Dynein heavy chain, axonemal

NameDynein heavy chain, axonemal
Smed IDSMED30026124
Length (bp)11416
Neoblast Clusters

Zeng et. al., 2018

▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population





Single cell RNA-seq of pluripotent neoblasts and its early progenies

We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)

Explore this single cell expression dataset with our NB Cluster Shiny App


Neoblast Population


t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.

Expression of Dynein heavy chain, axonemal (SMED30026124) t-SNE clustered cells

Violin plots show distribution of expression levels for Dynein heavy chain, axonemal (SMED30026124) in cells (dots) of each of the 12 neoblast clusters.


back to top


Sub-lethal Irradiated Surviving X1 and X2 Cell Population


t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dynein heavy chain, axonemal (SMED30026124) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dynein heavy chain, axonemal (SMED30026124) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.


back to top


Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods


back to top
Anatomical Expression

PAGE et. al., 2020


has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE

PAGE Curations: 31

Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026124SMESG000040510.1 SMESG000040507.1 SmedASXL_018112SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026124SMESG000049038.1 SMESG000040510.1 Contig55269uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026124SMESG000049038.1 SMESG000040510.1 Contig55269newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30026124SMESG000040511.1 dd_Smed_v6_6557_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026124SMESG000040510.1 Contig16071uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026124SMESG000040510.1 Contig16071uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026124SMESG000040510.1 Contig16071newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026124SMESG000040510.1 Contig16071newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30026124SMESG000040511.1 Contig45841uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30026124SMESG000040511.1 Contig45841newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026124SMESG000040511.1 SMESG000040510.1 SMESG000040507.1 dd_Smed_v4_10846_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ciliated epithelial cellSMED30026124SMESG000040511.1 dd_Smed_v4_6557_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026124SMESG000040511.1 SMED_23190_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH3 (dynein axonemal heavy chain 3 [Source:HGNC Symbol;Acc:HGNC:2949])

HSP 1 Score: 3760.3 bits (9750), Expect = 0.000e+0
Identity = 1870/3122 (59.90%), Postives = 2406/3122 (77.07%), Query Frame = 1

HSP 2 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 460/660 (69.70%), Postives = 546/660 (82.73%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH7 (dynein axonemal heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:18661])

HSP 1 Score: 3101.23 bits (8039), Expect = 0.000e+0
Identity = 1618/3113 (51.98%), Postives = 2153/3113 (69.16%), Query Frame = 1

HSP 2 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 398/647 (61.51%), Postives = 504/647 (77.90%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH12 (dynein axonemal heavy chain 12 [Source:HGNC Symbol;Acc:HGNC:2943])

