEVPFFEMLVPTTDTMRFGYLMEKLLAVKHSVLFTGTTGVGKSVVARGLLDKIQEEAQYVPLYINFSAQTSSTRTQEIIESKLEKKRKNIIGAPGKKRVIIFVDDLNMPKLDRYGSQPPIELLRQYQDFGGFYDREKMFWKEIQDAREDRGAMQPFCAPPGGGRNPVTPRFIRHFSMLCLPSPSEHSLKQIFQAILT-GFLVDFPVAVKQVATNIVEAAVEMYGRMSTELLPTPAKSHYIFNLRDLSKCMQGILQCDSGTVRDQNQIFRLFCHECQRVFHDRLINNEDKDYFNTMLAEMASKQFGVQVEAEYFVKH-------------PILFGDFMKVGVQRADRVYEDLTDVEKLKGVLQDYLDDYNLSSAKEMKLVFFQDAIEHVTRITRMIRQERGNALLVGVGGTGKQSLTRLACHMCGYRCFQIELSRGYSYDTFHEDLRKLYTIAGVEDKDTVFLFTDTQIVIEEFLEDINNILNSGEVPNLFEKDE----LEKVLAATRPKAKEAGIP-EGNRDEVLQFFINRVRARLHIVLCMSPVGDAFRARCRMFPSIVNCCTIDWFVQWPREALLSVSKTFFTPVDLGSDELKENLSEMCVEIHMSVTELAEHYYAELRRRYYTTPTSYLELINLYLSMLGEKRSQLTNSRDRIKNGLTKLLETNELVDKLQLELSALEPVLKQKSEDVEALMEKLATDQENADQVRRVVMEDEAVAKVKAEETQAMAADAQRDLDEALPALQAANRALDSLDRSDISEVRVFTNPPEGVRTVMEAICIVLSKKPD--------------WASAKQLLGDSNFLKRLTDYDKENISEDVIQKLK-VYINNKDFVPEKVERVSKACKSMCMWVRAMDLYSRVLKDVGPKRQRLATAQAELDATMAMLNDKQRRLKQVEDQIGALQDQFDMSVAEKESLAKNMALTQARMSRAGKLTSALGDEQIRWQESVAQFQVEINNVIGNVFIASACVAYYGAFTSHYRQMLIDRWISRCQELGIPINANFSLIGILGDPFEIRQWNTDGLPRDTVSTENGILVTRGRRWPLMIDPQDQANRWIRNKEMKNGLKIIKLTDGNFLRTLENAIRLGMPVLLEELKETLDPALEPILLKQTFVSGGRLLIRLGDSDVDYDKNFRFYMTTKMANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLEKPELEEQRNELIVRINADKNQLKVIEDRILKLLFTSEGNILDNEELIKTLQESKVTSGAIKTRLKEAEATEEMINTAREKYRPVAARGSVMYFVIASLSEIDPMYQYSLKYFKQLFNMTIETSEKRSDLAERLELLLKQTLLATYTNISRGLFEQHKLIFSFMLCIEILRQHGHVSDAEWNLFLRGAAGMDKERPTKPEIGWLAESTWNLCCDLEDHLPCFKGLK 3390          

HSP 2 Score: 602.823 bits (1553), Expect = 4.921e-173
Identity = 305/678 (44.99%), Postives = 443/678 (65.34%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENT-HKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQA-SGEGKSPEDSIQELADDILKKLPENFDLEMIMK----RYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEI-------TSFDNS-----------TDIKV-RPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L    KL++++    +K+V A+  F+ +NLG+ FI+ PP DL + + D +  +PL+FVLS G+DPM A  +F  + GY + ++ +ISLGQGQGPIA K+I++A++ G WV LQNCHLA SWM ++E+I + +  P    H N+RL+L+S P+ +FPV++LQN VK+TNEPPKGLRAN+ R++     +   FF+       W  ++FG+CFFHA++QER+KFGPLGWNI YEFN+SD   ++  + +F  D   +P +AL Y+TGE  YGGRVTD  D+R L ++L+ F++   +E   Y +S SGIYY+  + T Q + +YI +LP+N +PE++G+HENA++    QET  L   IL   PR +  G G S ++ ++ELAD IL KLPE  D+E  M+    R       S+ TVL QE+ RFN L+ V+RS+L  L+KAI G VVM+ E+E+++NS L  +VP  W+  +YPSLKPLG +V DL  R  F   WI+   P +FWISGF+F Q FLTG LQN ARKY +PIDE+GF ++        TS   +            DI++   +DG  V+GLF++ +RWD E+ ++ ++L   +   +P++  +P +    D  S Y  P+YKTSAR GTLSTTGHSTNFV+ + +P+    ++WI++G A LCQL+D
Sbjct: 3441 LSKFQKLVLVKSFMEEKVVFAMTDFVIENLGKAFIENPPVDLATLYQDMSASTPLVFVLSTGSDPMGAFQRFAREMGY-SERVHAISLGQGQGPIAEKLIEEAVKSGDWVFLQNCHLAASWMLAMEEIIKALSEPNAVIHPNYRLFLSSMPTRNFPVTVLQNSVKVTNEPPKGLRANIRRAFTEITPA---FFEKNVLGQNWRKIIFGICFFHAIIQERKKFGPLGWNIHYEFNDSDRECALLNLNLFCQD-GRIPWDALIYITGEITYGGRVTDSWDQRCLRTILKRFFSPKTLEP-GYLYSTSGIYYASEEKTLQDHKDYIENLPLNDDPEIFGMHENANLAFQRQETGTLVKTILEVQPRSSGQGAGTSNDEIVKELADSILAKLPEILDMEGAMESLFTRDEKGRINSLTTVLEQEVDRFNTLLQVIRSSLHTLKKAIAGFVVMSEEMEKIYNSFLNSQVPVLWSDNAYPSLKPLGGWVKDLALRTTFIDAWIKTGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDELGFHYKTLPVYRDQTSVAEAMRTQQFGQELEADIQLPAVQDGVLVHGLFMDASRWDDEDMVMEDALAAQMNPPLPVLHFEPCQNYQPD-PSLYHAPLYKTSARAGTLSTTGHSTNFVVTVFIPSKRDSDYWISKGAALLCQLND 4111          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1796.56 bits (4652), Expect = 0.000e+0
Identity = 977/2106 (46.39%), Postives = 1347/2106 (63.96%), Query Frame = 1
Query:  160 PMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVY-KKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASK-------VKGKIDKFKNHLPVLQVICNPGIQ---ERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAIT--VPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHG-FDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK-VVDEDVRGLIFGDYMTDD-----KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLK 6414
            P++   F N +  +  +    L  SW PR   LF DK            +  ++  ++F   +++L+S QLR+++  ++  +                FD       P   V+L   +  +   PS ++L+  ++     I +S + +P V   L      + + ++T    E ++T      +   + N  GP+ +L  Y  +YG L+N  A   V  F+ E          ++ ++ L  E+  L   +   +  L    L   +  +      LL+   + ++R  N  IC+ ++ +  +  ++P ++E ++ +  ++  A +  +  L ++ +E   R+ FLLD   +  EDI  N+ +  WP  I+  FD     ++  + + E +L  R  +    L+++++ ++ F   E   ++ + + V  +  +  ++ D  D +  +NKEE +  WE + +P +  +   LDP+ +L+   L +      W+ G F ELN  T+  ++ E  + M+K +K F      QK A +        K + D  +  +   Q   +P +Q   +RHW QMS+++  DI P   ++L   L   L  +L+K E+I AAA+KE+ LEK L  M E W  + F   +YR++GVSILS++D+IQ  LDD I+K+QTM+GS FIKPFE E+K+WE++LV + + +D WLKVQA WLYLEPIFSS+DI+ QMPEEGR F  VD  W+EVM    ++P  LVAT    +L++L + N LL++I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI RL F   L+I  M S+EGE + +V ++  ++A+G VEKWLLQVE+VM+ SV+ VI  +  +Y  T+R  WV +WPGQ+VICVS ++WT EV EAI      GL++Y  +   Q+ DIV+LVRG+L+   R+TLGAL  IDVHARDVV +M    VS+   F+WL+QLRYY    +V V  ++  + Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AM KFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   +  F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F  A ++  ++  +Q  + F+DK++Q YEM++VRHG M+VGEPF GKT+  Q LA  LT ++  G   E +V    +NPKAITMGQL+GQFDPVSHEWTDG++A  FREFA +    RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQMS  M+LIFE  DL QASPATVSRCGMIYMEP+QLGW+P ++S++    P    ED+  L+++LF WL+ P L  +R  CK L           + KL+ +   ++      +E  +        + A +IY  LQ  F FS VWS+G+S    GR KFD F REL  G +  +P P ++   +     ER  +YD+ +E K  G+W  W   I    +      K+ +II+PT +TAR TY +DL + H +P++ VGPTGTGKSV I N L+  L K+RYL   +NFSA+TSANQTQ+IIM+KLD+RRKGV+GPP  KR V+FVDD+NMPA EK+GAQPPIELLRQ+ DHG+W+D KDTSK+ L D  LL+AMGPPGGGRN V++R +RHFN+  +N F+D TM+ IF++++ ++  +  F   F  +G  +VS+T+ VYKKA+ + LPTP KSHY FNLRDFSRVI+GVLL+          ++RL+VHEVYRVF+DRL  ++DR   + + +    D FK + + +   L   G+ +  ED+R L+FGDYM  D     ++Y E+ S++  +  +E  L++YN   K  M+LV+F + +EH+SR+ RVLKQ  GHALLVG+GGSGRQS TR+A  M+   +F  EI+++YG  EWR+D+K
Sbjct:  240 PLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADK----------HKSTEADSTESFHGCVSTLLSNQLRDLIVRTIEAYVRL-------------FDLADGRALPHFRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETIKVQT---PEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFA--ECSELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQR---QKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQMCRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPN-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKML-----------MLKLWLNTRTQLCPSDITKERYSNAPESCIFMHANSIYS-LQASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWEC-PLEERGLVYDYMYELKGRGHWVHWNELIKNPHLG-DKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2299          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1784.23 bits (4620), Expect = 0.000e+0
Identity = 973/2119 (45.92%), Postives = 1348/2119 (63.61%), Query Frame = 1
Query:  160 PMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVY-KKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFN------------DNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAIT--VPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGL-----------FLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHG-FDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK-VVDEDVRGLIFGDYMTDD-----KIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLK 6414
            P++   F N +  +  +    L  SW PR   LF DK            +  ++  ++F   +++L+S QLR+++  ++  +                FD       P   V+L   +  +   PS ++L+  ++     I +S + +P V   L      + + ++T    E ++T      +   + N  GP+ +L  Y  +YG L+N  A   V  F+ E          ++ ++ L  E+  L   +   +  L    L   +  +      LL+   + ++R  N  IC+ ++ +  +  ++P ++E ++ +  ++  A +  +  L ++ +E   R+ FLLD   +  EDI  N+ +  WP  I+  FD     ++  + + E +L  R  +    L+++++ ++ F   E   ++ + + V  +  +  ++ D  D +  +NKEE +  WE + +P +  +   LDP+ +L+   L +      W+ G F ELN  T+  ++ E  + M+K +K F             D P  ++  S      +  +   P +Q +C+  I++RHW QMS+++  DI P   ++L   L   L  +L+K E+I AAA+KE+ LEK L  M E W  + F   +YR++GVSILS++D+IQ  LDD I+K+QTM+GS FIKPFE E+K+WE++LV + + +D WLKVQA WLYLEPIFSS+DI+ QMPEEGR F  VD  W+EVM    ++P  LVAT    +L++L + N LL++I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI RL F   L+I  M S+EGE + +V ++  ++A+G VEKWLLQVE+VM+ SV+ VI  +  +Y  T+R  WV +WPGQ+VICVS ++WT EV EAI      GL++Y  +   Q+ DIV+LVRG+L+   R+TLGAL  IDVHARDVV +M    VS+   F+WL+QLRYY    +V V  ++  + Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AM KFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   +  F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F  A ++  ++  +Q  + F+DK++Q YEM++VRHG M+VGEPF GKT+  Q LA  LT ++  G   E +V    +NPKAITMGQL+GQFDPVSHEWTDG++A  FREFA +    RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQMS  M+LIFE  DL QASPATVSRCGMIYMEP+QLGW+P ++S++    P    ED+  L+++LF WL+ P L  +R  CK + E       ++L + F   L                D  +  +  + +++ ++ L           F FS VWS+G+S    GR KFD F REL  G +  +P P ++   +     ER  +YD+ +E K  G+W  W   I    +      K+ +II+PT +TAR TY +DL + H +P++ VGPTGTGKSV I N L+  L K+RYL   +NFSA+TSANQTQ+IIM+KLD+RRKGV+GPP  KR V+FVDD+NMPA EK+GAQPPIELLRQ+ DHG+W+D KDTSK+ L D  LL+AMGPPGGGRN V++R +RHFN+  +N F+D TM+ IF++++ ++  +  F   F  +G  +VS+T+ VYKKA+ + LPTP KSHY FNLRDFSRVI+GVLL+          ++RL+VHEVYRVF+DRL  ++DR   + + +    D FK + + +   L   G+ +  ED+R L+FGDYM  D     ++Y E+ S++  +  +E  L++YN   K  M+LV+F + +EH+SR+ RVLKQ  GHALLVG+GGSGRQS TR+A  M+   +F  EI+++YG  EWR+D+K
Sbjct:  238 PLELTAFSNNVTLQLEKGEEKLMHSWFPRVVSLFADK----------HKSTEADSTESFHGCVSTLLSNQLRDLIVRTIEAYVRL-------------FDLADGRALPHFRVQLTFDDESMESYPSSEDLRGAVLAVAAQIGRSLQAVPMVHAWLAGSSSPETIKVQT---PEDVLTRASAALLHAVQANMQGPQEHLQSYIDRYGWLVNGTAMERVHTFISEDRSFDECATLVEEFRALVRELQGLPSVLHFPMVRLVCSELKQGLMDKARGFINLLLDKLLNQHRAHNAMICQAFEVMRQRCLKVPENSEEMIELGSYVDNARSKGIADLNDKIQECYRRMSFLLDVHILSPEDIAFNSQVLCWPREIAPAFDRNEELMEVAQRKGESELLARRERLLLELDKLSRRVDGFA--ECSELDMIAQYVSDMRMIGKRLQDADDTITFINKEEVLYKWELTSYPEVDAIRTKLDPFQKLFTLILRWQRAEKKWMDGSFLELNGETMATELEEFFREMYKHLKFFQQRQKKAEQERQRDAPRKKRGDSAEAEMEEAQEQSDPSVQ-MCS--IRDRHWVQMSEVVENDITPDSGTTLRKVLKQNLIPYLDKFEQISAAASKEYSLEKALHTMVETWDTIAFTTLQYRETGVSILSSVDEIQSTLDDQIVKTQTMRGSAFIKPFETEIKVWEERLVRIQETLDEWLKVQAQWLYLEPIFSSQDIMQQMPEEGRLFQTVDRNWREVMKFCTRDPKVLVATSMTGLLEKLQNCNGLLDKIMKGLNAYLEKKRLFFPRFFFLSNDEMLEILSETKDPLRVQPHLKKCFEGIARLGFLPNLDIGAMFSSEGERVELVERVSTSEARGAVEKWLLQVEDVMLRSVRDVIVRARTAYANTQRKDWVREWPGQVVICVSQMFWTTEVHEAIKGGPQQGLREYSERLQDQLKDIVELVRGDLSKQTRVTLGALVTIDVHARDVVFDMIDKGVSNETDFQWLAQLRYYWESEQVRVRIVNCNVKYAYEYLGNSPRLVITPLTDRCYRTLVGAFYLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMSKFFKGLASSGAWACFDEFNRIELEVLSVVAQQILCIQRAIQTKMVTFAFEGTELVLNPNCFVAITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSVKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLIAAGNLKLKFPN-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGITLPAADYTLFLEAARECCSRHNVQPVKVFLDKLIQTYEMMIVRHGFMLVGEPFAGKTKVLQVLADTLTLMSERGQGGEERVQLRTVNPKAITMGQLFGQFDPVSHEWTDGIVANTFREFASSDTPDRKWVVFDGPIDTLWIESMNTVLDDCLQLCLMSGEIIQMSQPMSLIFEAMDLSQASPATVSRCGMIYMEPSQLGWQPLVQSWLGTLPPTLQQEDNRDLLQELFTWLVAPSLRMVRKQCKDIHEKE-----LRLSEAFTKALI------------VSVDCRLSGLCLKGLWVSVEALLVLLMLKLWASFAFSLVWSVGASCDSDGRVKFDSFLRELLTGKSKDHPLPPTVGKWEC-PLEERGLVYDYMYELKGRGHWVHWNELIKNPHLG-DKGTKVQDIIVPTIDTARYTYLMDLCIQHSRPLLFVGPTGTGKSVYIKNKLMNNLDKERYLPFFVNFSAQTSANQTQNIIMSKLDKRRKGVFGPPMGKRSVIFVDDMNMPALEKFGAQPPIELLRQFFDHGNWYDLKDTSKIRLEDLQLLAAMGPPGGGRNAVTARFLRHFNICTINSFSDETMVHIFSSVMAFYLRNNDFPPEFFSVGNQIVSATLEVYKKAMQNLLPTPTKSHYTFNLRDFSRVIQGVLLLRREAADGRRSMLRLFVHEVYRVFHDRLVDDQDRRWLYGLSRDLLRDHFKESFDAVFEDLKEEGRPLCQEDMRKLMFGDYMNPDLMDEERLYAEVPSVQQFSSVVEQCLEEYNQTHKNRMNLVIFGYVLEHLSRISRVLKQPGGHALLVGVGGSGRQSLTRLATAMSGMALFQPEISKSYGHTEWREDVK 2305          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004701.1 (pep scaffold:Pmarinus_7.0:GL479445:9390:42654:-1 gene:ENSPMAG00000004281.1 transcript:ENSPMAT00000004701.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1451.8 bits (3757), Expect = 0.000e+0
Identity = 700/1097 (63.81%), Postives = 868/1097 (79.12%), Query Frame = 1
Query: 3433 IELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLG--NGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSP 6708
            +++EVLSVVAQQI SIQ AI + LKRF+FEGTELSLN TC +FITMNPGYAGR ELPDNLKVLFR+VAMMVPDYALIGEISLYSMGF+D+R+L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAG+L+ + P+ E+ES+LLL+A+ DVNL KFL+QD+PLF+GIISDLFPGV LPK D+D+F  A+ +N+ K  LQ   WFI+KI+QIYEM+LVRHG MIVG+P  GKT AY+ LA AL D+ A+G M E+ V+Y +INPK+ITMGQLYG FDP SHEWTDGVLA  FRE A A    R+W++FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMS KMNLIFEPADLEQASPATVSRCGMIYMEP QLGWRP  +S++E  LP  L ++H +L+ DLFEWL+ PCLDFIR +C+ L++TS IH    L +L+  LLDE+             +   + +S+Q + +WLQGLFLF+ VW++G ++    R KFD F+R L  G +  +P+PKS+KLTK++ FPER T+YD+ F K+  G W  W ++I  + + I P AK++++IIPT ETARQTYFL  ++ H    + VGPTGTGKS +  +YL+ LPK+ ++   +NFSARTSA QTQDI+M KLDRRRKG++GPP  KR V+FVDDLNMPAKE YGAQPPIELLRQWIDHGHW+DKKDTS+L ++D L +SAMGPPGGGRND++ R  RH N+L ++ F+D TM +IF +IVDWHF  GF+  F RLG+++V +TM VYK A+ +FLPTP+KSHYVFNLRDF+RVI+GVLL P T+L   +GE+L+RLW+HEVYRVFYDRL    DR  FFD+V+ TT+  FK +++K+L HL+ +GK+ DE VRGL FGDY     D + Y EI  LK L   ME +L++YN++SKAPM LV+F+FA+EH+SRV RVL QD GHALLVGIGGSGR+S  R+AAFMA  ++F IE+TR YG  EWR+DLKR+  KAG D KP VFLFSD QIK E F+ED++MLLN GDVPN+  +DE+AEI+E+MQ  AR+E    GRK+D+TP+AMYNYF+ERV+ NLHIVL   P
Sbjct:    1 VQVEVLSVVAQQILSIQQAIVRNLKRFIFEGTELSLNATCAVFITMNPGYAGRAELPDNLKVLFRTVAMMVPDYALIGEISLYSMGFIDSRSLSHKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGSLKLRYPE-ESESVLLLRALIDVNLAKFLAQDVPLFQGIISDLFPGVVLPKPDYDVFVRALNENIAKLNLQPVPWFIEKIIQIYEMMLVRHGFMIVGDPLAGKTSAYKVLAGALGDLFAEGAMDEFAVEYRVINPKSITMGQLYGCFDPASHEWTDGVLANAFREQASATGPERRWIVFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSQKMNLIFEPADLEQASPATVSRCGMIYMEPHQLGWRPLKDSYME-TLPSSLTDEHRELVGDLFEWLVQPCLDFIRSDCRFLVQTSPIHLAYSLMRLYSCLLDEL---------SAPREGSKEALSSQQVTMWLQGLFLFALVWTVGGTINGESRRKFDAFYRNLLMGQDDSHPRPKSVKLTKNSVFPERGTVYDYYFLKQGNGQWNVWTDSIQADQLVIPPGAKVSDLIIPTMETARQTYFLKTYVEHGVASLFVGPTGTGKSAIAGSYLLGLPKESFIPTVVNFSARTSAAQTQDIVMAKLDRRRKGIFGPPIGKRAVLFVDDLNMPAKEVYGAQPPIELLRQWIDHGHWYDKKDTSRLDIVDVLFVSAMGPPGGGRNDITGRFTRHLNILSIDSFDDETMTKIFNSIVDWHFGKGFEASFLRLGRMMVQATMGVYKAAVENFLPTPSKSHYVFNLRDFARVIRGVLLCPQTHLQYEDGERLVRLWIHEVYRVFYDRLIDGGDRATFFDVVRETTSSYFKQSVDKVLSHLTPTGKLADEHVRGLFFGDYAQPDADPRPYQEIADLKKLTSLMEHYLEEYNNVSKAPMPLVLFKFAIEHVSRVSRVLAQDGGHALLVGIGGSGRRSVARLAAFMAGQDLFQIELTRGYGATEWREDLKRVTRKAGVDGKPTVFLFSDTQIKDEGFVEDVNMLLNAGDVPNMLAADERAEIVERMQAVARLE----GRKVDATPLAMYNYFVERVRANLHIVLGKRP 1082          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 659/2612 (25.23%), Postives = 1210/2612 (46.32%), Query Frame = 1
Query: 1549 LATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKL---IKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGF-----DIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSE-DILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCL--VATGQRDMLKRLT-DSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGR----WVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIV-KLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRG------GEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFR----EFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLD--EIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSF----VWSIGSSLL------ESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSF---PERLTIYDFCFEKKSGGNWQEWVNTIDRESMSI-SPDAKINEIIIPTGETAR-QTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRR------RKGVYGPPPE--KRCVVFVDDLNMPAKEKYGAQPPIELLRQWID-HGHWFDKKDTSKLHLIDTL-LLSAMGPPGG-GRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGV--FNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEK-----LMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMD-------ENTREAIVIMCKFYHESVRQLSEEFLNTLRRY------------NYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSAD-SVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDN-GIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLF-LMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTM 9132
            L  +++ +  Y  +WR+  +         + P+  ++ L +++D+    +   +L   +KQF       ++   +  +++   +   +L  + +  ++ RHW+ +   IG      ++    E SL D +   L  +   L +I   A KE  +EK+L ++K+ WKE ++E+ E+  SG+ ++   D ++    + + +  +MK S + K FE++    E KL  +++I   W++VQ  WL L  I     DI   +P E  KF  +   +K +   + +  + +  +     D   +LT DS   L+ I+  L+ +LE++R  FPRF+FL ND+LL+I+   K   +V   +KK F  I  + F E   I G+ S EGE L++  KI   K     ++WL  ++  +  SV     D +      K G      V  +  Q ++  + + WT E+ E     N    Y  + + +I  ++ KL + +    ++I   AL V  +H  +V+  +            W    ++Y +         V++ Q    L Y  EY+G   RL+ TPL    + TL  +L    GG   GPAGTGKTET K   + + +  VVFNC D  DY+ + +   G+ Q GAW CFDEFNR++ +VLS V+  IQ IQ  +  G         E  L+P   +FIT+NPGY GR ELP+NLK  FR  +M  P    I E+ L  MGF D+++LASKIV    L S + SS +HY +G+R +K VL     L  +  + E     +++++  V LP     D  +F+  +S +F     P  +       +KD   +     +E F+ K +Q Y M   +  L++VG+   GKT  ++T+  A+        +        +I+ K +T   LYG     + EW DG+   + R    +      + R W++FD  +D  ++E MN+VLDDNK L L +GE + +     ++FE  +L+  +PAT++RCG+++               I  ++   LN+ +  L   L  + +D   D I          S+  D+  L  +F    D   I    +  + ET     V +IS+     W Q L   S        I  SLL       +G S+     R     IN  Y    S +L+  ++     ++L+   FC E          + ++  E+  +  PD     I+IPT +T + +  F DL L  ++ +I+ GP G+GK++++NN L       Y    INFS  T    T + I++ L R        KG+   P    K  V+F D++N+P  +KYG+Q  +  LRQ ++  G W  K   +K   I+ + ++ A  PP   GR  +S R  RH  +L +   +  ++ +I+    + +++  F  V  F    +    +++++Y +  A +  T  +SHY+F+ R+ +R+++GV    +T +  G +     L+RLW +E +R+F DRL   +++  F  ++   T D +  N +  LG++S +  +    +          D K  ++   +  + +R +TF D+     +  + +V+ +  ++HI R+ R LKQ  GH +L+G   +G+   TR  A++   +I   +I R+   +++   LK+ +            +  ++ I + +F+E ++ LL   D+P+L+  +E  ++L  ++N  R      G  +D T   +Y++F+  + +NLH+V  +    +   + +   P+L N C I+W   W    +  VAN  ++ I M+       E  +E +      + E ++ + +  +N L  +            N  +P  +++ ++   KL+  K  +L   +     GLEKL  +  +V ++   L     EL     +    L K+  +  E E K+E     ++   V+  + ++ K+     + +  P + +A   +  +K+  +T +RSM NPP  +K+VMEAVC +LG +                W    + +    F+  + ++     + PQ  K + E+++ +P+F  + +  AS AC  L +W+ A   +    + V P + ++   E E   T   L   +    ++EA ++    +     +  + ++  +      LDR+  L+  L  EK RW    K  S+    + G+ ++S+    Y G      R  ++    +   +  +    +++ +D L    +   W   GL  + + ++N  I++N+ +  P  +DP       I N    N+  ++   +  FV+ LEN+I+FG+ V++++ GE  +PI+  ++ +          + +GD+ ++ + DFK +I +   +      + ++V L++F+   + +E ++  I   +E  E++ K+  LI  + + K KLK LE ++LE L++SQGN+LEN+  +  L++ K  +  I +K + +E    + D     Y  +  H   +F  +         Y  S+  F++ F  + I+ S ++    TR++ +       VY     +L +  K++ ++TM
Sbjct: 1221 LTHVVEEVKTYDLVWRSIKNLWEDVQRTFETPWCRVDVLLLQSDLANFLRRADELPRAVKQF-------EMYKSLFSQVNMLTSVNKILVELKDGALKPRHWNMIFRDIGKRQIQKNLLDKLEFSLKDVMVLNLTLNEILLTKIIERAQKEFVIEKSLNRIKKFWKEAQYEVIEH-SSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQVNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDS---LKMIKSSLSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDF-ITGVRSVEGEVLNLNEKI-ELKDSIQAQEWLNILDTEIKLSVFTQFRDCLGQL---KDGTDIEVVVSKYIFQAILLSAQVMWT-ELVEKCLQTNQFSKYWKEVDMKIKGLLDKLNKSSDNVKKKIE--ALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGAWGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKT---VVESLKRVILPSLGDTDELVFKDELSKIFDSAGTP-LNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANV------VYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCS--------ISSKIDHLLNKSYEALDNKLSMFELDKLKDLI----------SDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYR--QWFQNLDDKSLKDVITLLIKRSLLYALAGDSTGESQ-----RAFIQTINT-YFGHDSQELSDYSTIVIANDKLSFSSFCSE----------IPSVSLEAHEVMRPD-----IVIPTIDTIKHEKIFYDL-LNSKRGIILCGPPGSGKTMIMNNALRN--SSLYDVVGINFSKDT----TTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLVLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFW--KTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPSGKSLSQIY----EIYYKAIFKLVPEFRSYTEPFARASVHLYNECKARY-STGLQSHYLFSPRELTRLVRGV----YTAINTGPRQTLRSLIRLWAYEAWRIFADRLVGVKEKNSFEQLL-YETVDKYLPNQD--LGNISSTSLLFSGLL--------SLDFKEVNKTDLVNFIEERFKTFCDE-----ELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTR----SLGLLLD-TEQELYDWFVGEIAKNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELV------FTEPIQTIRDAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLSKKSTELTEKEKEARSTLDKMLMEQNESERKQEATEEIKKILKVQEEDIRKRKEVVMKSIQDIEPTILEAQRGVKNIKKQQLTEIRSMVNPPSGVKIVMEAVCAILGYQFSN-------------WRDIQQFIRKDDFIHNIVHYDTTLHMKPQIRKYMEEEFLSDPNFTYETINRASKACGPLYQWVNAQINFSKVLENVDPLRQEMKRIEFESLKTKANLLAAEEMTQDLEASIEVSKRKYSLLIRDVEAIKTEMSNVQANLDRSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNY-YGNKTVLLSFLEEGFVKRLENAIRFGSVVIIQD-GEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALDKKFKMIMAMTM 3702          

HSP 2 Score: 68.1662 bits (165), Expect = 2.968e-11
Identity = 53/205 (25.85%), Postives = 96/205 (46.83%), Query Frame = 2
Query: 9683 AAKMIDQAIQDGTWVVLQNCHLATSWMKS-LEKICEEIIIPENTHKNFRLWLTSYPSED-FPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISD---NKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFL--NDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISL-LQIFYNAD 10273
            A + I ++  +G W++LQN  ++ SW+K+ L K  EE    E  H+ F++++T + + D  P  +LQ   +   E   G+          D + D   ++FF G           F L +FHAL+  R +  P G++  Y FN+ D + +   ++  L  N    +P   +        YGG++ ++KD  ++  L   +F  +D
Sbjct: 3825 AQEEISKSKIEGGWILLQNIQMSLSWVKTYLHKHVEETKAAEE-HEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGIL---------DTVKDLWGSQFFTGKISGVWSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLCAHVFCGSD 4019          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 3867.39 bits (10028), Expect = 0.000e+0
Identity = 1933/3121 (61.94%), Postives = 2411/3121 (77.25%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFT----DTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKK-------------------------IDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSG-KVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F   RF++ NEL++ GLP+ P +FE ++ ++C      LK +W+P CA L    R+ WS+L+P     ++  V+ FF+ +++LMS QLR+MV  SL DF +F+  +++GN+FG  + +L++        L +    +  P+  +                    +     +VE  LFP+MR +RL LR+V   E LV  Y+D  +  FK NTVGP+ YLN YKKY +LLNNKAE +V+AFL++   LLAL KK                         ID +Q L  E++ L ++VPL++  L+ + +N ++  R  KL + ++ + V++NR+ NR ICR+YD++++KV E+P +T+ LV + +FL +AST  V +L+   ++A ERL+FLLDYAT+PYEDIKLN+T+FHWP HI  +F+++ NRI +R++   +DL+ R+  +EE+L    K +E F+KKE+M  EEM++NV+ LDEL   +D  +D+L  LN EE +L WE +QFP+L +M+   +PY +LWRTAL+F  K++ WL GPF E+NA  +E +I  M + + KL K F D+P  ++VA  V+ KIDKFK HLP+LQVICNPGI+ERHW QMS+++GFDIKP   +SL + L Y LHKHL++LEEI  +A+KE  LEK + KMK +W +M FE   YRD+GVSILSA+DDIQMLLDDHI+K+QTM GSPFIKPFE E+K W +KL+ M DIID WLK QATWLYLEPIFSSEDI+AQMPEEGRKFGIVD  WK++M ESVK+   LVATGQ +ML RL +SN LLEEIQKGLN YLEKK+L+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI RLEFTE+ E++GM+SAE ET+   TKI PAKAKGMVEKWL+QVE VM++S+KKV  D++ +YV T RG+WV +WPGQ                         +YL K N QID+IV LVRG L  G R+TLGALTVIDVHARDV   MA   V S+  F+WLSQLRYY     V V  I+T + YG EYLGN+ RLVITPLTDRCYR           GAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLD+KAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQI +IQ AIA+  K+F+FEGTEL LNPTCTMFITMNPGYAGRQELPDNLKVLFR+VAMMVPDYALI EISLYSMGF++AR+LA KIVATY LCSEQLSSQ HYDYGMRAVKSVLTAAGNL+ + PD ++E+ L+L+A+ +VNL KFLSQD+PLFEGIISDLFPG   P  D+ +   ++++N ++R LQ  +W++ KI+Q+YEM++VRHG MIVG+P GGKT A++ L+ A+TD+   G   + KV Y IINPK+ITMGQLYG FDPVSHEW+DGVLA  FR+FA +  + RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNK +LIFEPADLEQASPATVSRCGMIYMEP QLGW+P MES++   LP  L+++H + +R LF+WL++PCL+FIRH+CK  + +S++H V   Q+L+  L+DEIR Q   E A+         +S+Q I  WL GL++FS VWSIG +L    R KFD FFR L  G +  +PKPK IK++K N FP+R T+YD+ F K++ G+W  W+    +    I   AK +E+ I T +TARQ +FL+ FLTHE P++ VGPTGTGKS + N+YLV+LPK++YL  NINFSARTSA QTQDIIM KLDRRRKGVYGPPP K+CV+FVDDLNMPAKEKYGAQPPIELLRQ +DHGHW+D KDTSKL L+D L +SAMGPPGGGRND++ R +RH NV+ ++ F+DNTM +IFT+I DWHF  GFD  F RLGK++V +TM VYK A+  FLPTP+KSHYVFNLRDF+RV+ G LLVP T+L  G+KL+RLW+HEVYRVFYDRL  + DR  FF+++K T    FK  +++++GHL  +G K+ DE +R L FGDYM   + DKIYDE++ LK L  +ME +LD+YN +SK PMSLVMF+FA+EHISRV RVLKQDNGH LLVGIGGSGRQSATR+A FMAD+++F IEIT+NY + EWRDDLK++LIKAG D KP VFLFSDNQIK+ESF+EDI+M+LNTGDVPN++ +DEKA+++EKMQ  AR+E    G+KID+TP+AMYN+FI+RV+ NLH+VLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLE++++    ++  V MCK++HESVR LSE +  TLRR+NYVTPTSYLELI TFK LL+ KRNE++ LKNRYLTGLEKLEFA+ +V  MQ EL  LQPELI TSA+T+KL+ K+EQDTVEVEAK+EI+AA++  AN  A  +Q IK++CE DLAEA+P L  A+ +LDTLK +DI++V+SMKNPP  +KLVMEAVCIM   KPERKPD S +G+MIEDYW SS K+LGD KFLD LK +  D++    +KK+REKY+  P+F+P  +R  S+ACEGLCKW+ A++ YD  AK+VAPKK KLA AE EL I +++L  K+A+L EV  KLQ L D+ D    +KKELE NI+LC KKLDRAE+LIGGLGGEK RWTE A++L +R++ +TGDVL+S+  VAYLG FTV FRN  ++GW K+C    IPCSESF +   LG+ VKIRAWNI GLPVD+FS+DNGIIV+N+ RWPL IDPQGQANKWIKNMEK N+LS+IKL+D N+VRTLENSI FGTPVLLEN+GE+L+PILEP+L K  F+Q GV+YL+LG+N IEY++DFKFY+TTRLRNPHYLPEIS KV LLNFMITP GLEDQLLGIVAAKEKPELEEKKN LI+ESA NK++LKE+ED+ILEVLSSS+GNILE+ETAI VLSSSK+LS+EIS KQ IA  T+ EID+TRNGYKPVA H S+LFFCISD+A+I+PMYQYSL WFINL+L SI NSE+S +L  RIE+LNDHFT S+Y N+CRSLFE  KLLFS  + I +LKG+NKV+D++WRFLLTGGVALDNPYPNP P W+ DK WSE+VRAS+LP++KGL++   N    WK  YDS +P+
Sbjct:  313 FAQSRFVDGNELLASGLPVSPSEFEELVVKQCARTREFLKKTWIPACANLLYSGRSHWSYLVPGNEGESTVLVQQFFSCVSALMSIQLRSMVINSLKDFVDFLNHYQDGNDFGESYSDLRYVMGEHSVDLTVGWWALPSPQTPFD----------------YPHARTGTRQVETELFPDMRDKRLPLRSVAVEEMLVQDYMDRAVDVFKLNTVGPQKYLNTYKKYQDLLNNKAETDVQAFLQDDPVLLALAKKHTHWLPLSTFVTKLKRIFLIGDFQKIDEFQSLSREIASLHLTVPLNMLCLNCQEVNQELSLRASKLADTMIHYVVDQNRDKNRGICRQYDEVSDKVQEMPDNTKDLVTLTQFLEKASTVMVVQLQSHVDDAGERLLFLLDYATLPYEDIKLNSTVFHWPEHIQKIFELSKNRIGHRKDLAMDDLKHRVKMYEEKLNGYNKEVEAFRKKEIMAAEEMKKNVEKLDELGTALDAARDELMDLNTEEELLQWEPTQFPILQSMMAYKEPYEKLWRTALNFQNKHEAWLNGPFVEINAEDVEEEIGGMFRTVIKLSKTFGDSPAPRRVAESVRSKIDKFKVHLPLLQVICNPGIRERHWTQMSEVVGFDIKPEASTSLCNMLEYNLHKHLDRLEEISGSASKEFGLEKAMEKMKVEWNDMFFEFVPYRDTGVSILSAVDDIQMLLDDHIVKAQTMSGSPFIKPFEAEIKSWCEKLILMQDIIDAWLKCQATWLYLEPIFSSEDIMAQMPEEGRKFGIVDSYWKDIMTESVKDTKVLVATGQPNMLGRLQESNQLLEEIQKGLNAYLEKKQLFFPRFFFLSNDELLEILSETKDPLRVQPHLKKCFEGIARLEFTEEQEVVGMVSAENETVPFSTKIVPAKAKGMVEKWLIQVEEVMMDSLKKVAGDAVAAYVNTVRGKWVQEWPGQ-------------------------EYLEKSNKQIDEIVALVRGKLDPGVRVTLGALTVIDVHARDVTAQMAHDGVHSLEDFQWLSQLRYYFEEKRVIVRMITTSINYGYEYLGNSGRLVITPLTDRCYRH----------GAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDFKAMGKFFKGLAQAGAWACFDEFNRIELEVLSVVAQQIHTIQKAIAEHKKKFIFEGTELVLNPTCTMFITMNPGYAGRQELPDNLKVLFRTVAMMVPDYALISEISLYSMGFLNARSLAQKIVATYTLCSEQLSSQSHYDYGMRAVKSVLTAAGNLKLRYPD-DDEAELMLRAVLEVNLAKFLSQDVPLFEGIISDLFPGTKWPNPDYGVLMDSLRENCSRRNLQATDWYMKKIIQVYEMMIVRHGFMIVGDPLGGKTMAFKVLSEAMTDLNKAGYPFQ-KVIYKIINPKSITMGQLYGCFDPVSHEWSDGVLANSFRDFASSTTEDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKQSLIFEPADLEQASPATVSRCGMIYMEPYQLGWKPLMESYLN-TLPESLSKEHRETVRLLFDWLMEPCLNFIRHDCKFFLTSSDMHLVTCFQRLYSCLMDEIRAQDHAEGADR--------MSSQQITNWLMGLYIFSMVWSIGGTLNGDSRKKFDAFFRLLISGTDKDHPKPKEIKMSKQNVFPDRGTVYDYYFVKQASGSWGNWIELTHKGKSVIPKTAKASELTIETDDTARQIFFLETFLTHEVPMLFVGPTGTGKSAITNSYLVKLPKEKYLPVNINFSARTSAGQTQDIIMGKLDRRRKGVYGPPPGKKCVMFVDDLNMPAKEKYGAQPPIELLRQLLDHGHWYDPKDTSKLELLDLLFVSAMGPPGGGRNDITGRFVRHANVISIDSFDDNTMNKIFTSIADWHFAKGFDATFQRLGKIVVMATMQVYKSAVDKFLPTPSKSHYVFNLRDFARVMFGTLLVPSTHLNEGDKLIRLWIHEVYRVFYDRLIDDTDRQMFFEVIKDTIKQQFKLEMDRLVGHLVPTGQKLKDEHIRNLFFGDYMAPESPDKIYDEVSDLKALTTQMEAYLDEYNQMSKTPMSLVMFKFAIEHISRVSRVLKQDNGHCLLVGIGGSGRQSATRLATFMADYDLFQIEITKNYTKTEWRDDLKKMLIKAGVDGKPTVFLFSDNQIKEESFVEDINMILNTGDVPNIFAADEKADVIEKMQTVARVE----GKKIDATPLAMYNFFIDRVRCNLHVVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEEVDISLEVKKQCVFMCKYFHESVRMLSERYYETLRRHNYVTPTSYLELIMTFKTLLDIKRNEILALKNRYLTGLEKLEFAASQVSVMQKELSDLQPELIQTSAETEKLMVKIEQDTVEVEAKKEIVAADEAVANEAAGVAQGIKEECEGDLAEALPALEAALKALDTLKPSDISMVKSMKNPPGAVKLVMEAVCIMKSVKPERKPDPSGSGRMIEDYWGSSQKILGDMKFLDSLKAYDKDNIPVPVMKKIREKYVTNPEFNPDNIRTVSSACEGLCKWVRAMEVYDRVAKVVAPKKEKLAAAEAELAIQMEKLNLKRAELKEVADKLQALNDEFDAMTTKKKELEANIDLCEKKLDRAEKLIGGLGGEKERWTETARLLEDRFFKVTGDVLLSSGEVAYLGPFTVDFRNECIDGWVKECTTRKIPCSESFSLNATLGDAVKIRAWNICGLPVDAFSVDNGIIVDNARRWPLMIDPQGQANKWIKNMEKENKLSVIKLSDANYVRTLENSITFGTPVLLENIGEDLDPILEPLLLKQTFKQGGVEYLKLGENSIEYSRDFKFYMTTRLRNPHYLPEISVKVTLLNFMITPLGLEDQLLGIVAAKEKPELEEKKNELILESAHNKKQLKEIEDKILEVLSSSEGNILEDETAIKVLSSSKVLSEEISAKQEIATATEKEIDETRNGYKPVATHSSVLFFCISDLASIEPMYQYSLTWFINLYLQSILNSERSPELSERIEFLNDHFTQSIYSNVCRSLFEKDKLLFSFILTIGILKGRNKVDDQVWRFLLTGGVALDNPYPNPCPEWLGDKNWSEIVRASDLPNLKGLKDDLAN--PGWKKFYDSSTPQ 3365          

HSP 2 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 432/660 (65.45%), Postives = 514/660 (77.88%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            +PD + LL GLD+++VLRC+RPDKIVPAVQ FI +N+G+++I+PP F+L  S++DS+CC+PLIFVLSPGADPM  LLKF  D+G+  ++I +ISLGQGQGPIAA MIDQA++ GTWVVLQNCHLATSWM  LEKICEE+I P++TH++FRLWLTSYPS DFPVSILQNGVKMTNEPPKGLR+N+LRSYLNDPISD++FF  CN  + W  +LFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRIS+RQ+QMFLNDY E+PL+ALTYL G+CNYGGRVTDDKDRRLL+ LL I    DIV+ EK                                      H+N            LF  ILLTLPRQ+ G GKSP + I+ELA DIL K P  FDLEM++K+YPV+Y++SMNTVLRQELIRFN+L +VV STL NLQKAIKGLVVM+ ELE+VFN+ML+GKVP  WAAKSYPSLKPLGSYV DL+ RL FF DWI++  P+ FW+SGFYFTQSFLTG  QNFARKYTIPID VGFEF +   +   D K  PEDG  V GLFLEGARWD+E  ++ ESLPKILF+++P++W+ P +         Y CPVYKTSARRGTLSTTGHSTNFV+ +DLP++ ++ HW+NRGVA LCQLDD
Sbjct: 3369 MPDPWDLLSGLDRMVVLRCLRPDKIVPAVQDFIVENMGRSYIEPPTFNLQLSYDDSHCCAPLIFVLSPGADPMAGLLKFANDKGFGGNRIQTISLGQGQGPIAAGMIDQALKKGTWVVLQNCHLATSWMPKLEKICEEVINPDDTHQDFRLWLTSYPSPDFPVSILQNGVKMTNEPPKGLRSNILRSYLNDPISDSEFFTACNKPAAWEKLLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISMRQLQMFLNDYDEIPLDALTYLIGQCNYGGRVTDDKDRRLLVCLLSICVCRDIVDNEK--------------------------------------HKN------------LFDCILLTLPRQSGGGGKSPAEMIEELAADILSKFPPLFDLEMVIKKYPVIYTDSMNTVLRQELIRFNRLTAVVISTLRNLQKAIKGLVVMSGELEDVFNNMLLGKVPAVWAAKSYPSLKPLGSYVTDLLDRLKFFQDWIDHGPPNVFWMSGFYFTQSFLTGARQNFARKYTIPIDHVGFEFNVMKEERDMDHK--PEDGVYVNGLFLEGARWDRETMLVAESLPKILFDTLPVMWIIPGEKSKFKSKPNYPCPVYKTSARRGTLSTTGHSTNFVMFVDLPSDKTERHWVNRGVALLCQLDD 3976          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 3081.58 bits (7988), Expect = 0.000e+0
Identity = 1606/3116 (51.54%), Postives = 2148/3116 (68.93%), Query Frame = 1
Query:  109 FMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFI--DKRTLWSHLLPKQ--STGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXX-XFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNG-LKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNC-KKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNS--------FPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFE-----HGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSG--KVVDEDVRGLIFGDYM---TDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYD-YAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHK--KCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            F   R ++ N++      ++   F+NV+ R        L   W P    ++   +KR        KQ  S  N++ ++AFF + + LM+ QL+ +   S++D+TE          F      ++  + P  I+ L +    + ++P FK+ + +L+  Y  ++++   +PRVE  L+ E  G +  L+ +I +E++V     +     +    GPK +L  Y KY +L+  KAE +V  FL E H      K+++ +  L DE+      V    +F L    L   + KR D LR  L+    ++++ +N+ +C  Y+ I  K    P +TE L+ ++ ++ +     +F L++   E   RL FL+DYA+    D++LN ++F W   +  VF+     +   R Q E  L++R  +F E LE  +K +E+F+      M E+ R ++    L  +++   +++   N EE    W+ + +P    +I  L+PY +L+ T ++F  K   W++GP+  ++   +E++     + ++KL KQ  + P AQ++A ++K K+++FK +LP++QV+ NPG+++RHW+QMS+I+GF +KP E+ +L       L  +L + E I  AA+KE  LEK + KM  +W  ++F +  YR++G  ILS++DDIQ LLDD I+K+QTM+GSPFIKPFE E+K WE KL+   +IID WLKVQATWLYLEPIFSS DI+AQMPEEGR+F  VD  W+E M  +V +   L   G   ML +L  SN LLE I KGLN+YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI  L+FT+ L+I  M S+EGE + +   I  +KA+G VEKWLL+++  M+ SV+KVI +++E+Y+  +R +WV DWPGQ V+CV+  YWT EV +AI      L  YL + NSQIDDIV LVRG L+   R TLGAL V+DVHARDV+  + +L +SS + FEWL+QLRYY     V    IS  L YG EYLGN+ RLVITPLTDRCYRTL  AL+L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQI +IQ+ I  G    +FEGTE+ L+PTC +FITMNPGYAGR ELPDNLK LFR+VAMMVP+YA+I EISLYS GFV+AR+LA KIV TY LCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K PD ENE IL+L++INDVNLPKFL+ D+PLF GI SDLFPGV LPK D+ +  +A  +      LQ  + F+ KILQIYEM++VRHG MIVGEPFGGKT AY+ LA AL+D+A  G M+E KV   +INPK+ITMGQLYGQFDPVSHEW+DGVLA+ +R FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCL SGEIIQ+++  NLIFEP DLE ASPATVSRCGMIYMEP  LGW+P + S++ + LP  LNE++ +LI+DLF+ + +  L FIR    K+L  T++ + V     +  +L+DE  ++   +E   +E           +  WL+ ++LFS VWS+G++L   GR  FD   RE+  G   L  K K   L   +         FP + T+YD+ F K+  G W+ W   I +++  I  D   NEIIIPT +T R TY ++  +TH KP + VGPTGTGKSV I N+L++  ++ Y    INFSA+T+A QTQDIIM+KLD+RRKGVYGPP  K+ VVFVDDLNMPA+E YGAQPPIELLRQW+DH  W+D KDTS +HL+D  +L+AMGPPGGGRN ++ R +RHFN + + +F+D TM++IF+ I++WH        GF   F  +G +LV+ T+ +Y+ AI + LPTPAKSHY+FNLRDF+RVI+G LL     +   + L RLW HEV+RVFYDRL    DR   ++ ++           + +   L   G  KV ++D+R L+F D+     D K Y E+  L  L   +E +LD++N++SK PM+LV+F+FA+EH+SR+ RV+KQ  GH LLVG+GGSGRQS TR+AA MADF++F +EI + Y   EWR+D+K +L K        VFLF+D QIK+ESF+EDI+ LLN G+VPNL+P DEK EI EKM+   R  +K   ++ D +P+A++NYFIERV+  LHIVLAMSPIGDAFRNRLR FPSL+NCCTIDWFQ+WP DAL++VA +FLE+ E++ + +E  V MCK +H S R LS  + + L+R+NYVTPTSYLELI TFK LLN K+ E++  K RY  GLEKL  A  +V  MQ EL+ALQP+LI    + D ++  +E+D++EV    +I+ A++  AN +A  ++ IKD+C+ DL EA+PIL  A+A+L+TL   DIT+V++MK+PP  +KLVMEA+CI+ G KP+R PD S +GK IED+W  S ++LGD KFL  L+ +  D++   AIK++R+KY   P+FDP  ++ ASTA EGLC+W+IA+D Y+ Y       K + L +    +    + L +K+A L EV+ KL  L ++ +   ++K +LE  ++LC+KKLDRAE+LIGGLGGEK+RWTE A  L  RY N+ GDVL+S+ VVAYLG FT AFR      +    + +E          ++ ++ +PVKIR W I GLP DSFSI+NGII+NN+NRWPL IDPQGQANKWIKNMEK N L +IKLTD ++VRTLEN IQFGTPVLLENVGEEL+P+LEP+L K  F+Q G   +++GD+VIEY+KDF+FYITT+LRNPHYLPE + KV LLNFMITP+GLEDQLLGIV A+E+PELEE+KN LI++SA+NKR+LKE+ED+ILEVLSSS+GNILE+ETAINVLSSSK+L+ EISEKQ IAE T+ +IDKTR GY P+AVH +ILFF I+D+ANI+PMYQYSL WFINLF+MSI+NSEKSE+L+ R+E L +HFT S+Y N+CRSLFE  KLLFS  +C+ +L    +V  + WRFLLTGGV LDNP+ NPA +W+  + W E+ R  ++   KG R+ F    + WK +YDS  P+
Sbjct:  210 FGTLRLVDKNDIQMRPEALELAMFQNVVMRHIEIAKETLLKRWFPEVQNIYYQGNKR--------KQVPSNQNAKRLEAFFNSASVLMTNQLQMLALNSISDYTEL---------FCPPSSSIRVLEHPGFIMRLVLEGDTVKFEPDFKDFEVVLLNVYDVMIKAVMVVPRVETKLYSEWSGTKKTLKPII-SEEIVNEAKAKVHAVIEHEMAGPKEHLKFYDKYKDLITRKAEADVDQFLLEGHKFNRFSKEVEKFAKLVDEIQYNSRKVIRVGMFELHCDELIRALAKRGDGLRTKLLQRMSKDHQVLNKMLCEEYEKIAEKALTSPANTEHLMELKNYIEQVENETIFDLEKRLVETKSRLGFLVDYASFSPADMRLNNSVFQWHFRMPEVFEEHKKIVNANRVQYENSLKMRRERFVEELESYSKQLEEFQT--FGDMSEVPRYLKKAQALHQRLETAAEKIVTFNVEEEAFGWDTTSYPQRQQLINTLNPYLKLYETTVEFQNKYKEWMEGPWGTIDPDKVESETGNYWRSLYKLEKQLTEVPLAQRIAGRMKTKVEEFKEYLPLVQVVFNPGLRDRHWEQMSEILGFPLKPDEDMNLAKMAEMNLEPYLAQFETISEAASKEFSLEKAMEKMVGEWDAVEFVMIPYRETGTHILSSIDDIQTLLDDQIVKTQTMRGSPFIKPFENEIKEWEGKLILTQEIIDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRRFSTVDKNWRETMKVAVLDKHVLTVIGIEKMLGKLKKSNELLELILKGLNEYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLQFTDTLDITHMKSSEGELVLLKDVISTSKARGQVEKWLLELQEDMVASVRKVIMEAMEAYLKEERVKWVRDWPGQTVLCVTQYYWTAEVHKAIRGGQKQLDQYLQQNNSQIDDIVTLVRGKLSKQNRATLGALVVLDVHARDVLTKLCELGISSEDDFEWLAQLRYYFEEENVMTRMISAHLAYGYEYLGNSGRLVITPLTDRCYRTLFGALQLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQMGIKSGGDTLLFEGTEIKLDPTCAVFITMNPGYAGRSELPDNLKALFRTVAMMVPNYAMIAEISLYSYGFVNARSLAVKIVTTYTLCSEQLSSQHHYDYGMRAVKSVLTAAGNLKLKYPD-ENEDILMLRSINDVNLPKFLAHDLPLFAGITSDLFPGVQLPKPDYTVLTAAAAEVCKSMNLQMVDEFLTKILQIYEMMIVRHGFMIVGEPFGGKTCAYRVLAKALSDVAEKGLMEENKVQIVVINPKSITMGQLYGQFDPVSHEWSDGVLAVNYRAFASSTTPDRKWLIFDGPVDAVWIENMNTVLDDNKKLCLNSGEIIQLASTTNLIFEPMDLEVASPATVSRCGMIYMEPHMLGWKPLLTSWL-HTLPKTLNEENKELIKDLFDRMEEALLQFIRKGGFKELSPTNDTNLVNSHMNMMDTLMDEFHDEQRFKELNERE-----------VAAWLECIYLFSCVWSLGATLDGEGRKSFDKLLREIVEGPLSLESKSKYHILEIVDPPPRPFLCPFPSKATVYDYRFIKEGMGKWELWTEEI-KDAPPIPKDMAFNEIIIPTVDTVRYTYLMEQLVTHGKPSLFVGPTGTGKSVYITNFLLKKLEETYKPLLINFSAQTTAKQTQDIIMSKLDKRRKGVYGPPLGKKTVVFVDDLNMPAREVYGAQPPIELLRQWLDHWQWYDLKDTSPIHLVDIQILAAMGPPGGGRNPITPRFLRHFNTISITKFDDGTMVKIFSRIMNWHLTTNASCRGFSKDFGPIGDMLVNGTLEIYRNAIVNLLPTPAKSHYLFNLRDFARVIQGTLLSAPDRITEHDMLKRLWSHEVFRVFYDRLVDGGDRDWLYNNLREVCKSHLNVEFDTLFQRLDFDGDGKVKEDDLRSLVFCDFTDAKADPKPYVEVEDLDKLRGVVENYLDEFNNMSKKPMTLVLFRFAIEHVSRISRVIKQPRGHCLLVGVGGSGRQSLTRLAAHMADFDLFQVEIGKGYTSTEWREDIKAILRKTAEGETNGVFLFTDTQIKEESFLEDINNLLNAGEVPNLFPLDEKQEICEKMRQFDRQRDK--SKQTDGSPVALFNYFIERVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQSWPADALQVVAQRFLEECEIEADVKEGCVEMCKSFHTSTRDLSLRYQSELKRHNYVTPTSYLELISTFKALLNKKQQEVVKAKRRYEVGLEKLNSAQSQVASMQEELEALQPQLIQAGKEVDDIMVIIERDSIEVAKTEKIVKADEAVANEQAMAAKAIKDECDKDLGEAIPILESALAALNTLTPADITVVKTMKSPPAGVKLVMEAICILKGVKPDRIPDPSGSGKKIEDFWAPSKRILGDMKFLQGLQTYDKDNIPAPAIKQIRQKYTSNPEFDPDKIKVASTAAEGLCRWVIAMDSYEKYDHLTTTFKSIDLLLMS--VLCDFQGLNKKRAALKEVQDKLARLQEKYEANVKKKSDLEKQVDLCSKKLDRAEKLIGGLGGEKTRWTEVANALGVRYTNLIGDVLVSSGVVAYLGAFTAAFRQGTCRAYSSSGRLVEY------GRVLVALIAQPVKIRDWTIFGLPTDSFSIENGIIINNANRWPLMIDPQGQANKWIKNMEKKNNLHVIKLTDADYVRTLENCIQFGTPVLLENVGEELDPLLEPLLLKQTFKQGGSICIKVGDSVIEYSKDFRFYITTKLRNPHYLPETAVKVTLLNFMITPEGLEDQLLGIVVARERPELEEEKNALILQSAENKRQLKEIEDKILEVLSSSEGNILEDETAINVLSSSKVLANEISEKQAIAEETEEKIDKTRMGYTPIAVHSAILFFSIADLANIEPMYQYSLTWFINLFIMSIDNSEKSEELDKRLENLRNHFTYSLYCNVCRSLFEKDKLLFSFLLCVNILMHDGEVCRDEWRFLLTGGVGLDNPHSNPA-SWLPSRSWDEICRLDDMSKFKGFRQKFPRTLEGWKKIYDSNEPQ 3280          