HSP 1 Score: 2973.73 bits (7708), Expect = 0.000e+0
Identity = 1549/3096 (50.03%), Postives = 2100/3096 (67.83%), Query Frame = 1
            +W P+   LF  K  L             E + AF++ +++LMS QL++++  ++  F +              FD       P+  +EL   + K+ + P+F++L+D ++   + I ++ +++  +          VNL  E+             E ++   +D        N  G + +   Y +KY  LL+  A   +  F  E H      + I+ +  L  E+ LL   +  ++  LD   L   +  +      +L++    + R+ N  IC  ++ I     ++P  TE ++ +  ++ +A T  +  L    +E+  ++ + LD    P ED+ LN T+  WP  I+ +FD     I+N + + E +L  +  K    +E+ ++ +E+F   E   +E M++ V  + +LQ +I + ++ ++ +NKEE +  WE +++P L  +  N++PY + +   L +      W+ G F +LN  ++E D+ E ++ + K +K F              A+K                   + S V  +I  FK ++P + ++CNPG++ RHW Q+S+I+G+D+ P   ++L   L   L  +LE+ E I A A+KE  LEK +  M   W+++ F ++ YRD+GV ILS++D+IQ +LDD IIK+QTM+GSPFIKPFE E+K WED+L+ + + ID WLKVQA WLYLEPIF SEDI+ QMPEEGR+F  VD  W+++M    K+P  L AT    +L++L + N LLE+I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +LEF   L+I  M S+EGE + ++  I  + A+G VEKWL+QVE++M+ SV  VI  +  +Y  + R  WV +WPGQ+V+C+S ++WT E  E I+    GLK Y  +  +Q+++IV+LVRG L+   R TLGAL  IDVHARDVV +M K+ VS    F WL+QLRYY       V  I+  + Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI Q L  FVFEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++AR L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP+AD+  F     +      LQ  ++F++KI+Q YEM++VRHG M+VGEPF  KT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA+++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS +M+LIFE  DL QASPATVSRCGMIY+EP+QLGW P + S++   + P+C   ++  L+R LF WLI P L+  +  CK+LI TS  + VV L +LF  LL + + N P+                +++I +W+   F+FS +WSIG S    GR  FD F R +  G +   P P S+   +   F E+  +YD+ +E K+ G W  W   I   ++      KI +II+PT +T R T+ +DL +T+ KP++ VGPTGTGKSV + + L+  L KD+Y    IN SARTSANQ Q+IIM +LD+RRKGV+GPP  K+C++F+DD+NMPA EKYGAQPPIELLRQ+ D GHW+D KDTSK+ L+D  L++AMGPPGGGRN V+ R IRHFN+  +N F+D TM+RIF++IV ++   H F   +  +G  +V+ TM +YK+++ + LPTP KSHY FNLRDFSRVI+G LL+    + N   ++RL+VHEV RVFYDRL  ++DR   F + K    D FK +   I  HL   +  V +ED+R L+FGDYM      DD++Y EI ++ + +  ++  LD+YN   K  M+LV+F++ +EH+SR+CRVLKQ  G+ALLVG+GGSGRQS TR+A  MA   IF  EI+++YG NEWR+D+K LL   G   +  VFL +D QIK+E+F+EDI  +LNTG+VPN++ +DEK E++E ++  A     + G K D  +P+A++ +F+ R K NLH+V+A SPIGDAFRNRLR FPSLINCCTIDWFQ+WPEDALE VA KFLE +E+ E  ++ IV +CK +H S+  LSE FL+ L R+NYVT TSYLELI +F++LL  KR  ++  K RY+ GL+KL FA  +VG+MQ+EL  LQP+L     +   ++  +E ++V+VEAKR+ +  ++E A+ KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  DIT+V+SMKNPP  +KLVM AVC+M   KPE+  D S TG  I DYW  S KLLGD  FL  LK +  D++    ++K+R +Y+  P+FDP  V  AS+A EGLCKWI+A++ YD  AK+VAPKK +L+ A+K L  T++ L +K+A+L EVE  L++L     E  + K  LED +ELC KKL+RA QLIGGLGGEKSRW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR +  + W   C +  IPCSE F +   LG+PVKIRAWNIAGLP D+FSIDNG+IVNN  RWPL IDPQGQANKWIKN EK N+LS+IKL+D++++RTLEN IQFGTP+LLENVGEEL+P LEP+L +  F+Q G+D +RLG+ +IEY+ DFKFYITT+LRNPHY+PE++TKV LLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LK++E +ILE LSSS+GNILE+E+AI VL S+K++S EI++KQ IAE T+++I ++R GY+P+A H S+LFF I+D+ANIDPMYQYSL WF+NL++ SI +S KS+ LE R+ YLNDHFT ++Y NICRSLFE  KLLFS  +C  LL  + ++  +   FLLTGGV+L +   NP P W+ DK W E+ RASE P+ +GLR+HF  +  +W+ +YDS+ P

HSP 2 Score: 856.67 bits (2212), Expect = 0.000e+0
Identity = 397/655 (60.61%), Postives = 499/655 (76.18%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH1 (dynein axonemal heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:2940])