HSP 2 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 392/649 (60.40%), Postives = 506/649 (77.97%), Query Frame = 2
Query: 9413 KLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNS-RWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            K+++LRC+RPDKI P VQ+F+T  LG+ +I+PPPFDL  +F DSN C+PLIFVLSPG+DP  ALLKF +DQG++ SK++S+SLGQGQGPIA +MI++A++DGTWVVLQNCHLATSWM +LEK+CEE+  P+ TH +FRLWLTSYPS +FPV++LQNGVKMTNEPPKG+RAN++RSYL DPISD +FF G    S ++  MLFGLCFFHALVQERR+FGPLGWNIPYEFNE+DLRISV+Q+ MF+N Y E+  EAL YLTGECNYGGRVTDD+DRR L+++L  FY   +++ ++Y FSPSG YY+P DG  + YIEY RSLP+  +PE++ +H N    + +     + +    T     SG G+S ++ +  +++DIL K+P+ FD +  ++++P  Y++SMNTVL QE++RFN+LI VVRS+L+N+QKAIKGLVVM++ELEEV + +L GK+P  W  KSYPSLKPLGSYVNDL+ RL F  DW +N  PS FWISGF+FTQ+FLTG  QNFARKYTIPID + F+FE+         +  PEDG  V GLF+EGARWD++ K +GES  K+LF+S+P++WL P K   I +   Y+ PVYKTS RRGTLSTTGHSTNFV+ + LP++  Q HW+ RGVA LCQLDD
Sbjct: 3297 KMVLLRCLRPDKITPCVQNFVTVKLGKKYIEPPPFDLGKAFADSNSCAPLIFVLSPGSDPTAALLKFADDQGFSGSKLSSLSLGQGQGPIALRMIEKAVKDGTWVVLQNCHLATSWMPTLEKLCEELN-PDTTHPDFRLWLTSYPSPNFPVTVLQNGVKMTNEPPKGIRANIIRSYLGDPISDPEFFTGTGQKSPQFKKMLFGLCFFHALVQERRQFGPLGWNIPYEFNETDLRISVQQLHMFMNKYDEVQYEALKYLTGECNYGGRVTDDRDRRTLLTILNKFYTPGVIKDDRYKFSPSGNYYAPDDGDYETYIEYARSLPLINHPEIFDMHANVFSLRTSMRHISVLTHQTCTQCVLLSGGGRSDDEIVASVSEDILSKMPQEFDTDAALRKFPTTYTQSMNTVLVQEMVRFNRLIKVVRSSLVNIQKAIKGLVVMSSELEEVVSGILKGKIPGLWMKKSYPSLKPLGSYVNDLLARLKFLQDWYDNGAPSVFWISGFFFTQAFLTGSKQNFARKYTIPIDLLTFDFEVL---EDKKYETPPEDGVYVNGLFMEGARWDRDTKAIGESQAKVLFDSLPVMWLCPCKTEDIKKRPHYVTPVYKTSERRGTLSTTGHSTNFVMEMRLPSDQPQEHWVMRGVALLCQLDD 3941          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 2196.78 bits (5691), Expect = 0.000e+0
Identity = 1135/2097 (54.12%), Postives = 1476/2097 (70.39%), Query Frame = 1
Query: 3130 ISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVR-LPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHG-FDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDY-----MTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPIL---------QKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            I+  + YG EYLGN+ RLVITPLTDRCYRTLMSA  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY  MGKFFKGLA  GAWACFDEFNRIELEVLSVVAQQI  IQ AIA    RF+FEGT+L+LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVPDYALIGEI LYS GFVDAR L+ KIV TY LCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ + E++LLL++I DVNLPKFLS DIPLFEGIISDLFPG+ LPKAD+D F   V++   K+ +Q  ++F +KI+Q YEM++VRHG                   +     +   ++ ++++ Y                       WTDG++A  FRE+A   D    W                                                    PATVSRCGMIY+EP+ LGW P ++S++  ELP  L E H +LI  LF+W +  CL F+R +CK+ +  S+ +    L  L   +L E           ++E +D+K     ++ +W+   FLFS VWS+G+ +    R+KFDVFF++L GG    +P P  +   +S   PE + +YD+ FE+K+ GNW +W   I   S+      +IN+II+PT +TAR +Y +DL + + KP++ VGPTGTGKS  + + L+  LPKD YL   +NFSA+TSANQTQDIIM+KLD+RRKGV+GPP  KR V+FVDD+NMPA EKYGAQPPIELLRQ++DH +W+D+KDT+K+ LID   + AMGPPGGGRN VS R +RHFNV+ V  FND TM RIF++IV ++F +  F       G  +VS+TM +YK+A+ + LPTPAKSHY FNLRDFSRV+ GVLL+    L + + + RLWVHEVYRVFYDRL  ++DR    D +  TT +C        L   +L  +  ++D+R L+F D+     M +D++Y E+T +  L K +E  LD+YN   K  M+LV+F++ +EH+ R+ RVLKQ  G+ALLVG+GGSGRQS +R+AA +A F +F  EI+++YG  EWR+D+K LL  AGC  KP +FL +D QIK+ESF+ED+  LLNTG+VPNL+P+DEKAEI+E ++  A+ + +   +  + +P+A++N+F+   K+ LHI+L MSPIGDAFRNRLR FP+LINCCTIDWFQ WPEDALEMVANKFLED  + +N R+ IV +CK++H S R LSE++L  L R+NYVTPTSYLELI +FK LL  K++E++  K RY  GLEKL FA+ +V KMQ+EL+ LQP+L+V +A+ DK++  +E+++ EVEA  E++  ++  AN++AAE+Q +KD+CEADLAEA+P L  AM++L+TLK  DIT+V+SM NPP  +KLVM AVC+M   KPE+  D   TGK I D+W  S KLLGD  FL  LK +  D+++P  + K+R++YIP PDFDP  V+ AS+A EGLCKW+IA++ YD  AK+VAPKK  LA AE  L  T+  L  K+ +L EVEAKL  L  Q  E  ++K+ LE  ++LC+KKL RAE+LIGGLGGEK RW+ AAK L + + N+TGDVL+S+ V+AYLG FT  FR      W K C    IPCS+ F +   LGE +KIRAWNIAGLP DSFSIDNG+IV+ + RWPL IDPQGQANKWIKN EK N+LS+IKLTD +++RTLENSIQFG PVLLENV EEL+P L+P+L            I    GV  +RLG++VIEY+ DF+FYITT+LRNPHYLPE+STKV LLNFMITP+GL+DQLLGIV AKE+P+LEE++  LI++SA NK++LKE+ED+ILE LSSS+GNILE+ETAI +L SSK+LS EIS+KQ IA+ T+ +I+++R GY P+A H S+LFF I+D+ NIDPMYQYSL WF+NLFL SI +S KS+ LE R+ YL+DHFT ++Y N+CRSLFE  KLLFS  +C  +LK K++++   + F LTGG+ L+N   NP P+W+SD+ W E+ R  +L   K  R+ F N T +W+ +YDS+ P 
Sbjct:    5 INASVKYGCEYLGNSGRLVITPLTDRCYRTLMSAFHLNLGGAPEGPAGTGKTETTKDLAKALAIQCVVFNCSDGLDYLQMGKFFKGLASCGAWACFDEFNRIELEVLSVVAQQILCIQRAIAAHQDRFIFEGTDLNLNPNCYVAITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIGEIMLYSYGFVDARNLSVKIVTTYTLCSEQLSSQFHYDYGMRAVKAVLAAAGNLKLKYPNND-ENVLLLRSIMDVNLPKFLSHDIPLFEGIISDLFPGIKLPKADYDTFLDTVQEVCAKKNIQFVDFFREKIIQTYEMMVVRHGC-----------GTGSLTPSPSQWYSFLASLIQFRIRY-----------------------WTDGIVANTFREYAADHDGNPMW----------------------------------------------------PATVSRCGMIYLEPSSLGWDPVLQSWLG-ELPEVLKE-HDKLIDALFKWALPACLTFVRKSCKEAVHCSDSNLARSLMNLVEIMLKE----------ASEEGADIK-----HLKIWVVSSFLFSVVWSVGACVDTESRAKFDVFFKDLMGGKLDDHPIPTLVGKIESPIPPEGM-VYDYLFERKNRGNWLQWTKLIKSTSLG-GKGTRINDIIVPTMDTARYSYLMDLMIHNNKPLLFVGPTGTGKSAYVKDKLMNGLPKDLYLPAFVNFSAQTSANQTQDIIMSKLDKRRKGVFGPPVGKRFVIFVDDVNMPALEKYGAQPPIELLRQYLDHRNWYDRKDTTKISLIDLQFICAMGPPGGGRNPVSPRFLRHFNVVSVATFNDETMQRIFSSIVQFYFRNNDFPTDALCAGNQVVSATMEIYKEAMINLLPTPAKSHYTFNLRDFSRVVLGVLLIKKDALADKKTITRLWVHEVYRVFYDRLVDDKDR----DWLH-TTCNC------DFL--CTLFSQASEDDMRSLMFCDFLNPDAMAEDRLYQEVTEIDELYKIVEACLDEYNQTHKTGMNLVVFRYVLEHLVRISRVLKQPGGNALLVGVGGSGRQSLSRLAADIAGFAVFQPEISKSYGMTEWREDVKTLLKSAGCQMKPTIFLLTDTQIKEESFLEDVDSLLNTGEVPNLFPTDEKAEIIEAVRPHAQAQAED--KNAEFSPLALFNFFVNSCKEKLHIMLCMSPIGDAFRNRLRQFPALINCCTIDWFQPWPEDALEMVANKFLEDAVLTDNERKEIVTLCKYFHTSSRNLSEKYLEVLGRHNYVTPTSYLELISSFKTLLGRKQDEVLRSKRRYEVGLEKLAFAASQVAKMQVELEELQPQLVVAAAENDKMMIIIEKESKEVEATSELVRKDEAAANIQAAEAQALKDECEADLAEAIPALEAAMSALNTLKPADITIVKSMANPPAGVKLVMSAVCVMKDIKPEKVNDPGGTGKKILDFWGPSKKLLGDMTFLTSLKEYDRDNISPHIMAKIRKEYIPNPDFDPSKVKTASSAAEGLCKWVIAMEIYDRVAKVVAPKKESLAKAEASLAETMSLLNAKRRELAEVEAKLAALKSQFQEMTEKKENLEFQVDLCSKKLVRAEKLIGGLGGEKDRWSLAAKTLQDTFDNLTGDVLISSGVIAYLGAFTAGFRKECTHEWTKICQSKNIPCSDDFLLSKTLGEAIKIRAWNIAGLPTDSFSIDNGVIVDCARRWPLMIDPQGQANKWIKNSEKENQLSVIKLTDGDYIRTLENSIQFGNPVLLENVEEELDPSLQPMLLGRDSKKPYHVKITLVGGVVCIRLGESVIEYSSDFRFYITTKLRNPHYLPELSTKVTLLNFMITPEGLQDQLLGIVVAKERPDLEEERQALILQSAANKKQLKEIEDKILETLSSSEGNILEDETAIQILDSSKVLSDEISKKQKIADETEAKINESRRGYNPIAAHASVLFFSITDLPNIDPMYQYSLTWFVNLFLNSIHDSNKSKILERRLRYLSDHFTYNLYCNVCRSLFEKDKLLFSFVLCANILKSKSELDMTEFMFFLTGGIGLENKLENPDPSWLSDRSWDEICRMCDLSGFKDFRKSFSNTTHEWRKIYDSKEPH 1980          

HSP 2 Score: 564.688 bits (1454), Expect = 6.351e-163
Identity = 264/423 (62.41%), Postives = 328/423 (77.54%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNS-RWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLI 10663
            L    K+IV+RC+RPDK+VP V +F+ D LG+ FI PPPFDL  S+ DSN C+PL+F+LSPGADPM  L+KF +D+G++  K  +ISLGQGQGP+AA++I +A+Q+G+WVVLQNCHLA SWM +LEKICE++  PE TH +FRLWLTSYPS  FPV++LQNGVKMTNEPP GLR NLL+SY+ DPISD +FF+GC + +  W  +LFGLCFFHALVQERRKFGPLGWNIPY FNESDLRISVRQ+QMF+N+Y E P +A+TYLTG CNYGGRVTDD DRR L+S+L  F+N DIV   KY FS SG YY+PP  T   Y+E+I+ LP + +PEV+G+H+N DI+KD + T  L    L        G GK  ED++ E+A DIL KLP+NFDLE  + +YPV Y ESMNTVL QE+ RFNK +
Sbjct: 1992 LTDFQKMIVIRCLRPDKVVPLVTNFVEDKLGKKFIQPPPFDLAKSYVDSNACAPLLFILSPGADPMAGLMKFADDKGFSGDKFNAISLGQGQGPVAARLIQEAVQNGSWVVLQNCHLAVSWMTALEKICEDLN-PETTHTDFRLWLTSYPSNKFPVTVLQNGVKMTNEPPTGLRQNLLQSYITDPISDPEFFNGCGEKAPVWEKLLFGLCFFHALVQERRKFGPLGWNIPYGFNESDLRISVRQLQMFINEYEETPYDAVTYLTGACNYGGRVTDDNDRRCLMSILADFFNPDIVHDSKYKFSLSGNYYAPPKSTYDEYVEFIQELPQSQSPEVFGMHDNVDISKDCKHTRVL----LTQAQGAGGGGGKKSEDTLLEIATDILSKLPKNFDLEAALAKYPVTYEESMNTVLVQEMERFNKYV 2409          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1978.37 bits (5124), Expect = 0.000e+0
Identity = 1076/2711 (39.69%), Postives = 1647/2711 (60.75%), Query Frame = 1
Query: 1372 ITKSIEDFKKKEVMTMEEMRRNVQFL-DELQG----------------------QIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPT-EESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFT------EQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESY--VITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCN------SQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLR-YYDRG-GEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYN-SISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEM-DENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVV-EGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALD--NPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            + KS E FK   + + EE ++ V  L D+ Q                       Q+ + K Q   L +  ++   EQ+    L  + K+L+   ++W    ++    DTW  G F EL    +E     + K ++K+I++  D     ++   +K +I++FK  +P++Q + N  +++RHW Q+   +      T ++ +L   +  GL +  E++ EI  AA+KE  +E+ ++ +   W ++  ++  Y+D G   L   D++   L+D+ +   TMK S ++K FE E+  WE  L  + +++++ L VQ  W+YLE IF  EDI  Q+P E  +F  V+  WK +M    K+P+ L  T    +L+ L D N+ LEEIQK L+ YLE KR  FPRF+FLSND+LLEIL ++K+P+ VQPHLKKCF+ I  L+        ++ E +GM SAEGE +     +     +G VE WL  VE  M  ++K+++          ++KR +WV +WPGQ+ I  S + WT +  +A++      D     +      S ++   +++RG+L   +R+ + AL  I+VH RDV+E + K   + V AFEWLSQLR Y+D+   +  V Q +T+  YG EYLGN+ RLVITPLTDRCY TL +AL L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLD+K+MG+ + GLAQ GAW CFDEFNRI +EVLSVVAQQI SI  A++ G  RFVFEG E++L  +C +FITMNPGYAGR ELPDNLK +FR ++M VPD  +I EI L++ GF + + LA K+   Y L  +QLS Q HYD+G+RA+ SVL  AG  ++  PD  +E ILLL ++ D+N+ K  +QD PLF GI+SDLFPG++ P  D+    +A+   L     Q     I KI+Q+YE    RH  ++VG+   GK+  ++ L +A+T +  DG      V    INPKA+++G+LYG+FD  ++EWTDGVL+ + R+    +    KW++FD PVD +WIE+MN+V+DDNK L L++GE I M + ++L+FE  DL  ASPATVSRCGM+Y +   LGW+P+++S+++  +    ++  ++ ++ LFE  +   L+F +H+CK+ + TSE++ VV L  LF +L                E++ V++ + ++    L+  FLF  +WS+ +S+ E  R K D F REL G                   FP + T+Y++  + K    W  W + + R     +P     +I+IPT +T R  + +   +  ++PV++ GP GTGK+ +    L +L    Y    IN SA+TS+N  Q+II +K+++R KGVY P   K+ + F+DD NMPAK+ +G+QPP+EL+R WID+G W+D+   +  ++ D  LL++MGPPGGGR  +S R+   FN++ +    ++ + RIF T+++   +  F+     LG ++  +T+ +Y   +A  LPTP + HY+FNLRD S++ +G+L            + RLWVHE +RVF DRL    DR  F  ++            +K+     L+   +  + +  IFG++M DD +Y+++   K + + ME  ++DYN       ++LV+F+ A+EH++R+ RV+ Q  G+ LLVGIGGSGRQS TR+A+++ ++++F IE+T++Y + E+RDDLKRL  +AG D KP VFLF+D Q  +E F+ED++ +L++G+VPNLY  DE  E+   + + A  E+      +  TP +M+++FIERV+ NLHIVL MSP+GD FRNR+RM+P+ +NC TIDWF  WP DAL  VA ++LE+IE+ DE T+  +  +    H SV  +S   L  L+R+NYVTPT+YLEL+  ++ LL  K+ EL    ++   GL+K++    +V  M +EL+    ++     Q ++ L  + Q   E + +++++ A  E   ++  + + + ++ + DL EA+P L++AM +L++L + D+T ++S   PP L++ VMEAV I+   +P               W  + + LGD  F+ +L N+  D++  + +KK+   Y  +PDF P+I+   S A + LC W+ A++ Y    ++V PKK +L  A  +LE     LAE KA+L EV  ++++L  Q DE   +K+EL    EL   KLDRA +L+ GL GE+ RW  +  +L E    + GD L++AA ++Y G F   +R+ +V + W  +  ++ + C+ +F     L +P  +R WNI GLP D+FS +NG++V   NRWPL IDPQGQA KWIKNME  + L II L  ++++RTLEN++QFG+PVLL+NV EEL+P L PIL K++ +  G   ++LGD  +EY+ DF+FYITT+L NPHY PEISTK  ++NF +  QGLE QLLGIV  +E+PELEE+K+ L+I  A  K+KL+ELED+IL +L ++QG++L++E  +N L+SSK  SQE++E+ T++E T+++ID  R GY+P A   SILFF ++DM  IDPMYQ+SL+ +I+LF  SIE S++S +L+ RI+ LN++ T +VY+  CR LFE HKLLFS  MC  +L+   K+N + + F L GGV LD      NP   W++D  W  +    +LP+  G+   F+     W   Y S  PE
Sbjct:  958 LKKSKEKFKTGLIHSSEEFKKTVNGLFDDFQSKGPFSSSIGVKEALEQVTQYHEQVVNLKSQETSLRRGLNIFKIEQALSKDLQNLEKDLEHLEQVWTVTKEWEELWDTWKVGKFVELVTTDMETQAQLLFKRLNKIIREVKDK--NWEICDSIKSRIEQFKRTMPLIQDLKNSAMRDRHWSQIKTEVQKPFDHTGDDFTLEKIIELGLDQFGEQICEISGAASKELSIEQAISGIASIWDQVSLDIGPYKDRGHFRLKQTDEVFQQLEDNQVTLSTMKASRYVKAFEAEVDKWERTLSLILEVVEMILTVQRQWMYLENIFLGEDIRKQLPRESAEFDDVNANWKIIMQRLNKDPNALRGTHYPGLLETLNDMNTKLEEIQKSLDMYLETKRQIFPRFYFLSNDDLLEILGQSKNPEAVQPHLKKCFDNIKTLKMARVGLTFDKTEAVGMYSAEGEYVEFGHSVL---LEGPVEAWLCDVERSMRWTLKELLKHCRLGLKKSLSKRDKWVKEWPGQLTITSSQMQWTSDCNKALSSSKERGDKKALKSLKKKQVSMLNKFSEMIRGSLTKMQRLKIVALVTIEVHGRDVIEKLIKAGCNDVTAFEWLSQLRLYWDKDIDDCVVRQTNTQFQYGYEYLGNSGRLVITPLTDRCYMTLTTALHLHRGGSPKGPAGTGKTETVKDLGKALGNYVIVVNCSEGLDFKSMGRMYSGLAQTGAWGCFDEFNRINIEVLSVVAQQILSILSALSAGATRFVFEGREINLVWSCGIFITMNPGYAGRTELPDNLKSMFRPISMCVPDSGMIAEIILFAEGFNNTKVLAKKVHTLYTLAVQQLSKQDHYDFGLRALTSVLRYAGRKKRANPDMSDEEILLL-SMKDMNVAKLTTQDAPLFNGIVSDLFPGIEAPVIDYGKLRNAIVAELKDGGYQPTPNTILKIIQLYETKNSRHSTIVVGQTGSGKSVTWRVLQSAMTRLKRDGEPGFNVVREFPINPKAVSLGELYGEFDLNTNEWTDGVLSSVMRQTCSDEKPEEKWILFDAPVDTLWIESMNSVMDDNKVLTLINGERISMPDMVSLLFEVEDLAVASPATVSRCGMVYTDFRDLGWQPYVDSWLDRRV----DKQSVEHLQRLFEKFVPKVLEFRKHHCKEPVPTSELNSVVSLCVLFDAL--------------ATEENGVRMSNGESYARMLELWFLFCLIWSVCASVDEDSRKKMDNFLRELEG------------------QFPAKDTVYEYHVDIKQK-TWASWEDKL-RSGWRYNPSVPFYKIMIPTVDTVRYDFLVYNLIQAKRPVLLTGPVGTGKTSVAQKVLQKLDPKTYGLLVINMSAQTSSNDVQEIIESKVEKRTKGVYVPIGGKQMITFMDDFNMPAKDTFGSQPPLELIRLWIDYGFWYDRMKQTVKYVKDMHLLASMGPPGGGRMVISKRLQSRFNLINMTFPQESQIKRIFGTMINQKLQD-FEEDVKPLGDIMTQATIEIYNTIVAKMLPTPTRIHYLFNLRDISKIFQGLLRANKDLHDTKTAISRLWVHECFRVFSDRLIDNTDRESFVTLLS-----------DKLGSMFDLTFHNLCPNKQSPIFGNFMKDDTMYEDLVDFKAIKRYMEDQMEDYNMEPGVIAINLVLFRDAIEHVTRIVRVIGQPRGNMLLVGIGGSGRQSLTRLASYIIEYKVFQIEVTKHYRRQEFRDDLKRLYYQAGVDNKPTVFLFNDTQALEEGFLEDVNNILSSGEVPNLYKPDEFEEVRTALSDIAAKED------VQDTPESMFHFFIERVRSNLHIVLCMSPVGDPFRNRIRMYPAFVNCTTIDWFSEWPGDALLEVAERYLENIELGDEETKANVAQIFVTVHRSVVDMSARMLLELKRHNYVTPTNYLELVSGYQSLLAEKKKELGDAASKLRNGLDKIDDTRAKVEVMSVELEDATLKVAEFQKQCEEYLVVIVQQKREADEQQKMVQARSEKIAIEEDKCRVMAENAQHDLDEAIPALQEAMKALESLNKKDMTEIKSYGRPPALVEKVMEAVMILRQSEPT--------------WAEAKRQLGDGNFIKQLVNYDKDNMTDRILKKI-GTYCAQPDFQPEIIGRVSLAAKSLCMWVRAMEVYGRIYRVVEPKKQRLHQATAQLEEKQAILAEAKAKLKEVTDRMEELKRQYDEKSAQKEELRAKAELLEIKLDRAGKLVSGLAGERDRWEASVTILEENIGYLVGDCLIAAAFMSYAGPFLSNYRDELVLKTWLAQVRQLGVACNPNFSFSGFLAKPTTVREWNIQGLPSDAFSTENGVMVTRGNRWPLMIDPQGQALKWIKNMEGKSGLKIIDLQQSDYLRTLENAVQFGSPVLLQNVQEELDPSLAPILNKSVVKVGGRYLIKLGDKEVEYSPDFRFYITTKLSNPHYTPEISTKTTIVNFAVKEQGLEAQLLGIVVRRERPELEEQKDALVINIAAGKKKLEELEDEILRLLQTAQGSLLDDEQLVNTLNSSKTTSQEVAEQLTVSEQTEIKIDAAREGYRPCAQRASILFFVLNDMGRIDPMYQFSLDAYIDLFNNSIEKSQRSPNLDNRIQNLNEYHTYAVYKYTCRGLFERHKLLFSFQMCSKILEAAGKLNMDEYNFFLRGGVVLDREGQMDNPCTQWLTDTSWDNVTELDKLPNFHGIVTSFEQYPRDWNQWYTSSEPE 3591          

HSP 2 Score: 311.612 bits (797), Expect = 2.084e-84
Identity = 150/330 (45.45%), Postives = 215/330 (65.15%), Query Frame = 2
Query: 9407 LDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIY------IEYIRSLPI 10378
            L +++V+R +RPD++     SFI +NLG  F++PP  D+ S  +DS+  +PLIFVLSPG DP +ALL+  E+ G  +++  ++SLGQGQ PIA +MI + ++DG WV L NCHL+ SWM  L+K+ E++ + E+ H +FRLWL+S P  +FP+SILQ G+KMT EPPKGL+AN+ R Y    +   + F  C+   ++  +LFGLCFFH+++ ERRKF  LGWNI Y FN+SD  +S   + ++L++Y E P +AL YL    NYGG VTDD DRRLL S +   +N   ++   Y  S    YY P DG    Y      + YI++ P+
Sbjct: 3606 LQRMLVVRSLRPDRVSFTATSFIVNNLGSKFVEPPVLDMSSVVDDSSTRTPLIFVLSPGVDPTSALLQLAENCGM-SNRFHALSLGQGQAPIATRMIKEGVKDGNWVFLANCHLSLSWMPQLDKLVEQLQV-EDPHPDFRLWLSSSPHPEFPISILQVGIKMTTEPPKGLKANMKRLY---QLITEQQFSRCHKQDKYKKLLFGLCFFHSVLLERRKFLMLGWNIVYGFNDSDFEVSENLLSIYLDEYEETPWDALKYLVAGVNYGGHVTDDFDRRLLHSYINEMFNDQAIQTPYYKLSSLPTYYVPKDGPLSTYRVSVILLMYIQASPL 3930          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 1947.94 bits (5045), Expect = 0.000e+0
Identity = 1131/2903 (38.96%), Postives = 1672/2903 (57.60%), Query Frame = 1
Query:  748 YLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPY--EDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDS-GVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLE-------------------------IIGMISAEGETLSM--VTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCI--YWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY-DRGGEVWVCQISTELP-YGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEY--KVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLP-KDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMD-ENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSF-SIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYP-NPAPNWMSDKLWSEMVRASE-LPSIKGLREHF 9318
            Y N ++ Y         L++ A  +  H +      ++ Y    ++   +    P+ + + D R+L   +     K  E++     +  ++    + +   D   ++  +P+ T   V    FL E    E     E     ++ L  L+D   +P   ED+ +  TL      + NV D +     +  ++    +   +++  + ++E+ +  +D K  +  +  E    + +L ELQG++D   D        +     E ++F  L  +   L     LW + +++      W +  F ELN  T+ N++++  K + +L K    N     V   +K K++  ++ LPV+  + NP +++RHWDQ+  I  +  K  E  +L         +H E +EE+   A+ E  LE  L K+++ WK  +F +  +RDS  V IL  +DDIQ +LDD +I   T+ GS  + P    ++ W+ +L   ++ +D W+  Q  WLYLE IFS+ DI  Q+P E + F  VD +WKE+M +  + P+ L A  Q  +L+   ++N+LL++IQK L  YLE K + FPRF+FLSNDELLEILS+T++P  VQPHL+KCF+ I +LEF   ++                         I+GMIS EGE +S+  V+  +  +   +   WL  + N  +N  KK+   S   Y+   R       P  I+   + I   +    +  I  P  L           +++  LVRG L    R  LGAL  IDVHARD+V  M   +V S N FEW+ QLRYY D   +  V ++S  +  YG EYLG + RLVITPLTDRCY  LM AL+L+LGGAP GPAGTGKTET KDLAKA+AKQCVVFNCS+GLD+K MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ +I+ A      RF+FEG E+ L P+C  FITMNPGYAGR ELPDNLK LFR +AMMVP+YALI E+ LYS GF  ++ LA K+   YRLCSEQLS Q HYD+GMRAVKSVL  AG L++  PD E E ++L++A+ D NLPKFL+ D  LF  I++DLFPG ++P  D+    S ++D +  + LQ     + K++Q+YE ++VRHG+M+VG    GKT  Y  L   LT +        Y   V   I+NPK++TMG+LYG+ + ++ EW DG++A+  R+         KW++ DGPVDA+WIENMNTVLDDNK LCL + E I+++N ++++FE  DL  ASPATVSRCGM+YM+P +LGWRPF+ S+++      + E+  + + +LF+  +D  L F    C + ++  +I  V  +  LF S     +  P               +    ++  +   FLF F+WSIG +L+E+    FD F R+L       +     +++  S      L  Y   F+ +    W++ +      +   S +    ++++PT +T R  + +D  L+  K V+  G TG GKSV+    L  +  K  Y+A  +NFSA+TS+ +TQ++I TKL+++RK + G P  KR V+FVDDLNMP  + YG+QPPIELLRQ+ D   ++D++      + D  + SA  PPGGGRN V+ R +RHF++  +    ++T+  IF +IV   F   F          +V +++ +Y +     LPTPAKSHYVFNLRD S+ I+GVL      + +  ++ RL+ HE  RVF DRL  +ED+  F  I+            E    H   +      +   ++FGD+M       DK+Y+E+T LK +   +  +LDDYN  S   M LV F  A+EHISR+ R+++Q  G+ALLVG+GG+G+QS TR+A  M+ ++ F IE+TR Y  + +R+DLK+L   AG   +  VFLF+D QI  E F+EDI+ +LN+G+VPNL+  +E   +L    N  R   K+ G   +     +++YFI RV+ NLHIVL MSP+GDAFR R RMFPSL+NCCTIDWF  WP +AL  V++ F E++++  E  ++ +  MC   H SV  +++ F   LRR  Y TPTSYLELI  +  +L+ KR +LI  ++R   GL+KL   +  V  MQ+EL AL+P+L   S   +KL+ K++ D  E +  R ++ AE+  A  KA E+  I  + + DL EA+P L  A  +LD+L ++DI+ +R    PP L+  VME++CI+LG KP+              W S+  +LGD  FL +L ++  D +    ++KL+ KYI  P F  ++V   S AC  +  W+ A+D Y    + V PK+ KLA A+ ELE+ +  L EK+A L EVE+K+ +L    D +   K+ L  NI     +L RA +L   LG E+ RWTE          N+ G+V ++AA VAY G FT  +R+ ++  W ++C E+ +P S+ F ++++L +P +IR WN  GLP DS  +I++ I+   + R  L +    +AN+WI+  E  N L IIKLTDNNF+RTLEN I+ G PVLLE VGE L+P LEPIL K  F Q G   +RLGD+ I+Y+K+F+FY+TT+L NPHYLPE+  KV ++NF +T  GLEDQLL  V   E+P+LE+++N LI+    +K +LK +ED+IL++L  S+GNIL++E  IN L+ SK+ S  IS +   AE T+ +I   R  Y+PVA  GS+++F ++ +A +DPMYQYSL +F  LF   IE+SEK++DL+ R+E L ++ T SVY N+ R LFE  KL+FS  +C  +++ +  + DE W F L G   LD   P  P   W++D +W+      + L S KG +  F
Sbjct:  380 YANTFEPYRKFYQENESLDLEAIREGEHDVEFFATSLEKYNSEHEQAVGIMAKKPIGMILADLRKLKEVLIPSPLKCLEVINDILPKLAKKRTDDLMKFCQDAQFELEVVPSSTNDYVKSLTFLDEIQ--EKIDDIEAESMTIKELYDLIDNYKVPTPPEDLAVYQTLRPTVTAVRNVIDKSLAERDSNIDKFCTCMDKDIVQLGKDVKEVKQKAQDPKILDSSSKSE--SIIAYLKELQGKMDRLHDTAFTYKSYQKNFKVEVTKFEELEEVHAELRLKQSLWNSLVEWDQSQQDWTETLFEELNPETLSNNVMKYAKTVMQLEKGLPPN----SVVPILKEKLENMRHKLPVITNLRNPALKQRHWDQIQQIFNYHFKDEEPLTLGLLDKIEAFEHTESIEEVSGQASSEASLEGILKKVEDAWKSTEFIVLPHRDSKDVFILGGVDDIQAVLDDSMINVSTIAGSRHVGPIRPRVEEWQRQLYLFSETMDEWMTCQRNWLYLESIFSAPDIQRQLPAEAKMFMTVDKSWKEIMRKVNRLPNALRAATQPGLLETFQNNNALLDQIQKCLEAYLESKCVIFPRFYFLSNDELLEILSQTRNPHAVQPHLQKCFDAIAKLEFGSTVQAPSTPQDQPVTPTGERRKMRYATNDILGMISPEGEKVSLGKVSYSHSIETLTLCFSWLKDMSNHPLNLHKKISLFSSLMYITWSRS------PQYIITSSTTINALFPSHYSLCIVFPMNL-----------NNLAALVRGVLPKLTRNILGALITIDVHARDIVTGMVNAKVDSENNFEWIKQLRYYWDPDLDNCVVRMSNSMYIYGYEYLGASARLVITPLTDRCYLCLMGALQLDLGGAPAGPAGTGKTETTKDLAKALAKQCVVFNCSEGLDFKMMGRFFSGLAQSGAWCCFDEFNRIDIEVLSVIAQQLLTIRNAKVAKASRFMFEGREIKLVPSCAAFITMNPGYAGRTELPDNLKALFRPMAMMVPNYALIAEVILYSEGFESSKNLARKMTQMYRLCSEQLSQQDHYDFGMRAVKSVLVMAGALKRSNPDLE-EDVVLIRALRDSNLPKFLAADAILFRAILTDLFPGKEIPDHDYGKLQSTIEDCMVAKGLQAIPALVKKVIQLYETMIVRHGVMLVGPTGSGKTTNYMMLQDTLTSLHEQAEDSPYYLPVQTHILNPKSVTMGELYGEVNKLTMEWRDGLMALKVRQCVQETTPDHKWIVCDGPVDALWIENMNTVLDDNKMLCLANSERIKLNNTIHMLFEVQDLAVASPATVSRCGMVYMDPNELGWRPFVRSWMQKH-SDKMKEETREYLWNLFDHYVDAGLKFASKKCTQAMQQVDISKVTTMCCLFDSFFFPAKGGPDFN------------LDPTKLHPLICTAFLFVFLWSIGGNLVETCNESFDTFTRDL-------FADTHDVRIPGSGD----LYSYYVDFDTRRMEPWEKII-----PAFKYSSEVPYFDLLVPTVDTVRFGFLMDKLLSVNKSVLYTGTTGVGKSVIAKAILDDISQKSNYMAIMMNFSAQTSSQRTQEMIETKLEKKRKNILGAPAGKRMVIFVDDLNMPKLDTYGSQPPIELLRQYQDFRGFYDREKLFWKEIHDMTICSACAPPGGGRNPVTPRFLRHFSMFCIPSSAEHTLGHIFKSIVS-GFLLDFPAEVRECADAIVGASVEIYARMSTDLLPTPAKSHYVFNLRDLSKCIQGVLQADPGVIRDKGQIFRLFCHEASRVFQDRLINKEDKTFFNTIMS-----------EMAHKHFQQARSPEKFESNPILFGDFMKMGADPADKLYEELTDLKKVKNLLTDYLDDYNMNSSKEMKLVFFMDAIEHISRIARMVRQPRGNALLVGVGGTGKQSLTRLACHMSAYKCFQIELTRGYDYSAFREDLKKLYDVAGVKGENTVFLFTDTQIVVEEFLEDINNILNSGEVPNLFEPEEYEAVL----NGTRPLAKEAGIP-EGDRDGVFDYFISRVRNNLHIVLCMSPVGDAFRTRCRMFPSLVNCCTIDWFTEWPREALLSVSSNFFEEVDLGAEGVKDKVAEMCVEIHTSVSTMADRFYAELRRRYYTTPTSYLELITLYLSMLDEKRKQLIGARDRVKNGLKKLLETNDLVDTMQVELVALEPQLKQKSLDVEKLMEKLQVDQEEADKVRNVVQAEEAVAKEKADETSAIAAEAQKDLDEALPALEAAQKALDSLDKSDISELRVFTKPPELVMTVMESICILLGVKPD--------------WPSAKTMLGDAGFLKKLMDYDKDKIPDSTLRKLK-KYIDNPKFVVEVVEKVSKACRSMVMWVRAMDLYARVYRTVEPKRAKLAAAQAELEVVMSTLREKQASLAEVESKIAELQAAYDHSIAEKETLTKNIAQTAARLKRASKLTTALGDEQGRWTENVAAFELEIGNVVGNVFVAAACVAYFGAFTSLYRHELINSWIEQCKELGVPVSDDFSLINVLADPYEIRQWNSDGLPRDSLKAIEDRILKLLNMRSTLFL----KANRWIRTKEAKNGLKIIKLTDNNFLRTLENCIRIGMPVLLEEVGESLDPALEPILLKQTFVQGGRLLIRLGDSDIDYDKNFRFYMTTKLANPHYLPEVCIKVTIINFTVTKSGLEDQLLSDVVRLERPDLEDQRNQLIVRINSDKNQLKAIEDRILKLLFHSEGNILDDEVLINTLNESKVTSGVISTRLKEAERTEEKITIAREKYRPVATRGSVMYFVVASLAEVDPMYQYSLKYFKQLFNACIESSEKTDDLDRRLEILLNNCTESVYVNVARGLFEKDKLVFSFMLCGDIMRQQEIITDEEWNFFLRGTGGLDKERPAKPDVPWLTDFMWNTCCDLEDVLHSFKGFKGDF 3191          