HSP 1 Score: 2331.21 bits (6040), Expect = 0.000e+0
Identity = 1296/3082 (42.05%), Postives = 1887/3082 (61.23%), Query Frame = 1
            ++     +  ++   LR +V  SL  F++FI        N  +  V  D+L     +    PL I++L +    + Y    ++ +  L+  +   + ++  +P++E  +  ++   G  L L +V  +E LV               +  + Y   Y+KY  L NN    ++ +FLK  +  GLLA + +      L+++  L        +   F ++T  +   + K+   L   ++    +   +   SIC  +  I+ K+ E P   E L  ++E+++      V       EE + ++M        FL + ++  + D  + +   +WP  I    ++   +     E+  +   +    F+E+LE +   +  F    E+    E+   V+    ++ Q+ DC+      N  E + +   + +  L+ M+K   PY  LW TA D+   +++W+  P   ++A  +E ++VE  K MHK +KQF D P  Q+VA  ++ +I++FK ++P++Q + NPG++ RHW+ +S+ I  +++P    +    L   L  H+E + ++   A KE+ +E+ L KM+++W  + F +  Y+ +   IL + D+   LLDDHI+ +Q M  SP+ KPFE+ +  WE+KL    ++++ WL  Q +WLYLEPIFSSEDI  Q+P E +++  ++  WK++M  + +N   +       ML  L D N +L+ +QKGL++YLE KR  FPRF+FLS+DELLEILS+TKDP  VQPHL+KCFE I RL F E LEI  M SAEGE + +   IYP+     VE WL +VE  M  SV  +I  +I +Y    R +WVL+WPGQ+ I     YWT EV EA+   N       +   Q+ D+V LVRG L+  +R  L AL VI+VHA+DVV  + +  V SVN F+W+SQLRYY    ++++  ++ E  YG EYLGN+ RLVITPLTDRCY TL  AL L  GGAP GPAGTGKTET KDL KA+A Q VVFNCSD LD+ AMGKFFKGLA AGAWACFDEFNRI++EVLSVVAQQI +IQ A  Q ++RF+FEG E+ L P+C +FITMNPGYAGR ELPDNLK LFR VAMMVPDYA+I EISLYS GF +A  LA KI  T++L SEQLSSQ HYD+GMRAVK+V++AAGNL+++ P + NE ++ L+AI DVN+PKFL +D+ LF GI+SDLFP +     D+ I   A+++      L+  E F+ K +Q+YE  +VRHGLM+VG    GK+         + +     +  G M E  V+Y ++NPK+ITMGQLYG+FD ++HEWTDG+ +   R  A+  D  +KW MFDGPVDA+WIENMNTVLDDNKKLCL SGEII+++  M ++FE  DL  ASPATVSRCGM+Y+EP+ LG  PF+E ++  +LP  L   E+H    + LF   ++  + F+R + K++I ++  +  + L KL          +  +++  +++ S +     + I  W    F+FS +WS+G++   SGR+ F  + R        L  + + + L     FPE   ++D+  E    SG N  E          WV  +D  +  ++ PD     II+PT +T + ++ LD+ LT++KPV+ +GPTGTGK++ I++ L++     Y+++ + FSARTSANQTQD I +KLD+RRKGV+GPP  +  + F+DDLNMPA E YGAQPPIELLRQW+DHG W+D+K      +L+D   + AMGPPGGGRN V+ R++RHFN L   E ++ +  RIF+TI+ +W      DG+                    + LV +T+ VY    +  LPTPAKSHY FNLRD S+V +G+L+     + +  +L+RLW HE  RVF DRL  EEDR  +FD +     + ++    K+               + +++GD+M+   D K Y+ ITS   + + +E +++DYN I+ A + LV+F  AM HI R+ R L+Q  G+ALL+G+GGSGR S TR+A+ MA++E F IE+++NYG +EWRDD+K++L+KAG    P+ FLFSD QIK ESF+EDI+ +LN+GD+PNLY +DE+ +I+  M+    I+E+     +  T   +   +  RV+ N+H+VL MSPIG+ FR RLR FPSL+NCCTIDWF  WP +AL+ VA  FL +I   E+++E I   + +C + H+SV +   E+L  L R+NYVTP SYLEL+  F  L+  K+ EL T KNR  +GL+KL   S++V KMQ +L+++ P L   +  T   + +++ DT   E  R  +  E+  AN KA ++Q I DD + DL EA+P L  A+ASL  L +ND+T VR+M+ PP  +KLV+EAVCIM G KP++ P    G  ++DYW     LL D   FL+ L  F  D++    IK + + YI   +F P  +   S AC  +C+W+ A+ KY + AK V PK+  L  A+ +L +T + L E K +L EVE  +  +  +  E   +K+ELE   E C ++L RA +LI GL  EK RW E  + L     NI+GDVL++A  VAYLG FT  +R  + + W K+     +P +    ++  LG PVKIR+W IAGLP D+ S++NG+I   S RW   IDPQ QANKWIKNMEK N L + KL+D +F+R++EN+I+FG P LLENVGEEL+P LEP+L K  ++QQG   L+LGD VI Y++DF+ YITT+L NPHY PEISTK+ L+NF ++P GLEDQLLG V A+E+P+LEE KN LII +A  +++LK++EDQIL  LSSS+GN +++   I VL +SK+ + EI  K  IAE T+ +ID TR  Y PVA+   ILFFC+SD+AN+DPMYQYSL WF+N+FL  I NSE++++L+ RI  +N + T S+Y N+CRSLFE HKL+F+  +C+ ++  + K+N   WR+LL+GG ++     NPAP+W+SD+ W +++  S LP+       F  +  +++ ++DS  P