HSP 2 Score: 605.905 bits (1561), Expect = 7.557e-174
Identity = 316/686 (46.06%), Postives = 446/686 (65.01%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPE-NTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSY---LNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQAS-GEGKSPEDSIQELADDILKKLPENFDLEMIMK---------RYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEIT-SFDNSTDIKVR------------------PEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L   ++LI ++  + +K+V A   F+ +NLG+TF++ P  DL   F + +   PLIF+LS G+DPMNA L+F  D  Y   +I +ISLGQGQGP+A K+I  A ++G WV LQNCHLA SWM ++E   +++   E   H++FRL+L+S P++ FPV++LQN VK+TNEPPKGLRAN  R++   + DP      F+      RW  ++FG+CFFHA++QER+KFGPLGWNI YEFN+SD   ++  ++MFL D   +P +ALT++TG+  YGGRVTD+ D+R L ++L  F++  I+E + Y FS SGIY+ P   +   Y EY+ +LP+   PEV+G+HENA+I    QET+QL   +L   PR AS G GK+ ++ + ELAD IL KL +  D+E   K         RY      S+ TVL QE+ RFN L+ V++++L  LQKAIKGLVVM+ EL++V+ S L  +VP+ WA  SYPSLKPLGS+V DL+ R  F   WI +  P +FWISGF+F Q FLTG LQN ARKY +PID++ F + +   + N  ++                     P+DG  V+GL+L+GARWD ++ MLG++    +   +PI+ ++P   +  D  S Y+ P+YKTSAR G LSTTGHSTNFV+++ LP +L Q  WI +G A LCQL++
Sbjct: 3224 LTSFERLIFIKAFKEEKVVFAAVDFVCENLGKTFVESPSIDLPVLFENVSNMIPLIFILSTGSDPMNAFLRFARDMNYT-ERIQAISLGQGQGPVAEKLIANASKNGDWVFLQNCHLAASWMLAMETTIKDLTNNEAEVHEDFRLFLSSMPTKAFPVTVLQNSVKVTNEPPKGLRANTKRAFGELMADP------FESHVLGVRWRKLVFGICFFHAIIQERKKFGPLGWNIKYEFNDSDRMCALENLKMFLVD-ENIPWDALTFITGQITYGGRVTDEWDQRCLTTILGRFFSPKILE-DNYKFSESGIYFPPGFESLHDYREYVDNLPLTDEPEVFGMHENANIAFQTQETHQLIYTVLEVQPRLASSGGGKTNDEIVYELADSILGKLMDVLDMEKAEKSLFETDAKGRY-----NSLTTVLGQEVDRFNNLLKVIKNSLTQLQKAIKGLVVMSLELDKVYTSFLNNQVPDMWANSSYPSLKPLGSWVKDLVLRTMFVEQWIIHGPPKSFWISGFFFPQGFLTGTLQNHARKYNLPIDQLTFSYNVLPQYRNQEEVAEETAKLEYGQALPLDEELDCPDDGVLVHGLYLDGARWDDDSMMLGDARYGEMNPPLPILHMEPQMNLVPD-PSQYMSPLYKTSARAGVLSTTGHSTNFVVSVYLPTDLPQAFWIEKGTALLCQLNE 3894          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 2771.11 bits (7182), Expect = 0.000e+0
Identity = 1509/3126 (48.27%), Postives = 2066/3126 (66.09%), Query Frame = 1
Query:  160 PMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQRLFLRTVIFNEKLVTSYLDETMQTFKD----NTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFK-KKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRL------WRTA----LDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFND--NPGAQKVA---SKVKGK-----------------------IDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNE-DHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDE-IRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHG-FDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIK-AGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQ-NDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQ--TIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
            PM     +N +  +C      +  +W P+  +LF +++T        +STG+ +   +F+   ++L+S QLR++             +HK    F   FD  +    P+  + L   + K+   P+ ++++  ++     I  + + +  V+  L     G          N K+   Y      T K     N  GP  +   Y  Y  L+N  A+ +V  FLKE H      KK++ + +L  E+S L   V  ++  LD           C++L++ L +            IC  ++ I  KV +IP +TE +  +++++       V  L  E +EA   +++LL+      EDIKLN+T++ WPH+I   F+ +   +Q+ R++ E++L  R  +   +LE++  +I+ F    E+  ++E   +V+   +   ++ + ++ +  +NKEE+   WE + +P +  M + ++PY ++      W+      L FH     W+ G F +LN  T+E  + E  + ++K++K F    +  AQ+VA    K +G+                       I KFK+++PV+ ++CNPG++ RHW++MS I GFD+ P   +SL   L   L   LE+ E I  AA+KE  LEK +  M + W  + F    ++D+GVSI +ALDDIQM+LDD I+K+QTM GSPF+KPF+ EMK WE++L+ + + ID WLK+QA WLYLEPIFSS+DI+ Q+PEEGR F  VD  W+E+M   VK+   L AT    +L+RL DSN+LLE+I KGLN YLEKKRL+FP                                               M S+EGE + ++  I  ++A G VEKWLLQ+E+ MI+SV+ +I+ S  +Y  T R +WV +WPGQ+V+C S I+WT EV +A+    GLK Y  +  +Q+++IV+LVRG L    R TLGAL  IDVHARDVV+++ + +VS    FEWL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQ+  IQ AI   L+ F FEGT L LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L++KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPGV LP AD+ +F  A ++      +Q  + F DK++Q YEM++VRH  M+VGE F GKT+    LA  L+ +   G  +E KV +  +NPK+ITMGQL+GQFD VSHEWTDGV+A  FREFA+A+   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMSN+M+LIFE  DL QASPATVSRCGMIYMEP+QLGW+P + S+I   LP  L   D+  LI DLF WLI P L  +R +C++++ T+  H VV L +LF  +LDE ++  P  E   T                W+   F  S VWS+G       R KF+ F R+   G N  +P P++I+  +     E+  +YD+ +E K  G W  W +TI+  ++    + K  EII+PT +T R TY +DL ++ + P++ VGPTGTGKSV + + L+  L KD YL   INFSA TSANQTQ+IIM+K+D+RRKGV+GPP  KR V+FVDDLNMPA+E++GAQPP+ELLRQ++DHGH +D KDTSK+ L+D   ++AMGPPGGGRN V+SR +RH N++ +N F+D+TM+ IF++IV +  +   F   F  +G  +V++ M VYKKA+A+ LPTPAKSHY FNLRDFSRVI+G LL+   +L   + L+RL+VHEVYRV++DRL  +EDR   + ++     D F    +++ G L    K+ ++D++ L+FGDYM      D+++Y E+ S++  A+ +++ L++YN + K  M+LV+F + +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A  MA   +F  EI++NYG  EWRDDLK++L++ AG   +  VFL +D QIK E+F+EDI  +LNTG+VPNL+  DEK EI+E ++  A+  +K     ++ +P+ ++ +F+ R K+NLH+V+A SPIG AFR RLR FPSLINCCTIDWFQ WPE+ALE VAN FLE +EM EN R+ ++ +CK +H S  QLS +F   L RYNY+TPTSYLELI TF++L++ KR  ++  K RY+ GL++L FA  EV KM+ EL  LQP+L        K++  +E +++EVEAK  ++  ++E A +KA E+Q +K +CE DLAEA+P L  A+ +LDTLKQ +DI++V++MKNPP  +KLVM AVC+M   KP+R PD + TGK I DYW  S KLLGD  FL  LK +  D++    ++ +R +++  PDFDP  V NAS+A EGLCKWI A++ YD  AK+VAPKK KLA A++ L  T   L +K+A+L EVE +L  L    +E  + K  LE  +E C +KL+RAE+LIGGL GEK  W++AA  L   Y N+TGDVL+SA V+AYLG FT  FR +  + W   C    IP S+ F +   LG P++IRAWNIAGLP DSFSIDNG+IV NS R PL IDPQGQANKW+KN+EK N L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K  F+ QGV+ ++LG+ VIEY+ DF+FY+TTRL+NPHYLPE++TKV LLNFMITP+GLEDQLLGIV A ++PELEE++  LI++SA+NKR+LKE+ED ILE L SS+GNILE+E+AI +L S+K++S EI++KQ   IAE T+++I ++R GY+ VA H SILFF I+D+ NIDPMYQYSL WF+NL++ SI++  KS+ L+ R+EYL DHFT ++Y N+CRSLFE  KLLFS  +C  LL  K   + ++  FLLTGG+ L N   NP P+W+ DK W E+ RASELP  +GL E F  N + +K +YDS+ P
Sbjct:   38 PMDCKSLQNKLVLECKRKEDSVMNTWFPQILKLFNNEKT-------PESTGDQKQA-SFYNCASTLISNQLRSV-------------LHKGIEEFVSVFDPSRQHCLPIFQMALTFDDEKMEMYPTPRDVEKSVLEILNVITNTFQKVQTVQSWL-----GHA---SPSFVNAKVTGDYFLWAQSTVKSAVLKNMEGPGKHFQSYDSYSWLVNGTAQTQVDTFLKEEHSFEEYTKKVETFHNLAKEISSLPPKVYFTMVQLD-----------CEELKQGLTN---------KAKICSEFEAIKQKVLDIPKNTEEIAQMEKYIDFTKKNIVPELNNEVKEANSHIIYLLETHVAKSEDIKLNSTVYLWPHNILLAFEQSEEVLQSSRQKEEKELIARRERLTVQLEKLEHNIKTFPLYSELGLIQEYIADVRTTGK---RLQEAEENIVGINKEEAFYKWEITCYPEVKAMKEQMEPYQKVFECILKWQHTESINLTFHTLLKRWMDGSFLDLNGETMETQVDEFYREIYKMLKFFQQKQSKAAQEVAKTYGKAEGQPDEKNSSKQECPTVNLCSIVIEQIQKFKDYIPVVSILCNPGLRGRHWEKMSQIAGFDLTPNFGTSLRKLLQLKLEPFLEEFETISVAASKEFSLEKAMQTMTQVWDGVSFHHQPHKDTGVSIFTALDDIQMMLDDQIVKTQTMMGSPFVKPFQSEMKQWEERLLHIQESIDEWLKLQAQWLYLEPIFSSQDIMQQIPEEGRLFQTVDRNWREIMGHCVKDSKVLQATSLPGLLERLQDSNALLEKIMKGLNAYLEKKRLFFP-----------------------------------------------MYSSEGERVELIQNISTSEANGAVEKWLLQLEDGMISSVRDIIDRS-RAYEKTARNQWVKEWPGQVVLCTSQIFWTLEVHKAL----GLKKYYQQLQNQLNEIVELVRGELPKQTRTTLGALVTIDVHARDVVKDLIE-KVSDETDFEWLAQLRYYWMNDNVRVHIINCDVKYAYEYLGNSPRLVITPLTDRCYRTLIGAFHLNLGGAPEGPAGTGKTETTKDLAKALAVQCVVFNCSDGLDYLAMGKFFKGLASSGAWACFDEFNRIELEVLSVVAQQVLCIQRAIMHKLEYFDFEGTMLKLNPNCFVSITMNPGYAGRSELPDNLKVLFRTVAMMVPNYALIAEISLYSYGFLNAKPLSAKIVMTYRLCSEQLSSQFHYDYGMRAVKAVLLAAGNLKLKFPN-ENEDILLLRSIKDVNEPKFLSHDIPLFNGITSDLFPGVSLPVADYKLFLEAAEECCKIHNVQPTKVFTDKLIQTYEMMIVRH-FMLVGESFAGKTKVLHVLADTLSLMNERGHGEEEKVIFRTLNPKSITMGQLFGQFDLVSHEWTDGVVANTFREFALAETPDRKWVVFDGPIDTLWIESMNTVLDDNKKLCLMSGEIIQMSNQMSLIFEANDLSQASPATVSRCGMIYMEPSQLGWKPLVISWIN-TLPDPLQSPDNRSLILDLFHWLIPPSLQMLRRHCREVVPTTNSHTVVALCRLFKMILDEPVKTGPDDESIRT----------------WIMAAFASSLVWSVGGCCDTDSREKFNDFIRQTVSGKNKEHPIPETIERWEC-PINEKGLVYDYFYEFKEKGRWIHWNDTIENINLG-EINTKGQEIIVPTIDTVRYTYLMDLCIS-QGPLLFVGPTGTGKSVYVKDKLLNNLDKDCYLPFFINFSAHTSANQTQNIIMSKMDKRRKGVFGPPLGKRYVLFVDDLNMPAREQFGAQPPVELLRQFLDHGH-YDLKDTSKISLVDVQFIAAMGPPGGGRNAVTSRFLRHLNIISINPFSDDTMVHIFSSIVAFSMKKNLFSPEFVIVGNQIVTAMMEVYKKAMANLLPTPAKSHYTFNLRDFSRVIQGCLLLKKGSLEGKQTLIRLFVHEVYRVYHDRLVDDEDRTWLYQLMNSIVKDHFNVPFDQVFGQLKQGDKLEEKDMQNLLFGDYMNPDLEGDERLYTEVPSIETFAEVVKSCLEEYNQMHKNRMNLVIF-YLLEHLSRISRVLKQPGGNALLVGVGGSGRQSITRLATSMAHMTLFQPEISKNYGMTEWRDDLKQMLLRNAGVKGQKTVFLITDTQIKDEAFLEDIDSVLNTGEVPNLFAVDEKQEIIETIRPIAQAGKK----SVELSPLTLFAFFVARCKENLHVVVAFSPIGKAFRKRLRQFPSLINCCTIDWFQPWPEEALERVANSFLESLEMSENERQEVITICKTFHTSANQLS-DFQAELGRYNYITPTSYLELIATFQQLISQKRETIMNAKQRYINGLDQLAFAESEVAKMKKELVDLQPKLEQAKIDNTKMMEVIEVESIEVEAKSRVVHVDEEAAAMKANEAQALKSECENDLAEALPALEAALTALDTLKQPSDISIVKAMKNPPSGVKLVMAAVCVMKNVKPDRIPDPAGTGKKILDYWGPSKKLLGDMNFLRDLKEYDKDNIPVPVMQTIRNEFMTNPDFDPSKVANASSAAEGLCKWITAMEVYDKVAKVVAPKKAKLAEAQESLAATKAVLDQKRAELKEVEDRLTALQKTFEEKTEEKARLEMQVESCARKLERAEKLIGGLSGEKI-WSKAADDLQNTYDNLTGDVLISAGVIAYLGPFTSGFRQNCTKLWTTLCQSKNIPSSDDFSLSKTLGNPIEIRAWNIAGLPNDSFSIDNGVIVRNSRR-PLMIDPQGQANKWVKNLEKDNNLNVIKLTDGDYMRTLENCIQFGTPLLLENVGEELDPSLEPLLLKQTFK-QGVESIKLGERVIEYSADFRFYVTTRLKNPHYLPEVATKVSLLNFMITPEGLEDQLLGIVVA-KEPELEEERTALILQSANNKRQLKEIEDSILETLQSSKGNILEDESAIQILDSAKIMSNEITKKQQIQIAEKTELKIAESREGYREVAKHSSILFFSIADLTNIDPMYQYSLIWFVNLYINSIQDI-KSKVLKQRLEYLKDHFTYNLYCNVCRSLFEKDKLLFSFLLCCNLLARKEIEHSDL-MFLLTGGIGLQNTVANPDPSWLQDKSWDEICRASELPGFQGL-EAFIKNPEDFKLIYDSREP 3022          

HSP 2 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 396/656 (60.37%), Postives = 488/656 (74.39%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNS-RWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPED-SIQELADDIL-KKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            L  L K+I+ RC+RPD +VPAV  F+T NLG+ F+ PP FDL  SF DSN   PL+FVLSPGADPM ALLKF  D+  + S+  SISLGQGQGPIAAKMI  A+Q+G+WV LQNCHLA SWM +LEKICE+  +    H++FRLWLTSYPS  FPV ILQNGVKMTNE P GLR NLL+SYL DP+SD  FF+GC D    W  +LFGLCFFHALVQER+KFGPLGWNIPY FNESDL IS+RQ+Q F+N+Y ++P EA+TYLTGECNYGGRVTDD DRRLL++ L  FY  DI++  +YP SPSG Y++PP  + + YI++I +LPI+  PEV+GLHEN DI+KD Q+T  LF  +LLT    A G   S  D ++ ++A++IL ++LP  FD E ++ +YPV+Y ESMNTVL QE+ R+N L S +  +L NL KA+KGLVVM++ELE V  ++++GKVP  WA  SYPSLKPLGSY+ D + RL F   W EN  P  FW+SGF+FTQ+FLTGV+QNFARKY IPID + F+FE+   D S   +  PEDG  V GLFL+GARWDKE  +L E  P+ILF+S+PIIW+KP K   I   S Y+CP+YKTS R+GTLSTTGHSTNFV+ + L       HWI RGVA L QLDD
Sbjct: 3035 LTDLQKMIIFRCLRPD-MVPAVTKFVTRNLGKKFVQPPAFDLTKSFLDSNSTIPLVFVLSPGADPM-ALLKFASDKKMDGSRFQSISLGQGQGPIAAKMIFTAMQNGSWVCLQNCHLAVSWMSNLEKICEDFSLT-TCHQDFRLWLTSYPSPKFPVGILQNGVKMTNEQPTGLRLNLLQSYLTDPVSDPNFFNGCPDKKPVWEKLLFGLCFFHALVQERKKFGPLGWNIPYGFNESDLHISMRQLQQFVNEYDKVPFEAITYLTGECNYGGRVTDDWDRRLLMTTLADFYCEDIIKTFRYPLSPSGKYFAPPKSSYEDYIQFIENLPISQQPEVFGLHENVDISKDLQQTKLLFDSLLLTQGGGAMGGVSSGGDNTLYDIANNILTQQLPPTFDREAVLLKYPVLYEESMNTVLVQEMERYN-LCSTICVSLQNLLKALKGLVVMDSELEAVAGNLIVGKVPEKWAKFSYPSLKPLGSYITDFLARLKFLQVWYENGQPKVFWLSGFFFTQAFLTGVMQNFARKYQIPIDLLTFDFEVLPIDKS---ETPPEDGVYVNGLFLDGARWDKEG-VLTEQHPRILFDSMPIIWVKPEKKNMIQTDSLYVCPLYKTSERKGTLSTTGHSTNFVIAMMLSTKKRPQHWIKRGVAMLLQLDD 3682          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1466.06 bits (3794), Expect = 0.000e+0
Identity = 894/2591 (34.50%), Postives = 1433/2591 (55.31%), Query Frame = 1
Query: 1762 VKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIK-PTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQML--LDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNP----SCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQL--EIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDW----PGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQ----IDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVF-EGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKL-QHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPER-LTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFD-KKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF--EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFD--IVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTD----------------DKIYDEITSLKNLAKRMETFLDDYN-SISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLE--DIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEAD-------LAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIAL-LKGKNKVNDEIWRFLLTGGVALD-NPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            +K  ID+F    P+L+++ +  +  RHW +++++ G ++   +E   L + +     K+ E++E+I  +A KE  +E+ L ++  +W    F    +++ G  +L      +++  L+D ++   ++  + +  PF+ +++ W   L + +DII+ W+ VQ  W+YLE +F   DI  Q+P+E + F  +D +W ++M  + + P    SC+       +L  L +    L+  QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F E++   I+ + S E ET+ +     P  A+G VE WL  +      S+  VI  +  +  I   G  ++D+      Q+ +    + WT++  EA+T  +  +  + K N      ++ ++ +   +L + ER     L  I VH RD+ +++ +L + + + FEWL Q R+Y  +   ++ +        Y NE+LG T RLVITPLTDRCY TL  AL + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQ+G+W CFDEFNRIEL VLSV AQQI  +        K FVF +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FRSV+MMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P ++ ES ++ + + D+NL K + +D  LF  +I DLFPG++L K  +    +A+   + +  L  H  W + K++Q+YE   VRHG+M +G    GKT   Q L  A+T+       +E +     +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+     W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + LGW P +E +++   P     +  +++R LF         F   + +  ++  E   ++Q   +   L+      P  E+                    L+ L++F+ +WS G+ L    R K +++FR               I+ +     P R  T++D+     + G+W  W   ++          K + I++P  +  R  + +D      K V+++G  GT K+V++ +++ +   +  L   +NFS+ T+    Q  + + +D+R    YGPP  K+  + +DD+NMP   ++G Q   E++RQ ++   +++ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I + HF  + GF     R    LV  T  +++      LPTPAK HY+FNLRD SR+ +G+L      + +   L+ LW HE  RV  DR TM +D +++FD  + KL         +E+ LG      KVVD  V    F D++ D                 K+Y+ I S ++L  R+  FL  YN SI    M +V FQ AM H+ +V R+++   G+ALLVG+GGSG+QS TR+A+F+A ++IF I +TR Y      +DLK L   AG   K + F+++DN+IK+ESF+E ++ +L++G+V NL+  +E  EIL  +    + E  +       T   +Y+YF+ RV+ NLH+VL  SP+G+ FRNR   FP+LI+ CT+DWF  WP+DAL  V++ FL   DI+     +  +V     + + V +   ++    RR  +VTP SYL  I+ +K +   KR E++       TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+ EA  E++  E +    KA   Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP LI   M+ V ++L  +       +    I   W  S+ L+    FL  LK F  D++N + + +L + Y   P+++ +  R AS+   GL  W  A+  +    K V P K  LA+ E  L +    L + +A+LD  +A+L  +  + +E    K  L ++ + C +K+  A  LI GL GEK RWTE +K  + +   + GDVL++ A ++Y G F   FR+ ++  W  +  + +IP   +  + ++L +   +  WN+ GLP D  SI NGIIV  + R+PL IDPQ Q   WIKN E  N L I  L    F   LE S+  G P+L+E+VGEEL+P+L+ +L+K   +      +++GD  ++  K FK Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG V   EK E+E+++  L+ +   NKRK+KELED +L  L+S+QG+++++E+ I VL ++K  ++E+++K  IA  TQ++I+  R  Y+PVA  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+  S KS +   RI+ + ++ T  VY    R L+E HK LF+L + + + ++GKN  + E    L+ GG +LD    P     W+ D  W  +V  S+L     + +   ++   WKS +D ++PE
Sbjct:  966 LKRTIDEFSECCPLLELMTSKAMMARHWKRITEVTGHNLDVESENFKLRNIMEADPLKYKEEIEDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLMSNRYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQ---LDSCQKSLTGYLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKIYDRILAVSSREKETMELDR---PITAEGNVEVWLNALLKESQRSLHLVIRQA--ALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTDRCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANP-SDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKL-KVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQ--PHREMR-----MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSP-----NEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI------PLKEQCGELPREH------------LERLYIFALMWSAGALLELEDRKKMELWFR-----------GNDVIRRSLPEIPPGREETMFDYYV--TAEGHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDD-VEWFDQTLAKL---------VEQQLGE--EHKKVVDCGVERY-FVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRLYNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRR----PPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVMN------TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEV---TVKAEAS-ELVKVEVQKVKDKA---QAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETV-ELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLT-LIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQISHHEKLWKSWFDKEAPE 3471          

HSP 2 Score: 426.402 bits (1095), Expect = 1.076e-118
Identity = 238/668 (35.63%), Postives = 383/668 (57.34%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSY--LNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPL---EALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPR-QASGEGKSPEDSIQELADDILKKLPEN---FDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARK-YTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQL 11350
            LP+ ++ L    +L+++RC  PD+ +   + +I D +G+ + +    D+  ++ +SN  +PLI  LS G+DP ++++  G+           +S+GQGQ   A K++ Q + +G W +LQNCHL  ++M   +++ + +I  E  + +FRLW+T+   ++FP+++LQ  +K TNEPP+GL+A L R+Y  +N  + D       ++ ++W  ML+ + F H+ VQERRKFGPLGWNIPYEFN++D   +V+ +Q  L+D     L     + Y+ GE  YGGRVTDD D+RLL +  ++++N ++ E++   +   GI   P   +   Y+ YI+ LP    PEV+GLH NADIT  +++   +   IL   P+  +SG G++ E ++  +ADD+L+KLP +   F+++ + K  P+   + MN  LRQE+ R  ++I +VRSTLI+L+ AI G ++M+  L +  + M   ++P  W  KS+ S   LG +  +L++R   F  W+    P+ FW++GF+  Q FLT + Q  AR      +D +    E+T +    DI   P  G  VYGL+LEGA WD+ N  L ES PK+LF  +P+IW+     V  D    Y CP+YK   R           N + ++ L       HW+ RGVA LC +
Sbjct: 3475 LPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETR---YVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFM---DELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLD------VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGI---PKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARW-MKSWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKW-MKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVVKD-PRLYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVALLCDV 4112          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 752/2097 (35.86%), Postives = 1177/2097 (56.13%), Query Frame = 1
Query: 3190 TPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVF-EGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKL-QHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERL-TIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFD-KKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF--EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGN-GEKLMRLWVHEVYRVFYDRLTMEEDRLKFFD--IVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDD----------------KIYDEITSLKNLAKRMETFLDDYN-SISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLE--DIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEAD-------LAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIAL-LKGKNKVNDEIWRFLLTGGVALD-NPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            T L   CY TL  AL + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQ+G+W CFDEFNRIEL VLSV AQQI  +        K FVF +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FRSV+MMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P ++ ES ++ + + D+NL K + +D  LF  +I DLFPG++L K  +    +A+   + +  L  H  W + K++Q+YE   VRHG+M +G    GKT   Q L  A+T+       +E +     +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+     W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + LGW P +E +++   P     +  +++R LF         F   + +  ++  E   ++Q   +   L+                   +K+    N +L  + L++F+ +WS G+ L    R K +++FR               I+ +     P R  T++D+    +  G+W  W   ++          K + I++P  +  R  + +D      K V+++G  GT K+V++ +++ +   +  L   +NFS+ T+    Q  + + +D+R    YGPP  K+  + +DD+NMP   ++G Q   E++RQ ++   +++ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I + HF  + GF     R    LV  T  +++      LPTPAK HY+FNLRD SR+ +G+L   H++     + L+ LW HE  RV  DR TM +D +++FD  + KL         +E+ LG      KVVD  V    F D++ D                 K+Y+ I S ++L  R+  FL  YN SI    M +V FQ AM H+ +V R+++   G+ALLVG+GGSG+QS TR+A+F+A ++IF I +TR+         LK L   AG   K + F+++DN+IK+ESF+E ++ +L++G+V NL+  +E  EIL  +    + E  +       T   +Y+YF+ RV+ NLH+VL  SP+G+ FRNR   FP+LI+ CT+DWF  WP+DAL  V++ FL   DI+     +  +V     + + V +   ++    RR  +VTP SYL  I+ +K +   KR E+  L NR  TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+ EA  E++  E +    KA   Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP LI   M+ V ++L  +       +    I   W  S+ L+    FL  LK F  D++N + ++ L + Y   P+++ +  R AS+   GL  W  A+  +    K V P K  LA+ E  L +    L + +A+LD  +A+L  +  + +E    K  L ++ + C +K+  A  LI GL GEK RWTE +K  + +   + GDVL++ A ++Y G F   FR+ ++  W  +  + +IP   +  + ++L +   +  WN+ GLP D  SI NGIIV  + R+PL IDPQ Q   WIKN E  N L I  L    F   LE S+  G P+L+E+VGEEL+P+L+ +L+K   +      +++GD  ++  K FK Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG V   EK E+E+++  L+ +   NKRK+KELED +L  L+S+QG+++++E+ I VL ++K  ++E+++K  IA  TQ++I+  R  Y+PVA  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+  S KS +   RI+ + ++ T  VY    R L+E HK LF+L + + + ++GKN  + E    L+ GG +LD    P     W+ D  W  +V  S+L     + +   ++   WKS +D ++PE
Sbjct:   13 TYLMTWCYITLAQALGMCMGGAPAGPAGTGKTETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFKGLAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANP-SDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKL-KVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTECGQ--PHREMR-----MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKGEHIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSP-----NEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLIP------------------LKVRLKLNQHL--ERLYIFALMWSAGALLELEDRKKMELWFR-----------GNDVIRRSLPEIPPGREETMFDYYVTAE--GHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIFGVIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNHSSRNIIFQVLLALWKHECKRVIADRFTMPDD-VEWFDQTLAKL---------VEQQLGEEH--KKVVDCGVERY-FVDFLRDPPEATGEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTRSGLLEGLIAYLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRR----PPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDALVEVSHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFLRYRRSTHVTPKSYLSFIQGYKTIYVEKRAEVQMLANRMNTGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEV---TVKAEAS-ELVKVEVQKVKDKA---QAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETVE-LLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLVGDVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWNLQGLPNDELSIHNGIIVTKAARFPLLIDPQTQGKTWIKNKEAKNELQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLGRVILTEKREMEKERTDLLEDVTYNKRKMKELEDNLLYRLTSTQGSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRPVATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLARSSKSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEFLT-LIKGGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQVHHHEKLWKSWFDKEAPE 2036          

HSP 2 Score: 427.557 bits (1098), Expect = 2.004e-119
Identity = 239/677 (35.30%), Postives = 386/677 (57.02%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSY--LNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPL---EALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPR-QASGEGKSPEDSIQELADDILKKLPEN---FDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARK-YTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWL---------KPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQL 11350
            LP+ ++ L    +L+++RC  PD+ +   + +I D +G+ + +    D+  ++ +SN  +PLI  LS G+DP ++++  G+           +S+GQGQ   A K++ Q + +G W +LQNCHL  ++M   +++ + +I  E  + +FRLW+T+   ++FP+++LQ  +K TNEPP+GL+A L R+Y  +N  + D       ++ ++W  ML+ + F H+ VQERRKFGPLGWNIPYEFN++D   +V+ +Q  L+D     L     + Y+ GE  YGGRVTDD D+RLL +  ++++N ++ E++   +   GI   P   +   Y+ YI+ LP    PEV+GLH NADIT  +++   +   IL   P+  +SG G++ E ++  +ADD+L+KLP +   F+++ + K  P+   + MN  LRQE+ R  ++I +VRSTLI+L+ AI G ++M+  L +  + M   ++P  W  +S+ S   LG +  +L++R   F  W+    P+ FW++GF+  Q FLT + Q  AR      +D +    E+T +    DI   P  G  VYGL+LEGA WD+ N  L ES PK+LF  +P+IW+         K  K+V   R   Y CP+YK   R           N + ++ L       HW+ RGVA LC +
Sbjct: 2040 LPNSYQSLDCFRRLLLIRCWCPDRTIAQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETR---YVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFM---DELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGGINQDLLD------VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGI---PKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEVKRLQKMGPL---KPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKESWAS-STLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKW-MKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNGSSEKKKKIVKDPR--LYSCPIYKKPTR--------TDINCIASVGLKTTQPPEHWVLRGVALLCDV 2686          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1193.33 bits (3086), Expect = 0.000e+0
Identity = 813/2591 (31.38%), Postives = 1318/2591 (50.87%), Query Frame = 1
Query: 1762 VKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSIL---SALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNP----SCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLE-IIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDW----PGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQ----IDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVF-EGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKL-QHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPER-LTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFD-KKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF--EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFD--IVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDD---------------KIYDEITSLKNLAKRMETFLDDYN-SISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTR---EAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEAD-------LAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIAL-LKGKNKVNDEIWRFLLTGGVALD-NPYPNPAPNWMSDKLWSEMVRASELPSIKG-LREHFQNNTDKWKSMYDSQSPE 9369
            +K  ID+F    P+L+++ +  +  RHW +++                              E+I  +A KE  +E+ L ++  +W    F    +++ G  +L   S  + I  L D  ++    M  S +  PF+ +++ W   L + +DII+ W+ VQ  W+YLE +F   DI  Q+P+E + F  +D +W ++M  + + P    SC+       +L  L +    L+  QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F E+ + I+ + S E ET+ +     P  A+G VE WL  +      S+  VI  +  +  I   G  ++D+      Q+ +    + WT++  EA+T  +  +  + K N      ++ ++ +   +L + ER     L  I VH RD+ +++ +L + + + FEWL Q R+Y  +   ++ +        Y NE+LG T RLVITPLTD                           ET KD+ + + K  VVFNCSD +D++ +G+ FK LAQ+G+W CFDEFNRIEL VLSV AQQI  +        K FVF +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FRSV+MMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P ++ ES ++ + + D+NL K + +D  LF  +I DLFPG++L K  +    +A+   + +  L  H  W + K++Q+YE   VRHG+M +G    GKT   Q L  A+T       M+        +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+ +   W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + LGW P +E +++   P     +  +++R LF         F   + +  ++  E   ++Q   +   L+  ++ Q      E                  L+ L++F+ +WS G+ L    R K +++FR               I+ +     P R  T++D+     +  +W  W   ++          K + I++P  +  R  + +D      K V+++G  GT K+V++ +++ +   +  L   +NFS+ T+    Q  + + +D+R    YGPP  K+  + +DD+NMP   ++G Q   E++RQ ++   +++ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I + HF  + GF     R    LV  T  +++      LPTPAK HY+FNLRD SR+ +G+L      + +   L+ LW HE  RV  DR TM +D +++FD  + KL         +E+ LG      KVVD  V    F D++ D                K+Y+ I S ++L  R+  FL  YN SI    M +V FQ AM H+ +V R+++   G+ALLVG+GGSG+QS TR+A+F+A ++IF I +T  Y      +DLK L   AG   K + F+++DN+IK+ESF+E ++ +L++G+V NL+  +E  EIL  +    + E  +       T   +Y+YF+ RV+ NLH+VL  SP+G+ FRNR   FP+LI+ CT+DWF  WP+DAL + ++ FL   ++D + +   E +  M  F      +  + F+N                                       TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+ EA  E++  E +    KA   Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP LI   M+ V ++L  +       +    I   W  S+ L+    FL  LK F  D++N + + +L + Y   P+++ +  R AS+   GL  W  A+  +    K V P K  LA+ E  L +    L + +A+LD  +A+L  +  + +E    K  L ++ + C +K+  A  LI GL GEK RWTE +K  + +   +  DVL++ A ++Y G F   FR+ ++  W  +  + +IP   +  + ++L +   +  WN                                             L I  L    F   LE S+  G P+L+E+VGEEL+P+L+ +L+K   +      +++GD  ++  K FK Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG                                     V+ + + +++++E+ I VL ++K  ++E+++K  IA  TQ++I+  R  Y+P A  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+ +S KS +   RI+ + ++ T  VY    R L+E HK LF+L + + + ++GKN  + E     L  G +LD    P     W+ D  W  +V  S+L      L +   ++   WKS +D ++PE
Sbjct: 1193 LKRTIDEFSECCPLLELMTSKAMMARHWKRIT------------------------------EDICISAVKERDIEQKLKEVITEWDNKTFTFAGFKNRGELLLRGDSTSELIASLEDSLMVLGSLM--SNYNTPFKAQIQKWVQYLSNTSDIIEHWMIVQNLWIYLEAVFVGGDIAKQLPKEAKLFSSIDKSWMKIMTRAHEMPNVVQSCVGDVTMGQLLPHLLEQ---LDSCQKSLT-YLEKKRLLFPRFFFVSDPALLEILGQASDSHTIQAHLLNVFDNIKSVQFHEKYDRILAVSSREKETMELDR---PITAEGNVEVWLNALLKESQRSLHLVIRQA--ALAIQNEGFELIDFLNSFSAQVGLLGIQMIWTRDSEEALTNAHYDRGIMSKTNQHFLNLLNTLIDMTTKDLGAVERTKYETLITIHVHQRDIFDDLCRLHIDNPSDFEWLKQCRFYFNEDSDKMTINITDVSFDYQNEFLGCTERLVITPLTD---------------------------ETIKDMGRCLGKYVVVFNCSDQMDFRGLGRIFK-LAQSGSWGCFDEFNRIELPVLSVAAQQIAIVLTCKKDRHKTFVFTDGDSVDMNPEFGIFLTMNPGYAGRQELPENLKINFRSVSMMVPDRQIIIRVKLASCGFIDNVKLACKFFTLYKLCEEQLSKQVHYDFGLRNILSVLRTLGAAKRANP-SDTESTIVKRVLKDMNLSKLIDEDEELFLSLIEDLFPGIELNKEGYPELEAAIDKKIQETGLINHPPWKL-KVIQMYETQRVRHGMMALGPSGSGKTTCIQILMKAMTCGQPHREMR--------MNPKAITAPQMFGRLDVATNDWTDGIFSTLWRKTLKAKKE-HIWIVLDGPVDAIWIENLNSVLDDNRTLTLANGDRIPMAPNCKVVFEPHNIDNASPATVSRNGMVFMSSSVLGWSPILEGWLKQRSP-----NEAEVLRQLFSSSFSELYRFSVQSLEFKMDMLEAFVIMQCINMLQGLI-PLKEQCGELPREH-----------------LERLYIFALMWSAGALLELEDRKKMELWFR-----------GNDVIRRSLPEIPPGREETMFDYYV---TAEHWVHWSTRVEEYIYPPDVTPKYSSILVPNVDNVRTDFLIDTISKQGKAVLLIGEQGTAKTVIMKSFMSKYDPEIQLGKCLNFSSATTPLMFQRTVESYVDKRMGTTYGPPAGKKMSILIDDINMPVVNEWGDQVTNEIVRQLMEQKGFYNLEKPGEFTNIVDVQFLAAMIHPGGGRNDIPQRLKRQFSIFNCTLPSNASIDKIF-VIGEGHFCAQRGFIEEVQRTIPQLVLLTRRLWQLTKIKMLPTPAKFHYIFNLRDLSRIWQGMLCTNAEVINSVHVLLALWKHECKRVIADRFTMPDD-VEWFDQTLAKL---------VEQQLGE--EHKKVVDCGVERY-FVDFLRDPPEATEEPEESDFDMPKVYEPIESFESLKDRLNMFLCQYNDSIRGNGMDMVFFQDAMIHLIKVSRIIRTPGGNALLVGVGGSGKQSLTRLASFIAGYKIFQITLTL-YNTTNLMEDLKSLYRIAGHQGKGISFIYTDNEIKEESFLEYMNNVLSSGEVSNLFARNEMDEILSDLVPVMKREFPRR----PPTNENLYDYFMSRVRHNLHVVLCFSPVGEKFRNRALKFPALISGCTMDWFSRWPKDAL-VESHHFLSAFDIDCSPQVKSEVVQCMGSFQDCVAEKCVDYFMN---------------------------------------TGLQKLKEASESVAALSKELEVKEKELQIANEKADMVLKEV---TVKAEAS-ELVKVEVQKVKDKA---QAIVDSITADKAIAEEKLEAARPALEEAEAALQTIKPSDIATVRTLSRPPPLIMQTMDCVLLLLRRRVNPVEINAETNFITSSWQESLNLMTSGSFLSELKQFPKDTINEETV-ELLQPYFNLPNYNIERARTASSNVAGLLSWTKAMASFFAINKEVLPLKANLAVQENRLAVANLDLEKAQAELDAKQAELNVVRAEYEEAMTEKLTLLEDAKRCRRKMQIASNLISGLAGEKERWTEQSKEFAAQTKRLV-DVLLATAFLSYSGPFNQEFRSLLLNEWQCELKQRSIPFGNNLDITELLIDASTVSEWN---------------------------------------------LQITSLNHKYFRNHLEESLSLGRPLLIEDVGEELDPVLDNVLEKNFIKTGSTYKVKIGDKEVDVMKGFKLYMTTKLPNPAYTPEISARTSIIDFTVTIRGLEDQLLG------------------------------------RVILTEKRSLVDDESLIVVLGNTKQTAEEVNQKLQIAGDTQIQINAAREEYRP-ATRGSILYFLITEMSMVNVMYQTSLTQFLGLFDLSLASS-KSSNTSERIKSIIEYMTFKVYYYAARGLYEEHKFLFTLLLTLKIDMQGKNVTHKEF--LTLIKGASLDLKTCPQKPAEWILDMSWLNLVELSKLWQFSEILDQQISHHEKLWKSWFDKEAPE 3513          

HSP 2 Score: 420.239 bits (1079), Expect = 6.463e-117
Identity = 234/668 (35.03%), Postives = 380/668 (56.89%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDK-IVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSY-LNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPL---EALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPR-QASGEGKSPEDSIQELADDILKKLPEN---FDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARK-YTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQL 11350
            LP+ ++ L    +L+++RC  PD+ I    + +I D +G+ + +    D+  ++ +SN  +PLI  LS G+DP ++++  G+           +S+GQGQ   A K++ Q + +G W +LQNCHL  ++M   +++ + +I  E  + +FRLW+T+   ++FP+++LQ  +K TNEPP+GL+A L R+Y +N  + D       ++ ++W  ML+ + F H+ VQERRKFGPLGWNIPYEFN++D   +V+ +Q  L+D     L     + Y+ GE  YGGRVTDD D+RLL +  ++++N ++ E++   +   GI   P   +   Y+ YI+ LP    PEV+GLH NADIT  +++   +   IL   P+  +SG G++ E ++  +ADD+L+KLP +   F++++  +   +   + MN  LRQE+ R  ++I +VRSTLI+L+ AI G ++M+  L +  + M   ++P  W  +   +   LG +  +L++R   F  W+    P+ FW++GF+  Q FLT + Q  AR      +D +    E+T +    DI   P  G  VYGL+LEGA WD+ N  L ES PK+LF  +P+IW+     V   R   Y CP+YK   R           N + ++ L       HW+ RGVA LC +
Sbjct: 3517 LPNSYQSLDCFRRLLLIRCWCPDRTIAQQARKYIRDAMGEKYTEGVILDVEGTWEESNPRTPLICFLSMGSDPTDSIIALGKKLKIETR---YVSMGQGQEVHARKLLQQTMANGGWALLQNCHLGLNFM---DELMDTVIETECINDSFRLWITTEVHKNFPITLLQMSIKFTNEPPQGLKAGLKRTYGINQDLLD------VSNTNQWKPMLYCVAFLHSTVQERRKFGPLGWNIPYEFNQADFNATVQFIQNHLDDMDTKQLVSWNTVQYMIGEIQYGGRVTDDYDKRLLNTFSKVWFNKNMFERDFNFYKGYGI---PKCSSVDQYLAYIQGLPAYDTPEVFGLHPNADITFQSKQAKDVLDTILSIQPKDSSSGGGETREAAVSRMADDMLEKLPPDYIPFEIQVRERLQKMGPLKPMNIFLRQEIDRMQRVIMLVRSTLIDLKLAIDGTIIMSENLRDALDCMYDARIPARWMKQESWASSTLGFWFTELLERNRQFQTWLFKGRPNCFWMTGFFNPQGFLTAMKQEIARANKGWALDRMVLCNEVTKW-MKDDIPHPPAKGVYVYGLYLEGASWDRNNCRLTESKPKVLFEMMPVIWMYAENNVKDPR--LYSCPIYKKPTRT--------DINCIASVGLKTTQPPEHWVLRGVALLCDV 4158          
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 634/1922 (32.99%), Postives = 1026/1922 (53.38%), Query Frame = 1
Query: 1492 EQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIG--FDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELT---EYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPS---CLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEF----TEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPN-----GLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTL-LLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLV-PHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMT-----DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTG-LEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQD 7176
            E L K   +L+ + +++P + ++ K L   S+++            W +  +   +   +++ I    + + +L K     P    VA  +   + +F+  L +L  + N  +++ HW+++ +  G  FD+   +  +L    +  LHK+   ++EI  +A KE  +E T       WK  KF +    +     V +L A+D+I + LD+ ++K Q M GS F  PF   ++ WE  L   ++ I++WL+VQ  W+ LE IF  EDI +Q+PEE +K   +   + E+M  +   P+   C    G+   L  L +    LE IQK L ++L+ KR  FPRFF +S+DELL +L    DP  +Q H+ K ++ I  L      + Q  +  M+S EGE +    K  P +A+  VE W++ V   M  + + +  +++  YV      W+  +   +V+  + ++WT EV  AI   N      LK Y  + + QID++V  +       +R+ +  + V DVHARD+V+N     +  V+ FEW SQLR+Y       ++V Q +T L YG EY+G   RL ITPLT R Y TL  AL + LGGA  GPAG GKTET KDLAKA+   CVV +C++ +D   +GK   GLA+ G W CFDEFNRI   VLSVV+ QIQ+I+ A+    K F FEG ++SL+    ++ITMNP Y  R ELP+++KV FR V ++ PD   I EI L+S GF+ A+ LA K+   Y+    QLS Q HYD+G+ + KSVL  AG +++   +  +E ++L++A+ D+NLPK +S+D+P+F G+ISD+FPG+D  +  F  F   V++ L K         +DK++QIYE++L +   MIVG+  GGK+    TL  A T                 +NPKA ++ +LYG FDP + +WTDG+ + +FRE   + D + ++++FDG VD+ W+ENMN+VLDDNK L L +G+ I++ +   L+FE  DL+ ASPATVSRC +++++P  L + P+ + +++  L              LFE  +  C+D +  N + ++  ++++ V QL  +   LL+   +   V                      L+  FL +   S+G++L+ESGR KFD    +L   ++ L               P   T+YDF F+ ++   W  W + +       +P  K  + I+PT +T R  + L+  +  ++PV++VG  GT K+ +I N L     D  ++  INFS++T++   Q  +   +++R K  YGPP  K+ +VF DD+NMP  + +G Q P+ LLR  +D G  +D+K       I  L  ++AM   GGGRN+V  R +  F+V  +      ++  I+ +I+  H    F      + + +   T+ ++   I    PTP+K HY F+ R+ SR+  G+ L  P  +    E+ +R+W +E  R F+DRLT E D+      +K    + F+T+ E +L                ++FGDY       + ++Y++I               DY+ +SKA   L  F+ A+EH++RV R+L+ D GHALL+G  GS  Q+ T++AAF AD E+F I + R Y +  +R+DLK L +K G + +  VFLF+D  I +E F+E I+ +L    VP L+  DEK  I++++ + A  E   + ++      +++ YF+ +   NLHIVL +S  GDA + R R FP L++   IDW+  W   AL  VA   LE+  + +    A++      H S+   S++ L   +R NY T  S+L+ I ++  LL  ++NE + L+ + L G L +L  A +++ ++ ++L   +  L   +A     L +++++
Sbjct: 1067 EHLTKTAKLLDLQLAEYPEIISIQKYLSGLSQIYNIYKAHKEAKTKWSQTLWVNFDIKLLQDGIDGFIESLMQLSKDVQTLP----VAFFLDSHLKEFRVSLSLLLDLKNTALRD-HWNKLMERTGKSFDMN-LQRFTLETLFSLELHKYANDIDEIVTSALKELSIEMT-------WKRTKFNMQPQLKVNQERVFLLGAVDNILVNLDNDVMKLQCMAGSRFGGPFLDAIQQWEKNLTLFSETIEIWLQVQHKWMNLENIFCGEDICSQLPEEAKKLKKITKKFTEIMKSTENEPNIKKCCTVPGRLSSLWVLRND---LERIQKNLANHLDSKRNEFPRFFLISDDELLNVLGSV-DPACIQEHVIKMYDNIESLRLGVDSSGQTVVGAMVSNEGEVMEF-RKPVPLEAR--VEDWIMAVLQEMKRTSRLITKEAVYHYV-----DWIRSYQCMMVLAANRVWWTWEVENAIKNVNKGDKYALKKYAEQIHRQIDELVTCLGRPTKESDRLKISNVLVTDVHARDIVDNFVGRSIKEVHDFEWESQLRFYWVKEHDSLFVRQCNTSLSYGYEYMGLNGRLAITPLTSRIYLTLTQALSMYLGGALAGPAGAGKTETVKDLAKALGLFCVVTHCTEDMDTITLGKIISGLAKCGFWGCFDEFNRIGASVLSVVSSQIQAIRNALTSHFKMFQFEGQQISLDDHMGIYITMNPSYERRPELPESVKVFFRPVVVVTPDVQQICEIMLFSQGFLQAKELAKKMTVLYKTAGIQLSKQPHYDFGLHSQKSVLKMAGKMKRDSLEL-SEDVVLMRALRDINLPKLVSEDVPVFLGLISDIFPGLDSSRVGFPSFRETVEEILQKSNYTILPDQVDKVVQIYEIMLTQQATMIVGQTCGGKSVVINTLCQAQTLGLCTKLYP--------LNPKATSVDELYGSFDPETRDWTDGIFSKLFREINQSTDKKERYILFDGDVDSQWLENMNSVLDDNKLLTLANGDRIRLQSHCALLFEVGDLQHASPATVSRCAVVFIDPKHLSYTPYWQRWMKNRL------------NRLFEKYVPSCID-VTLNSETIVPRTDVNMVSQLCLMLDVLLESKNSSAEV----------------------LECYFLEALYCSLGATLVESGRLKFD----KLVKSLSCLSTVDDEKAAAGPGEIPYLPTLYDFHFD-ETQEKWVPWSSLVPEYIH--NPAMKFAD-ILPTVDTTRTHWILEQMVKIKRPVLLVGECGTSKTAIIQNLLKNTSTDSSISLTINFSSKTTSLDLQRNLEANIEKRTKDTYGPPIGKKLLVFFDDINMPKVDDFGTQQPVALLRLLLDQGGLYDRKQKLSFKTIKDLGYIAAMRKTGGGRNEVDPRFLSLFSVFNIPPPATESLHLIYASIIKGH-TRPFKAAIQEVCQTITECTLKLFTTIITDLPPTPSKFHYTFSQRELSRIYCGLTLTKPDFSCLTVEQFVRVWRNECLRNFHDRLTDETDKALVHGHIKKLVEEYFETDSEAVLAD-------------PILFGDYRAAREECEQRVYEDI--------------GDYD-VSKAIFQL--FEDAVEHLTRVHRILRSDRGHALLIGADGSWTQALTKLAAFTADCEVFEIILRRGYNELNFRNDLKTLYLKLGIENRRTVFLFTDAHIVEEGFLEQINNML-ISMVPTLFADDEKESIIKQINSEALQEGAGSSKE------SVWQYFLRKSANNLHIVLCLSATGDALKTRCRNFP-LMSNTVIDWYLPWSAQALHAVAQCVLENPTIPKAHFGAVIDHICMVHASLCDFSKQLLLKHQRCNYATSKSFLDFISSYSTLLE-EKNEHV-LQCKCLEGSLNRLREAREQIDELNLKLADQKVVLAKKTATCTAFLEEIDKN 2870          

HSP 2 Score: 373.629 bits (958), Expect = 0.000e+0
Identity = 214/655 (32.67%), Postives = 349/655 (53.28%), Query Frame = 2
Query: 9398 LQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTE-----LPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVE--KEKYPFSPSGIYYS-PPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDW-IENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVA 11335
            L    KL++LRC+R D++  A+  ++T  +G   + PP  +  + +  S   SP++F++S G+DP   L+KF E  G   +K   I++GQGQ  +  K++++A+  G+W++LQNCHL   W+K LEK  E+I  P   + NFR+W+T+   +DFP+ ILQ   K+  EPP+ ++ N+  +Y    IS  +    C  +  + ++++ L FFHA+VQER K+G  GW++P  FN+SD   S+  +  +L    E     +P E+L YL GE  YGGR  D  DRR+L   +  ++   +    +  + F    + Y  PP G   +Y E I  +P+   PEV GL    +I    Q   ++++ + +  P    G G   ++ I  +A DI K+LPE FD+ ++ +      S + + VL QEL RFNKL+  ++ +++ L +A+ G V M+ E +++ ++     VP  W   +  +LK L  +++ L +R   + +W +    P   W+SG +  +S+L  V+Q   RK   P+D+  F  E+T +    DI  R +    + GLFLEGA WD EN  L  S PK+L   +PI+ + P +  ++   +T   PVY TS RR            V   DL   +  +HW+  GV 
Sbjct: 3535 LSAFQKLLLLRCLRADRLHRAMADYVTVTMGNC-VHPPLINFTTIYERSTAFSPIVFIMSSGSDPTTDLIKFAEKSG---TKFTLIAVGQGQEQVVLKLLEKAVSIGSWLILQNCHLLVKWLKDLEKALEKITNP---NINFRMWITTNAIDDFPIGILQKSQKVVAEPPEDIKLNMKATY--SKIS-QQTLSSCQ-HPAFCSLVYVLAFFHAVVQERSKYGKTGWSVPCNFNDSDFSASLEVLSTYLTKCHEQGDSFIPWESLQYLIGEVVYGGRAIDSFDRRILKVYMDEYFGDFLFSPFQHFHFFRNKDVGYKIPPPGRKHVYTE-IEKMPLITTPEVAGLPSTVEIGYYTQAVEEMWTHLRVLQPETQVGRGIGGDEHISHIAQDIQKQLPELFDINLVGEELGTDLSPT-SVVLLQELRRFNKLVLCMQQSVVELLRALTGEVGMSKESDDLAHAFCNDLVPAMWKRLAPETLKSLDDWMSHLRRRYEQYSNWQVREGEPKVMWLSGLHVPESYLAAVVQAACRKKGWPLDQSTFHTEVTRYRTEDDIDDRLKQ-CYLSGLFLEGADWDMENGCLARSKPKVLVVELPILKVIPVQKNSLRLRNTLRTPVYTTSLRRN-----ASGAGLVFEADLFTTMHTSHWVLSGVC 4170          

HSP 3 Score: 338.961 bits (868), Expect = 0.000e+0
Identity = 223/717 (31.10%), Postives = 387/717 (53.97%), Query Frame = 1
Query: 7246 ESQEIKDDCEADLAEAMPILRDAMASLDT-LKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVV-EGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRL-SIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFL---LTG-GVALDNPYPNPAPNWMSDKLWSEMVRASEL--PSIKGLREHFQNNTDKWKSMYDSQSPE 9369
            E++E  D+    LA+   +L    A+    L++ D     S   PP  +++V E + ++ G+K             E  W ++ K++ +  FL  L     DS++   I  +  K++       + +++ S A  G+ K++ +   Y   AK V PKK ++   EKE   +  +L   K  L+ ++ +   L ++ ++    K+   D  +L  ++L  A++L+ GL  E+  WT+  + L +++  + GD L++AA ++Y G F   FRN++V + W +   +  IP S+ FK+ + L   ++I +W   GLP D  S+ NGI+    +R+PLCIDPQ QA  WIKN EK N L  +  L D +F++ LE SI++G P LL++V E+++PI+  +L++ +   +G   + LGD  + Y+ +FK ++ T L NP Y P +  K  ++N+  T +GLEDQLL +     +   +++  +L+ E ++NK  LK L D +L  L +S GN+L+N   I  L  +K  + E  +K ++A+   VE    R GY+PVA  G++LFF +SDMA ++ MYQYSL  +++LF +S++ S    +L+ R+E + +  T +V+      LF  HKLLFS+ M + + + +  V  +   FL   L+G G  +  P+      W+ D+ W ++ + +EL       L    + N+  WKS +D ++PE
Sbjct: 2834 EAREQIDELNLKLADQKVVLAKKTATCTAFLEEIDKNQTISFAKPPKQVQVVCECILVLRGKK-------------ELNWLTAKKMMSEAGFLHSLMQMDCDSISNSHISTI--KFLKNLQTSVEEMQSISKAGSGILKFVESFMSYWDIAKEVQPKKDQVKRLEKEFLQSKAELECIKNDLNNMQKEASSLKEKYEDANLEKELQLDEAKLMERRLTAADKLVLGLTSER-EWTKDLEELKQQHECLLGDCLIAAAFLSYAGAFNWDFRNNMVYDKWTQDVKQKGIPLSQPFKIENFLTNQLEI-SWGSEGLPPDEQSVQNGILTTKGSRFPLCIDPQQQALNWIKNKEKDNNLKQVSSLNDPDFLKQLELSIKYGYPFLLQDVNEDIDPIIINVLERNVVVSEGRTVIVLGDKEVNYDPNFKLFLHTTLANPQYSPSVFEKALVINYS-TLRGLEDQLLSVTTGFLEKVFQQQHLLLVEEISENKTLLKSLGDSLLMELGTSTGNMLDNTELIQTLEKTKTEASETIKKLSVAQSKTVEFANLREGYRPVAKRGAVLFFALSDMALVNRMYQYSLTSYLSLFELSLQESLAHPNLQQRLENIINTLTYNVH----NYLFGKHKLLFSMNMTVKIEQTEGGVPQKELDFLIKNLSGDGTKVQKPH-----EWIPDQAWQDITKLAELFPEQFSSLPSDIEQNSTNWKSWWDLRAPE 3523          
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000040511.1 (SMESG000040511.1)

HSP 1 Score: 3420.56 bits (8868), Expect = 0.000e+0
Identity = 1691/1712 (98.77%), Postives = 1692/1712 (98.83%), Query Frame = 1
Query: 4237 MGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL 9372
            MGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIE    GRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQE+ANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKLQDLTDQLDETQQRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEM IPCSESFKMMDIL               VDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAKEKPELEEKKNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL
Sbjct:    1 MGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIE----GRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEEANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKLQDLTDQLDETQQRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMKIPCSESFKMMDIL---------------VDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAKEKPELEEKKNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL 1693          

HSP 2 Score: 1332.01 bits (3446), Expect = 0.000e+0
Identity = 643/660 (97.42%), Postives = 644/660 (97.58%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLAT                +NTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD
Sbjct: 1696 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLAT----------------KNTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 2339          
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000040511.1 (SMESG000040511.1)

HSP 1 Score: 3370.87 bits (8739), Expect = 0.000e+0
Identity = 1669/1690 (98.76%), Postives = 1670/1690 (98.82%), Query Frame = 1
Query: 4303 MFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL 9372
            MFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIE    GRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQE+ANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKLQDLTDQLDETQQRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEM IPCSESFKMMDIL               VDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAKEKPELEEKKNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL
Sbjct:    1 MFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLVRLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGKVVDEDVRGLIFGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIE----GRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEEANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKLQDLTDQLDETQQRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMKIPCSESFKMMDIL---------------VDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAKEKPELEEKKNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL 1671          

HSP 2 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 643/660 (97.42%), Postives = 644/660 (97.58%), Query Frame = 2
Query: 9377 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLAT                +NTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD
Sbjct: 1674 LPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLAT----------------KNTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 2317          
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3041.91 bits (7885), Expect = 0.000e+0
Identity = 1598/3118 (51.25%), Postives = 2142/3118 (68.70%), Query Frame = 1
Query:  106 GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIKIHKNGNNFGVEFDELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQR--LFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKE---RHGLLALKKKIDAYQDL-KDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITV-PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNC-KKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGG-----------INPLYPKPKSIKLTKSNSFPERLTIYDFCF----EKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF-EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLI---FGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
             F N R +++ E   +   ++  DF++   R        L   WL     ++         L+P  S  +   ++ FF   ++LM++ L+N+   S+ D+T  ++   +  N           + P  ++ L + +  I ++PS ++ + LL+  Y  +++    + R+E  L+ +  G +  ++L  +I  E ++  +         D +VGP  ++  + KY +L+N + + E+   L E   RH      K +  Y DL K      R S+ L +F L    L   + KR   + E L+   +E +R+ NR + + Y++I  K   +P +TE ++ + +F+ +     +  L+++ +++ ERL+FL+DYA     D+ LN ++FH  + + ++FD     ++ ++E+ + +L+ +  +F E L+   K +E+F+   +  M E+ + ++    L  +++    ++E  NKEE    W+ + +PV   +   L PY +L+ TA++F+ K   W++G   ++    ++ D+    + + KL KQF + P  +K+A+KVK K+++FK H+P++Q +  PG+++RHW Q+SDI+G+ ++  E   L   +   L   + K E I  AA KE  LEK + KMK +W  M+F +  YR++G  ILS++DDIQ++LDDHI+K+QTM+GSPFIKPFE E+K WE KL+ + DI+D WLKVQATWLYLEPIFSS DI+AQMPEEGRKF  VD TWKE+M + + +   L       ML +L  SN LLE I KGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI  L FTE L+I  M S+E E +++   I  +KA+G VEKWLL++E  MI SV+  I++ +  Y  T R  WV  W GQ V+ +S  YWT  V +AI   P  L  YL   NSQID+IV LVRG L+   R TL AL V+DVHARDV+ N+ + QV++ N F WL QLRYY     +    I++ L YG EYLGNT RLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQI +IQ AI       +FEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFRSVAMMVPDYALI EISLYS GFV+AR LA KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNL+ K PD E+E IL+L++I DVNLPKFL+ D+PLF GI SDLFPGV+ P  D+DI    +K+N  K  L+ + +F++KI QIYEM++VRHG MIVGEPFGGKT AY+ LAAAL DI   G M+E KV Y I+NPKAITMGQLYGQFDPVSHEW+DGVLA+ +R FA +    RKWL+FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+S   NLIFEP DLE ASPATVSRCGM+YMEPA LGWRP   S+++  LP  + + H ++  D+FE  ID  +  I+    K+L  TS+I+ V  L  L    +D   ++  + +           +  ++I  WL+G+F F++ WSIG++  E GR  FD   REL  G           +    P P          +P + TIYD+ F    ++   G W+ W   +  +  SIS DAK NEII+PT +T + TY ++L LTH+KP + VGPTGTGKS  I ++L+ ++ KD Y  N INFSA+TSANQTQ+IIM+KLDRRRKGV+GPP  K+ +VFVDDLNMP +E YGAQPPIELLRQW+DH +W+D KDT+ + LID   + AMGPPGGGRN ++ R +RH N + +NEF+D TMI IF++I++WH     F   F      L+ +T++VYK A+ + LPTPAKSHY+FNLRDFSRVI+GVLL     +     + RLW HE++RV+YDRL  ++DR  FF+ ++  +      + + +  HL     GKV ++D+R LI   F D  + +K Y E+T L+ L K +E +LD+YN +SK PM+LV+F+FA+EH+SR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+++F +EI+++Y   EWR+DLKR+L K+       VFLFSDNQIKQESF+EDI+ LLN G+VPNLYP+DEK E+ EKM+   R  +K   R+ D +P+A+YN+F++RV+  LHIVLAMSPIGDAFRNRLR FPSL+NCCTIDWFQ WPEDAL  VA +FLED+E+D++ ++  + +CK +H S R LSE++L  L RYNYVTPTSYLELI TFK LL+ KR E+   K RY  GLEKL+ A+ ++  MQ EL+  QP+L+  S + DK +  VEQ + E   + +I+  E+  AN +A  ++ IK++C+ DLAEA+PIL  A+ +L+TL   DIT+VR+M +PP  ++LVMEAVC++ G KP+R  D S +GK IED+W  S +LLG+ KFL+ LK F  D++    +K +REKY+   DF P+ +  ASTACEGLCKW+ A++KYD  AK+VAPKK+ L  A  E    +  L +K+A L EV+ KL+ LT++L+  ++RK +LE+ ++LC+KKL RAEQLIGGLGGEK RW +AA  L  R+ N+TGD+L+S+ VVAYLG FT +FR    + W    +E +IPCS+ F ++  LG+PV+IR+WNI GLP D FSI+NGII++NS RWPL IDPQGQANKWIKNMEK N L +IKLTD +FVR LEN IQFGTPVLLEN+GEEL+P+LEP+L K  F+Q G   ++LGD++IEY+ DF+FYITT+LRNPHYLPE S KV LLNFMITP+GL+DQLLGIV ++E+PELEE+KN LI +SA+NK+KLKELED+IL VLS+S+GNILE+E+AI VL+SSK LS EI+EKQ   E T+ +ID+ R GY P+A+H +ILFF I+D+ANIDPMYQYSL WFINLF +SI+NSEKSE+L+ R++ L  +FT S+Y N+CRSLFE  KLLFS  +C  +LK  + + ++ WRFLLTGGV LDNP+ NP+  W+  K W E+ R  +L    G+R+ F    D WK +YDS  P
Sbjct:  263 SFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNK--KKLVP--SVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSDLANMA---------EHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQN--LGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPD-EDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKV-LPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQ-----------MDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQ---DYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKD-SISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKI--RQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEP 3344          

HSP 2 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 418/669 (62.48%), Postives = 511/669 (76.38%), Query Frame = 2
Query: 9356 VNHRNCFLPDHF--RLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            V   N  LPD +  RL    +K+ VLRC+RPDKIV A+Q+F+ + +G+ +I+PPPFDL  SFNDSNC SPL+F+LSPGADPM ALLKF +DQG+   K  S+SLGQGQGPIA KMI + I++GTWV+LQNCHLA SWM  LEK  EE+  PE TH +FRLWLTSYPS  FPV+ILQNGVKMTNEPPKGLR N+ RSYL+DPISD +FF    D S W  +LFGLCFFHA+VQERRKFGP+GWNI YEFNE+DLRISV+Q+ MF++ Y  +  +AL YLTGECNYGGRVTDD DRR LI++LQ FY   + E   Y F  SG YY+PPD   + YIEYI++LP+NP P V+G+H+NADITKDNQET  LF  ILLT  R +SG GKS +D + E++ D+L +LP NFD E++M++YP  Y +SMNTVL QE++RFN L+S +RS+L N++KAIKGLVVM+++LEEV  SML  K+P  W  KSYPSLKPLGSYVND + RL F  DW +N  P  FWISGFYFTQ+FLTGV QN+ARKYTIPID + F++EI    N  +    PEDGA V GLFL+GARWD++ KM+ ES PK+L + +P+IWLKP K   I    +YL P+YKTS RRGTLSTTGHSTNFV+ + LP +  + HWI RGVA LCQLDD
Sbjct: 3342 VEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELN-PETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEA---PEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4006          
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3038.44 bits (7876), Expect = 0.000e+0
Identity = 1600/3132 (51.09%), Postives = 2145/3132 (68.49%), Query Frame = 1
Query:  106 GFMNKRFININELISEGLPMQPGDFENVIKRKCTEMHSVLKASWLPRCARLFIDKRTLWSHLLPKQSTGNSEPVKAFFATIASLMSTQLRNMVNASLNDFTEFIK---------IHKNGNNFGVEF-----DELQFTDTPLMIVELKVAEPKIIYQPSFKELKDLLIRCYQFIVQSSEHIPRVEVNLFPEMRGQR--LFLRTVIFNEKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKE---RHGLLALKKKIDAYQDL-KDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWEQSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFNDNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITV-PNGLKDYLIKCNSQIDDIVKLVRGNLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYYDRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNC-KKLIETSEIHDVVQLQKLFHSLLDEIRNQPSVEEAETQEDSDVKIISAQNIYLWLQGLFLFSFVWSIGSSLLESGRSKFDVFFRELTGG-----------INPLYPKPKSIKLTKSNSFPERLTIYDFCF----EKKSGGNWQEWVNTIDRESMSISPDAKINEIIIPTGETARQTYFLDLFLTHEKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHF-EHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGNGEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLS--GKVVDEDVRGLI---FGDYMTDDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTS-TGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMDILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNMEKSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSP 9366
             F N R +++ E   +   ++  DF++   R        L   WL     ++         L+P  S  +   ++ FF   ++LM++ L+N+   S+ D+T  ++          H   +   + F     D     + P  ++ L + +  I ++PS ++ + LL+  Y  +++    + R+E  L+ +  G +  ++L  +I  E ++  +         D +VGP  ++  + KY +L+N + + E+   L E   RH      K +  Y DL K      R S+ L +F L    L   + KR   + E L+   +E +R+ NR + + Y++I  K   +P +TE ++ + +F+ +     +  L+++ +++ ERL+FL+DYA     D+ LN ++FH  + + ++FD     ++ ++E+ + +L+ +  +F E L+   K +E+F+   +  M E+ + ++    L  +++    ++E  NKEE    W+ + +PV   +   L PY +L+ TA++F+ K   W++G   ++    ++ D+    + + KL KQF + P  +K+A+KVK K+++FK H+P++Q +  PG+++RHW Q+SDI+G+ ++  E   L   +   L   + K E I  AA KE  LEK + KMK +W  M+F +  YR++G  ILS++DDIQ++LDDHI+K+QTM+GSPFIKPFE E+K WE KL+ + DI+D WLKVQATWLYLEPIFSS DI+AQMPEEGRKF  VD TWKE+M + + +   L       ML +L  SN LLE I KGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI  L FTE L+I  M S+E E +++   I  +KA+G VEKWLL++E  MI SV+  I++ +  Y  T R  WV  W GQ V+ +S  YWT  V +AI   P  L  YL   NSQID+IV LVRG L+   R TL AL V+DVHARDV+ N+ + QV++ N F WL QLRYY     +    I++ L YG EYLGNT RLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQI +IQ AI       +FEGTEL L+PTC +FITMNPGYAGR ELPDNLK LFRSVAMMVPDYALI EISLYS GFV+AR LA KIVATYRLCSEQLSSQ HYDYGMRAVKSVLTAAGNL+ K PD E+E IL+L++I DVNLPKFL+ D+PLF GI SDLFPGV+ P  D+DI    +K+N  K  L+ + +F++KI QIYEM++VRHG MIVGEPFGGKT AY+ LAAAL DI   G M+E KV Y I+NPKAITMGQLYGQFDPVSHEW+DGVLA+ +R FA +    RKWL+FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+S   NLIFEP DLE ASPATVSRCGM+YMEPA LGWRP   S+++  LP  + + H ++  D+FE  ID  +  I+    K+L  TS+I+ V  L  L    +D   ++  + +           +  ++I  WL+G+F F++ WSIG++  E GR  FD   REL  G           +    P P          +P + TIYD+ F    ++   G W+ W   +  +  SIS DAK NEII+PT +T + TY ++L LTH+KP + VGPTGTGKS  I ++L+ ++ KD Y  N INFSA+TSANQTQ+IIM+KLDRRRKGV+GPP  K+ +VFVDDLNMP +E YGAQPPIELLRQW+DH +W+D KDT+ + LID   + AMGPPGGGRN ++ R +RH N + +NEF+D TMI IF++I++WH     F   F      L+ +T++VYK A+ + LPTPAKSHY+FNLRDFSRVI+GVLL     +     + RLW HE++RV+YDRL  ++DR  FF+ ++  +      + + +  HL     GKV ++D+R LI   F D  + +K Y E+T L+ L K +E +LD+YN +SK PM+LV+F+FA+EH+SR+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD+++F +EI+++Y   EWR+DLKR+L K+       VFLFSDNQIKQESF+EDI+ LLN G+VPNLYP+DEK E+ EKM+   R  +K   R+ D +P+A+YN+F++RV+  LHIVLAMSPIGDAFRNRLR FPSL+NCCTIDWFQ WPEDAL  VA +FLED+E+D++ ++  + +CK +H S R LSE++L  L RYNYVTPTSYLELI TFK LL+ KR E+   K RY  GLEKL+ A+ ++  MQ EL+  QP+L+  S + DK +  VEQ + E   + +I+  E+  AN +A  ++ IK++C+ DLAEA+PIL  A+ +L+TL   DIT+VR+M +PP  ++LVMEAVC++ G KP+R  D S +GK IED+W  S +LLG+ KFL+ LK F  D++    +K +REKY+   DF P+ +  ASTACEGLCKW+ A++KYD  AK+VAPKK+ L  A  E    +  L +K+A L EV+ KL+ LT++L+  ++RK +LE+ ++LC+KKL RAEQLIGGLGGEK RW +AA  L  R+ N+TGD+L+S+ VVAYLG FT +FR    + W    +E +IPCS+ F ++  LG+PV+IR+WNI GLP D FSI+NGII++NS RWPL IDPQGQANKWIKNMEK N L +IKLTD +FVR LEN IQFGTPVLLEN+GEEL+P+LEP+L K  F+Q G   ++LGD++IEY+ DF+FYITT+LRNPHYLPE S KV LLNFMITP+GL+DQLLGIV ++E+PELEE+KN LI +SA+NK+KLKELED+IL VLS+S+GNILE+E+AI VL+SSK LS EI+EKQ   E T+ +ID+ R GY P+A+H +ILFF I+D+ANIDPMYQYSL WFINLF +SI+NSEKSE+L+ R++ L  +FT S+Y N+CRSLFE  KLLFS  +C  +LK  + + ++ WRFLLTGGV LDNP+ NP+  W+  K W E+ R  +L    G+R+ F    D WK +YDS  P
Sbjct:  263 SFKNLRLVDVEEFRGKKTAIELQDFQHTCMRHIEAAKEKLMKKWLNDVQNIYYQGNK--KKLVP--SVQDQANLERFFNCASTLMTSSLQNLGLDSMMDYTNLLRNPSRLIESMSHVMTDKRSIGFMAPKRDLANMAEHPGFVLRLILEDTVIKFEPSIEDFETLLLNVYDQMMKVISSVTRIESRLYSDWAGDKTKIYLNPIILPE-IIEKHKSTVRNVLIDESVGPTEHIKEFDKYRSLINREVDQEIDLLLSEGEDRHSFEEFAKYLKDYNDLVKKIEYDSRRSIRLGMFELQCDELIRALSKRAQNVCEKLLDRVIEYHRQSNRELMKEYEEIGRKALGLPANTEQMMELIKFVSDTERITMLELEKKLDKSNERLIFLMDYANFNTSDMNLNISVFHSHNRMGSIFDENKKNMEQKKEEFQTNLKFKRERFIEELDSYRKQVEEFQN--LGDMNEINKYLKKSQVLDTKLEAAIGRIEDFNKEEEAFGWDVTTYPVRQEVQNVLRPYLKLYETAVEFNGKYKDWMEGSMEKVEPDQVDADVGNYYRTLFKLEKQFENKPIPKKIATKVKTKVEEFKEHMPLIQTLFVPGLRDRHWQQISDIVGYTLRNEEGMCLSKLIDMNLEPFIPKFESISEAAGKEFNLEKAMEKMKNEWSPMEFVVIAYRETGTFILSSVDDIQLMLDDHIVKTQTMRGSPFIKPFEAEIKDWESKLILVQDILDEWLKVQATWLYLEPIFSSPDIMAQMPEEGRKFTSVDKTWKEIMKQVIADKRVLTVIQIEKMLDKLKKSNELLESILKGLNQYLEKKRLYFPRFFFLSNDELLEILSETKDPTRVQPHLKKCFEGIASLVFTETLDITHMKSSENEIVTLKDVISTSKARGQVEKWLLELEADMIASVRLNISEGLVDYKATPRKEWVKKWFGQGVLAISMYYWTIYVQDAIKEGPEALDAYLKVNNSQIDEIVALVRGQLSKQNRTTLQALIVLDVHARDVLVNLIQEQVANENDFAWLCQLRYYWVENNMITKMINSMLKYGYEYLGNTLRLVITPLTDRCYRTLFGALHLHLGGAPEGPAGTGKTETTKDLAKAVAKQCVVFNCSDGLDYIALGKFFKGLASCGAWSCFDEFNRIDLEVLSVVAQQILTIQRAIGAQQDTLMFEGTELKLDPTCAVFITMNPGYAGRSELPDNLKALFRSVAMMVPDYALIAEISLYSCGFVNARPLAVKIVATYRLCSEQLSSQPHYDYGMRAVKSVLTAAGNLKLKYPD-EDEDILMLRSIIDVNLPKFLNHDLPLFNGIASDLFPGVNRPVPDYDILNKYIKENCLKMNLESSSFFMEKIQQIYEMMIVRHGFMIVGEPFGGKTSAYKVLAAALGDICEQGLMEENKVQYTILNPKAITMGQLYGQFDPVSHEWSDGVLAVSYRAFATSTTPDRKWLIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQLSPSTNLIFEPMDLEVASPATVSRCGMVYMEPASLGWRPIFNSWLKV-LPPAITDIHKKMWADIFERFIDAGIACIKKGGGKELSPTSDINVVKSLLNLIDCQIDAFNDEAKISQ-----------MDQRDILTWLEGVFFFAYTWSIGATTNEEGRKAFDKLCRELMNGGMMEETRIKLALVETVPPPLQ---DYQGLYPHKGTIYDYRFIAEKQENGFGKWEHWSELVKGKD-SISKDAKFNEIIVPTTDTVKYTYLMNLLLTHDKPCLFVGPTGTGKSCYIIDFLLNQMNKDIYKPNLINFSAQTSANQTQNIIMSKLDRRRKGVFGPPVGKKIIVFVDDLNMPIRETYGAQPPIELLRQWLDHWNWYDLKDTTAIKLIDLQFIGAMGPPGGGRNPITPRFLRHLNTITINEFHDETMITIFSSILNWHIITQNFSPDFKPSMNQLIQATLDVYKSAMTNLLPTPAKSHYLFNLRDFSRVIQGVLLSLPNTIEEPAHMKRLWTHEMFRVYYDRLVTDQDREWFFNYIREVSNKHLNEDFDMLFKHLDFDEDGKVTEDDIRSLIYCDFSDAKSSNKEYIEVTDLELLRKTVEGYLDEYNQMSKKPMNLVLFRFAIEHVSRISRILKQPRSHALLVGVGGSGRQSLTRLAASMADYDLFQVEISKSYTSTEWREDLKRILRKSTETDNHAVFLFSDNQIKQESFLEDINNLLNAGEVPNLYPTDEKQEVCEKMRQIDRQRDKI--RQTDGSPVALYNFFVQRVRDQLHIVLAMSPIGDAFRNRLRKFPSLVNCCTIDWFQTWPEDALTAVATRFLEDVELDQSLKDGCIDLCKMFHTSTRVLSEKYLLELSRYNYVTPTSYLELISTFKNLLDKKRTEVQKQKRRYEVGLEKLQSAASDISVMQKELRDYQPKLVEASKEVDKTMIIVEQQSTEASKQEKIVKGEEAIANDQAKAAEAIKNECDNDLAEAIPILESALKALETLTPADITIVRTMISPPKGVRLVMEAVCVLKGIKPDRVNDPSGSGKKIEDFWGPSKRLLGEMKFLEGLKAFDKDNIPIPIMKVIREKYLTNDDFKPERIAVASTACEGLCKWVFALEKYDKVAKVVAPKKIALEKAMNEYNTAMSSLNKKRAALKEVQDKLKVLTEELESNKRRKIDLENKVDLCSKKLVRAEQLIGGLGGEKDRWIQAAHDLGVRFINLTGDILLSSGVVAYLGAFTSSFRAEKTKQWLHDVMEKSIPCSDKFSLITTLGDPVEIRSWNIYGLPTDEFSIENGIIISNSRRWPLMIDPQGQANKWIKNMEKKNNLQVIKLTDADFVRILENCIQFGTPVLLENIGEELDPLLEPLLLKQTFKQGGSICIKLGDSIIEYSFDFRFYITTKLRNPHYLPETSVKVTLLNFMITPEGLQDQLLGIVVSRERPELEEEKNKLIQQSANNKKKLKELEDEILNVLSTSEGNILEDESAIKVLNSSKELSNEIAEKQAYFEETEQKIDEARLGYVPIAIHSTILFFSIADLANIDPMYQYSLTWFINLFNLSIDNSEKSENLQQRLQNLKSYFTYSLYCNVCRSLFEKDKLLFSFILCSNILKHDSLIKEDEWRFLLTGGVGLDNPHENPSA-WLPPKSWDELCRLDDLSVFHGIRQRFIEQKDSWKKIYDSVEP 3367          

HSP 2 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 418/669 (62.48%), Postives = 511/669 (76.38%), Query Frame = 2
Query: 9356 VNHRNCFLPDHF--RLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPENTHKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSPPDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFNKLISVVRSTLINLQKAIKGLVVMNNELEEVFNSMLIGKVPNPWAAKSYPSLKPLGSYVNDLIQRLNFFHDWIENNVPSTFWISGFYFTQSFLTGVLQNFARKYTIPIDEVGFEFEITSFDNSTDIKVRPEDGACVYGLFLEGARWDKENKMLGESLPKILFNSIPIIWLKPNKLVAIDRSSTYLCPVYKTSARRGTLSTTGHSTNFVLNIDLPNNLSQNHWINRGVASLCQLDD 11356
            V   N  LPD +  RL    +K+ VLRC+RPDKIV A+Q+F+ + +G+ +I+PPPFDL  SFNDSNC SPL+F+LSPGADPM ALLKF +DQG+   K  S+SLGQGQGPIA KMI + I++GTWV+LQNCHLA SWM  LEK  EE+  PE TH +FRLWLTSYPS  FPV+ILQNGVKMTNEPPKGLR N+ RSYL+DPISD +FF    D S W  +LFGLCFFHA+VQERRKFGP+GWNI YEFNE+DLRISV+Q+ MF++ Y  +  +AL YLTGECNYGGRVTDD DRR LI++LQ FY   + E   Y F  SG YY+PPD   + YIEYI++LP+NP P V+G+H+NADITKDNQET  LF  ILLT  R +SG GKS +D + E++ D+L +LP NFD E++M++YP  Y +SMNTVL QE++RFN L+S +RS+L N++KAIKGLVVM+++LEEV  SML  K+P  W  KSYPSLKPLGSYVND + RL F  DW +N  P  FWISGFYFTQ+FLTGV QN+ARKYTIPID + F++EI    N  +    PEDGA V GLFL+GARWD++ KM+ ES PK+L + +P+IWLKP K   I    +YL P+YKTS RRGTLSTTGHSTNFV+ + LP +  + HWI RGVA LCQLDD
Sbjct: 3365 VEPHNQQLPDEWAERLKDSFNKMCVLRCLRPDKIVSAIQNFVEERIGKKYIEPPPFDLPGSFNDSNCTSPLLFILSPGADPMAALLKFADDQGFGGGKFESLSLGQGQGPIAMKMIQRGIKEGTWVLLQNCHLAPSWMGVLEKTVEELN-PETTHPDFRLWLTSYPSSTFPVAILQNGVKMTNEPPKGLRFNIWRSYLSDPISDMEFFGTSKDLSAWKKLLFGLCFFHAIVQERRKFGPIGWNIKYEFNETDLRISVQQLHMFIDQYDSVQYDALQYLTGECNYGGRVTDDWDRRTLITILQKFYCIQVNEDPDYKFDDSGFYYAPPDLDYEGYIEYIKTLPLNPEPGVFGMHQNADITKDNQETQLLFDSILLTQARGSSGGGKSTDDIVDEVSADVLNRLPPNFDTEIVMRKYPTKYEQSMNTVLVQEMVRFNALLSTIRSSLQNIRKAIKGLVVMSSDLEEVVISMLKSKIPGMWMKKSYPSLKPLGSYVNDFLARLKFLSDWFDNGPPPIFWISGFYFTQAFLTGVQQNYARKYTIPIDLLHFDYEILDDRNYDEA---PEDGAYVKGLFLDGARWDRKLKMINESHPKVLQDPMPVIWLKPMKKSEIPNKPSYLSPMYKTSERRGTLSTTGHSTNFVIAMTLPTDKPEEHWIMRGVALLCQLDD 4029          
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000013737.1 (SMESG000013737.1)

HSP 1 Score: 2976.42 bits (7715), Expect = 0.000e+0
Identity = 1545/2961 (52.18%), Postives = 2078/2961 (70.18%), Query Frame = 1
Query:  676 EKLVTSYLDETMQTFKDNTVGPKNYLNVYKKYGNLLNNKAELEVRAFLKERHGLLALKKKIDAYQDLKDEXXXXXXXXXXXXFMLDTRRLNIDIFKRCDKLRELLVSFEVEENREINRSICRRYDDITNKVSEIPTDTEGLVAVQEFLREASTTEVFRLKEETEEAVERLMFLLDYATIPYEDIKLNTTLFHWPHHISNVFDVATNRIQNRREQTXXXXXXXXXXXXXXXXXITKSIEDFKKKEVMTMEEMRRNVQFLDELQGQIDDCKDQLEQLNKEESMLNWE-QSQFPVLATMIKNLDPYSRLWRTALDFHIKNDTWLKGPFHELNALTIENDIVEMNKIMHKLIKQFN--DNPGAQKVASKVKGKIDKFKNHLPVLQVICNPGIQERHWDQMSDIIGFDIKPTEESSLMDFLTYGLHKHLEKLEEIGAAAAKEHQLEKTLAKMKEDWKEMKFELTEYRDSGVSILSALDDIQMLLDDHIIKSQTMKGSPFIKPFEKEMKLWEDKLVSMNDIIDVWLKVQATWLYLEPIFSSEDILAQMPEEGRKFGIVDVTWKEVMAESVKNPSCLVATGQRDMLKRLTDSNSLLEEIQKGLNDYLEKKRLYFPRFFFLSNDELLEILSETKDPQRVQPHLKKCFEGIHRLEFTEQLEIIGMISAEGETLSMVTKIYPAKAKGMVEKWLLQVENVMINSVKKVINDSIESYVITKRGRWVLDWPGQIVICVSCIYWTKEVTEAITVPNGLKDYLIKCNSQIDDIVKLVRG-NLASGERITLGALTVIDVHARDVVENMAKLQVSSVNAFEWLSQLRYY--------DRGGEVWVCQISTELPYGNEYLGNTPRLVITPLTDRCYRTLMSALKLNLGGAPEGPAGTGKTETCKDLAKAVAKQCVVFNCSDGLDYKAMGKFFKGLAQAGAWACFDEFNRIELEVLXXXXXXXXXXXXXXXXGLKRFVFEGTELSLNPTCTMFITMNPGYAGRQELPDNLKVLFRSVAMMVPDYALIGEISLYSMGFVDARALASKIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNLRQKMPDTENESILLLKAINDVNLPKFLSQDIPLFEGIISDLFPGVDLPKADFDIFFSAVKDNLTKRKLQHNEWFIDKILQIYEMILVRHGLMIVGEPFGGKXXXXXXXXXXXXXXXXXGTMQEYKVDYGIINPKAITMGQLYGQFDPVSHEWTDGVLAIMFREFAVAQDDRRKWLMFDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQMSNKMNLIFEPADLEQASPATVSRCGMIYMEPAQLGWRPFMESFIEYELPICLNEDHIQLIRDLFEWLIDPCLDFIRHNCKKLIETSEIHDVVQLQKLFHSLLDEIRN-----------QPSVEEAETQEDSDVKIISAQNIYL-----WLQGLFLFSFVWSIGSSLLESGRSKFDVFFR---ELTGGINPLYPKPKSIKLTKSNSFPERLTIYDFCFEKKSGGNWQEWVNTIDRESM-SISPDAKINEIIIPTGETARQTYFLDLFLTH-EKPVIVVGPTGTGKSVLINNYLV-RLPKDRYLANNINFSARTSANQTQDIIMTKLDRRRKGVYGPPPEKRCVVFVDDLNMPAKEKYGAQPPIELLRQWIDHGHWFDKKDTSKLHLIDTLLLSAMGPPGGGRNDVSSRMIRHFNVLGVNEFNDNTMIRIFTTIVDWHFEHGFDGVFNRLGKLLVSSTMNVYKKAIASFLPTPAKSHYVFNLRDFSRVIKGVLLVPHTNLGN------GEKLMRLWVHEVYRVFYDRLTMEEDRLKFFDIVKLTTADCFKTNIEKILGHLSLSGK-VVDEDVRGLIFGDYMT------------------DDKIYDEITSLKNLAKRMETFLDDYNSISKAPMSLVMFQFAMEHISRVCRVLKQDNGHALLVGIGGSGRQSATRMAAFMADFEIFIIEITRNYGQNEWRDDLKRLLIKAGCDAKPLVFLFSDNQIKQESFMEDISMLLNTGDVPNLYPSDEKAEILEKMQNAARIEEKKTGRKIDSTPIAMYNYFIERVKQNLHIVLAMSPIGDAFRNRLRMFPSLINCCTIDWFQAWPEDALEMVANKFLEDIEMDENTREAIVIMCKFYHESVRQLSEEFLNTLRRYNYVTPTSYLELIKTFKKLLNFKRNELITLKNRYLTGLEKLEFASKEVGKMQIELKALQPELIVTSAQTDKLLAKVEQDTVEVEAKREIMAAEQEDANVKAAESQEIKDDCEADLAEAMPILRDAMASLDTLKQNDITLVRSMKNPPYLIKLVMEAVCIMLGEKPERKPDTSTGKMIEDYWTSSVKLLGDFKFLDRLKNFSADSVNPQAIKKLREKYIPEPDFDPKIVRNASTACEGLCKWIIAVDKYDYAAKIVAPKKMKLAIAEKELEITLKQLAEKKAQLDEVEAKXXXXXXXXXXXXXRKKELEDNIELCTKKLDRAEQLIGGLGGEKSRWTEAAKMLSERYYNITGDVLMSAAVVAYLGTFTVAFRNSVVEGWHKKCIEMTIPCSESFKMMD--ILGEPVKIRAWNIAGLPVDSFSIDNGIIVNNSNRWPLCIDPQGQANKWIKNME-KSNRLSIIKLTDNNFVRTLENSIQFGTPVLLENVGEELNPILEPILQKTIFRQQGVDYLRLGDNVIEYNKDFKFYITTRLRNPHYLPEISTKVCLLNFMITPQGLEDQLLGIVAAXXXXXXXXXXNVLIIESADNKRKLKELEDQILEVLSSSQGNILENETAINVLSSSKLLSQEISEKQTIAEVTQVEIDKTRNGYKPVAVHGSILFFCISDMANIDPMYQYSLNWFINLFLMSIENSEKSEDLETRIEYLNDHFTLSVYRNICRSLFENHKLLFSLTMCIALLKGKNKVNDEIWRFLLTGGVALDNPYPNPAPNWMSDKLWSEMVRASELPSIKGLREHFQNNTDKWKSMYDSQSPEL 9372
            E+ V S  ++     K N+  P  Y  +Y  +  LLN   E     F+     LL  + +++  + L DE + L   +P+ LF+LD   +N  +  R  +L  + ++    ++R  NRSIC +YD I  +V++    T  LV +QE++ +  T E+  L+ + E+A   ++FLL+Y  +P +DI LN T F W   I  + D +   +   RE+    L     +F E L  +   I++F ++    + +   N Q LD++  ++++C ++ +Q+N+EE +L+   Q+ +  L  ++   +P+ +LW++A+ FH   D W+ GP  E++A  +E +   + K  ++L K F+  +  G  + A+ +K K++KFK +LP++Q +CNPG+++RHWD MS+ +GFDI P  ++ L D L  GL KHLE L E+ + A+KE  LEK   +M+ DW+E+ F  T Y+++GV+IL  +DDIQ+LL+DHI+K+ TM+ SPFI PFE E+  W+  L  + D ++ WLKVQA WLYLEPIF S DI  Q+P EG +F IVD  W+ +M +   +   +      ++L+ L  S +LLE+IQKGLNDYLEKKRLYFPRFFFLSN+ELLEILSETKDP RVQPHLKKCFEGI +L+FTE+  I GM+SAE E +     I+P +A+G+VEKW+LQVE  M +S++ V+  ++  Y    R +WV DWPGQ+V+  S ++WT++ T AI   + L+++L K + QI  IV+LVR  NL S  RITL A  V+DVHARDVV  +   +VSS + F W+SQ+RYY             + +  ++TE+PYG EYLGNT RLVITPLTDRCYRTLM A+KLNLGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDYK+MGKFFKGLAQ+GAWACFDEFNRIELEVLSV+AQQIQ+IQ AI   L+ F+FEGTEL L+ +CT+FITMNPGYAGR ELPDNLKVLFR+VAMMVPDYALI EISLYSMGFV+AR LA+KIVA YRLCSEQLSSQHHYDYGMRAVKSVLTAAG L++K+     E ++L K+I DVNLPKFL  DIPLF+GIISDLFPGV+ P  D+      + + L   KL+   WF+DKI+QIYEMILVRHGLMIVG+ F GKT A++ L+ AL D+  +  + E  V + IINPKAI++G LYG+FD VSHEW+DG+LA  FRE A ++ D RKW++FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQM+NK N+IFEP DLEQASPATVSRCGMIYMEP QLG  P ++ +I+  LP  L+++    ++ LF WLI P LDFI   CK  ++   +  V  + +L+ SLLD++RN                  E +ED   KI +   I       +L   F  S +WS G+ L +  + KFD FFR   E+T   N  YP+PK++K  ++   P++ TI+D  F KK  G W  W + I++  +  +    +I+ I+IPT +T RQ +FL   L +  KP++ VG TGTGKS +I  +++  LP   +L +++ FSA+TS++Q QD   +KLDRRR+G+Y PP +K  VVF+DD++MP KEKYGAQPP+E+LRQ IDH  WFD+KD + L + D L+ SAM  P   R  V+SR++RHFN++ ++EF+D TM  IF  I+DWHF  GF+    RL K++V +T ++++  +A FLPTPAKSHYVFNLRDFSRVI+G LL+    L N        KL+RLWVHE YRVF+DRL   ED   FF+++K      FK     + G  S   K   + ++R L+FGD++                   + K+Y+EIT  + L + M+ +LD+YN +SKAPM LV+F+FA+EHI+R+CR+L+Q NGH+LLVGIGGSGRQSA ++A F+ DFEIF IE+TR Y  ++WRDD++RL+   G       FLF D+QIK+  F+EDI+MLLN+GD+PNL+ ++++ EI+EKMQ   + +  +       T I MYN FIERV++NLH+VL  SPIGDAF +RLR FPSLINCCTI+WFQ WPEDAL+MVANK L+++E+ ++ RE IVIMC+ +H+SV  LS++F   + R NYVTPTSYLELIKTF  LLN K+ E+IT K RY  GLEKLEF+  ++  MQ+EL+A QP+LI TS +T+KL+  +E +TVEVE  R+++  E+    VKA +++ IKDDCE++LAEAMP++  A+ +LDTLKQNDI++V++M+NPP  +KLVMEAVCI+ G KPE+K D S GK++EDYW ++ KLLGD KFLD LK++  D++    ++K+R +YI  P FDP  ++N S+ACEGLC W+ AV+ YD   K+V+PKK KLA+AE   +  + QL  K+ +L EVE+KL  L +     QQ K +LE+NIEL   K++RAE+LI GLGGEKSRW +    L+ R+ N+ GDVL+ A +VAYLG FT+ +R   VE W  +C  M+IP S         +LG+PV++R W I GLPVDSFS+DN +IV ++NRW L IDPQGQANKWIK ME + N+L +IKL+D  ++R LEN +QFGTP LLENVGEEL+ +LE +L K  F+Q  V+Y+RLGD+V+EY++DF+FYITTRLRNPHYLPE S KV L+NFMITP GLEDQ+LGIV AKEKPELE+++  LIIESA N+R+LKE+EDQIL++LS+S+GNILE+E AI +LSSSK+LS++IS KQ  A  T+ EI+  RNGYKPVA HGSILFF ISD+A++DPMYQYSL+WFINL++ SIENSE S D+E R++ LN HFT +VY+NICRSLFE  KLLFS  +CI + KG+NKV++ +WRFLLTGG++LD+P  NP P+W+S+K W+EM   S L   KG  + F  N  KWKS+ DS++P L
Sbjct:    5 EEFVISNKEKLRDYVKLNSEAPIKYSQIYTNFRYLLNKTTEDHSHQFINADKQLLDYEAELEKLKSLSDEAASLPTFLPMHLFILDCETINQWLLDRSKQLEMIYLNHMTNKSRVFNRSICTQYDSIVRRVTKQSETTSQLVELQEYVEKLRTGELIMLQGKLEKAARSVLFLLNYTILPTDDILLNNTTFTWNDRIIPILDSSGYNLTKERERALNKLEKWQKQFVENLAGLKAQIKEFNQRN--QLNDAVENEQELDKMAEKLNECIEEKKQINQEELLLSTGVQTPYLQLQEILTIKEPFDKLWKSAVTFHKLYDKWMNGPILEVDAEEVEAETQSLWKTAYRLTKVFSHPEYKGPMRCAATIKAKLEKFKINLPIIQALCNPGLKQRHWDAMSNKVGFDITPRIDTPLSDMLAMGLDKHLEDLMEVSSKASKEFSLEKASIRMQNDWQEIVFSFTPYKETGVNILCTVDDIQVLLEDHIVKTSTMRNSPFIGPFESEINQWDKTLHRLKDALNSWLKVQAAWLYLEPIFGSADIRRQIPIEGGQFEIVDEKWRTIMNKVTNDSKVMNVIKFDNLLEDLQSSEALLEQIQKGLNDYLEKKRLYFPRFFFLSNEELLEILSETKDPLRVQPHLKKCFEGISKLKFTEETVITGMLSAESEEVKFAYDIFPLEAEGLVEKWILQVEYAMKDSLRDVMKKALTCYNQISRCQWVQDWPGQVVLAASAVHWTEQATNAIK-SHTLEEFLKKNDQQISSIVELVRDENLKSLVRITLEAFIVLDVHARDVVAKLLSSEVSSEDDFNWISQMRYYWFTELKMNLSNDNLVIRMVTTEVPYGYEYLGNTSRLVITPLTDRCYRTLMGAIKLNLGGAPEGPAGTGKTETSKDLAKAVAKQCVVFNCSDGLDYKSMGKFFKGLAQSGAWACFDEFNRIELEVLSVIAQQIQTIQRAIRDQLEMFLFEGTELRLDKSCTIFITMNPGYAGRSELPDNLKVLFRTVAMMVPDYALIAEISLYSMGFVEARTLAAKIVAIYRLCSEQLSSQHHYDYGMRAVKSVLTAAGQLKRKLRLLTEERVVL-KSIIDVNLPKFLGPDIPLFDGIISDLFPGVEKPLIDYQDLTRILIERLRTMKLEPVPWFLDKIIQIYEMILVRHGLMIVGQSFCGKTCAFKALSMALGDLNKELNI-ENSVIFDIINPKAISIGWLYGRFDTVSHEWSDGILAKTFREHASSESDERKWIIFDGPVDAIWIENMNTVLDDNKKLCLMSGEIIQMTNKQNMIFEPEDLEQASPATVSRCGMIYMEPLQLGTDPLIKVWIQQFLPEFLDDEQRTTVQLLFNWLIPPSLDFIGRKCKSYVKCGSLQLVANMLQLYSSLLDDVRNVGKKSDDADDEDIEELAGEDEEDILNKITNENEILKEERTNFLIAHFFLSLIWSFGAILDKDSKLKFDDFFRDLCEMTDSPNQKYPRPKNLKCARNLMVPKKGTIFDHIFMKKQFGCWTTWQSLIEKPDLDELIKTTEIHNILIPTVDTVRQRFFLTRILKNGRKPIMFVGATGTGKSAVIKAFMLDSLPNKDFLFHSLTFSAQTSSDQVQDSFFSKLDRRRRGLYKPPQDKTLVVFIDDISMPEKEKYGAQPPVEILRQLIDHKFWFDRKDNTPLIIEDVLICSAMAIPSASRPAVTSRLLRHFNIIAIDEFDDETMKGIFQPIMDWHFNSGFEITLKRLSKVIVHATADIFQSVMAHFLPTPAKSHYVFNLRDFSRVIQGCLLLKSVVLKNLTQEDSYNKLIRLWVHETYRVFHDRLISSEDCDLFFELIKKVVEMTFKEKFHVLFGDFSTDNKRPTNTEMRKLMFGDFLKAKKDPNEILSSGTVSKEGEIKLYNEITDEEALFQTMQFYLDEYNLMSKAPMDLVLFRFAIEHIARICRMLRQPNGHSLLVGIGGSGRQSAAKLATFICDFEIFQIEMTRTYSVSDWRDDIRRLVRNTGDKGIETTFLFGDHQIKETCFLEDINMLLNSGDIPNLFENEDRLEIIEKMQQIVQQQNIQIE----ITAINMYNKFIERVRKNLHLVLTFSPIGDAFHSRLRNFPSLINCCTINWFQVWPEDALKMVANKSLDEVEIKQDVREKIVIMCQHFHQSVSDLSKKFYEVMGRINYVTPTSYLELIKTFINLLNKKQMEIITSKERYSVGLEKLEFSENQISLMQVELQAFQPQLIETSKETEKLIKIIETETVEVEKVRKVVKEEEAGCMVKAEDAKSIKDDCESNLAEAMPVMNAAIEALDTLKQNDISIVKAMQNPPDGVKLVMEAVCILKGLKPEKKTDPS-GKLMEDYWPTAKKLLGDLKFLDHLKSYDKDTIPEAYMRKIRLQYINNPGFDPVKIKNISSACEGLCLWVRAVEVYDRILKVVSPKKEKLAVAESIYQTQMAQLKVKQDELYEVESKLAKLQENFQNKQQEKTDLENNIELTKVKIERAEKLIAGLGGEKSRWGKVISDLAIRFDNMIGDVLLCAGIVAYLGPFTIGYRQECVELWQNECKSMSIPVSSESTFSLSSVLGDPVRVREWQIYGLPVDSFSVDNAVIVTSTNRWSLLIDPQGQANKWIKKMESERNKLEVIKLSDKGYLRVLENCLQFGTPCLLENVGEELDSVLESVLLKQTFKQSNVEYIRLGDHVVEYSQDFRFYITTRLRNPHYLPEWSVKVTLVNFMITPTGLEDQMLGIVTAKEKPELEKRRGQLIIESASNRRQLKEIEDQILQILSTSKGNILEDEKAIEILSSSKVLSEQISIKQEAANKTENEINFVRNGYKPVAHHGSILFFTISDLASLDPMYQYSLSWFINLYIHSIENSEHSSDIEIRLKNLNSHFTRAVYQNICRSLFEKDKLLFSFLLCIGIAKGQNKVDELVWRFLLTGGISLDSPQKNPVPDWLSEKSWNEMFGLSNLEPFKGWLKDFVMNIQKWKSIVDSKTPHL 2955          

HSP 2 Score: 501.901 bits (1291), Expect = 6.598e-142
Identity = 237/433 (54.73%), Postives = 315/433 (72.75%), Query Frame = 2
Query: 9362 HRNCFLPDHFRLLQGLDKLIVLRCIRPDKIVPAVQSFITDNLGQTFIDPPPFDLLSSFNDSNCCSPLIFVLSPGADPMNALLKFGEDQGYNASKIASISLGQGQGPIAAKMIDQAIQDGTWVVLQNCHLATSWMKSLEKICEEIIIPEN-THKNFRLWLTSYPSEDFPVSILQNGVKMTNEPPKGLRANLLRSYLNDPISDNKFFDGCNDNSRWHNMLFGLCFFHALVQERRKFGPLGWNIPYEFNESDLRISVRQMQMFLNDYTELPLEALTYLTGECNYGGRVTDDKDRRLLISLLQIFYNADIVEKEKYPFSPSGIYYSP-PDGTAQIYIEYIRSLPINPNPEVYGLHENADITKDNQETNQLFSGILLTLPRQASGEGKSPEDSIQELADDILKKLPENFDLEMIMKRYPVMYSESMNTVLRQELIRFN 10654
            H   F  D    L  L++L+V+RC+ P+K++PAV S+I   LG  +++PP FDL  SF +S+  +P+IFVLSPG DPM+ L +F E +  + + +  +SLGQGQGPIA   I ++++   W++LQNCHLATSW+  L KICEE+++ ++  + NFRLWLTSYPS  FPV++LQN VKMTNEPPKGLRANLLRSY   PISD  FF        +  +LF LCFFHA+VQERR +G +GWNIPYEFN+SDL+IS+RQ+QMF++DY ++ LEALTYLTGECNYGGRVTD++DRRL++SLL   Y+ +++  E +P + SG Y  P        Y+ +I+  P N  PEV+GLH NA++ K+ QETNQLF  IL+TLP++ SGE KS +  I++LA DIL KLP+ F +E I  +YPV+Y E MNTVL QELIRFN
Sbjct: 2954 HLEKFPGDWEERLSPLERLVVIRCLCPEKVIPAVISYIVGFLGHEYVEPPAFDLELSFKESDSVTPIIFVLSPGVDPMSDLYRFAELKNLSPTNLKVVSLGQGQGPIAESYIYESLKSENWIILQNCHLATSWLPELGKICEELLLKKSEINPNFRLWLTSYPSSVFPVNVLQNSVKMTNEPPKGLRANLLRSYTTTPISDEDFFKASKRPQVFEKLLFSLCFFHAVVQERRNYGSIGWNIPYEFNDSDLKISIRQLQMFIDDYEDVQLEALTYLTGECNYGGRVTDNQDRRLIMSLLYSVYHKELLLSECFPLTESGTYLVPLVTSDLNSYLNHIKRFPPNAAPEVFGLHTNAELAKEQQETNQLFESILVTLPKEISGESKSSQTIIEDLASDILSKLPQIFQIEEIHMKYPVLYEECMNTVLIQELIRFN 3386          
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH30.000e+059.90dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH70.000e+051.98dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH120.000e+050.03dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH10.000e+042.05dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH61.194e-17038.47dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-31.479e-4426.94Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-13.243e-15535.75Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.243e-15535.75Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-14.089e-15535.75Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-32.070e-6837.37Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+048.40gene:FBgn0013810 transcript:FBtr0304742[more]
Dnah30.000e+046.49gene:FBgn0035581 transcript:FBtr0289982[more]
Dhc62B0.000e+044.30gene:FBgn0013811 transcript:FBtr0303106[more]
Dhc16F8.802e-13837.95gene:FBgn0283476 transcript:FBtr0074509[more]
kl-21.277e-12737.15gene:FBgn0001313 transcript:FBtr0346722[more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah30.000e+060.71dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB... [more]
dnah70.000e+051.62dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+049.62dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah120.000e+049.46dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+049.29dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc21a0.000e+062.73tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+062.29tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a4.268e-1065.43tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+064.24tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a4.268e-1064.03tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah30.000e+060.94dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah30.000e+059.97dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah7c0.000e+052.22dynein, axonemal, heavy chain 7C [Source:MGI Symbo... [more]
Dnah7a0.000e+052.22dynein, axonemal, heavy chain 7A [Source:MGI Symbo... [more]
Dnah7b0.000e+052.17dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TD57|DYH3_HUMAN0.000e+059.90Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
sp|Q8BW94|DYH3_MOUSE0.000e+059.97Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|Q63170|DYH7_RAT0.000e+052.11Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
sp|Q8WXX0|DYH7_HUMAN0.000e+051.98Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|E9Q8T7|DYH1_MOUSE0.000e+042.02Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EPJ60.000e+068.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J3L20.000e+067.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4S2M5I40.000e+067.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
K1PBH33.470e-4766.93Dynein heavy chain 3, axonemal OS=Crassostrea giga... [more]
A0A2C9KDA10.000e+066.40Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+049.89dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah21.773e-14739.85dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.11.270e-12036.06dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.22.448e-11233.84pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah54.358e-11633.64dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001140.10.000e+049.63pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
DNAH64.921e-17338.19dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000003955.10.000e+046.39pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003959.10.000e+045.92pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
ENSPMAT00000004701.10.000e+063.81pep scaffold:Pmarinus_7.0:GL479445:9390:42654:-1 g... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN12.968e-1125.23Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347270.000e+061.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458060.000e+051.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379616.351e-16354.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340772.084e-8439.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318007.557e-17438.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+048.27dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
dnah51.076e-11834.50dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah52.004e-11935.86dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah56.463e-11731.38dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
si:dkeyp-86b9.10.000e+032.99dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5