HSP 2 Score: 678.707 bits (1750), Expect = 0.000e+0
Identity = 328/653 (50.23%), Postives = 449/653 (68.76%), Query Frame = 2
            L    KL+VLRC+R DK+  A+Q F+  NL   FI+P   +L   F DSN  +PLIFVLSPG DP   L KF E+  + + K+++ISLGQGQGP A  M+  +I+ G WV  QNCHLA SWM +LE++ E I  P+  H++FRLWLTS PS  FPVSILQNG KMT EPP+G+RANLL+SY +       F + C+    + ++L  LC FH    ERRKFGPLG+NIPYEF + DLRI + Q++MFL++Y ++P + L Y  GE NYGGRVTDD DRR ++++L+ FYN D++  E + +S SGIY+  PP      Y+ YI+SLP+N  PE++GLH+NA+IT    ET  L   I+   P+ +S   +  E+ ++++  +IL K+PE  +L+ +M +YPV+Y ESMNTVL QE+IR+N+L+ V+  TL +L KA+KGLVVM+++LE +  S+    VP  W+AK+YPSLKPL S+V DL+QRL+F   WI++ +P+ FWISGF+F Q+FLTG LQNFARK+ I ID + F+F++  F+  +++  RP+ G  ++GLFLEGARWD E   L ES PK L+  + +IWL P           YLCP+YKT  R GTLSTTGHSTN+V+ +++P +  Q HWI RGVA +C LD
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1978.76 bits (5125), Expect = 0.000e+0
Identity = 1155/3002 (38.47%), Postives = 1742/3002 (58.03%), Query Frame = 1
            P+ + EL +    ++++PS ++  D ++     C   ++     +P    + F           +  G    L  V  ++K   + + +  +T +      + Y   ++K+         L+++A   +   +    ++++ Y     +   LR +  + L ++DTR L   +     +  E+L      ++++   +I     D   K+  +PT T   V    FL E    E     E+    V ++  L++   +P   ED  +  T+      + N  D +    ++  +Q    L   L +    + E+    +D +  ++   ++  R +  L+ LQ  + D + +  Q    +     E S+F  L  +   L     LW +  ++      WLK  F  L+   +   + +  K + +L K    N     V  ++K K++K K  LPV+  + NP ++ RHW  +   +   +   E    ++ L+  LH     +++++I   A+ E  LE  L K+++ WK  +F +  +RDS  V IL   DDIQ+LLDD  I   T+  S ++ P +  +  W+ +L   N  ++ WL  Q  WLYLE IF++ DI  Q+P E + F  VD +WKE+M +  + P+ L A  Q  +L+   ++N+LL++IQK L  YLE KR+ FPRF+FLSNDELLEIL++T++PQ VQPHL+KCF+ I +LEF                 E++   +I+ M+S EGE +S+   +   KA+G VE+WL +VE  M  S++++   +I  Y    R  WV+   P Q+++ VS I W +++TE +   +      LK++      +++ +  +V+G+L    R  L AL  IDVHARD+V  + + +V +V +F+W  QLRYY D   +  V +++ ++  YG EYLG  PRLVITPLTDRCY  LM AL+L+LGGAP GPAGTGKTET KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ +I+ A A  L RF+FEG E+ L  TC  FITMNPGYAGR ELPDNLK LFR  AMMVP+YALI E+ LYS GF  ++ LA K+   Y+LCSEQLS Q HYD+GMRAVKSVL  AG+L+++ PD  NE ++L++A+ D NLPKFL+ D  LF GIISDLFPGV +P+ D+ I  S + D + ++ LQ     + K++Q YE +LVRHG+M+VG   GGKT  Y+ LA  L ++   G    +   V   ++NPK+ITMG+LYG+ + ++ EW DG++A+  R       +  KW++ DGPVDA+WIENMNTVLDDNK LCL + E I+++ +++++FE  DL  ASPATVSRCGM++++P +L W P+++++++  +   L E+  + I +LF+  +D  L FI   C + I   +I  V  L  L  SL   I  +  V  A   E + +  I  Q         F+F ++WS+G +L E+    FD F R      NP    P S  L   +            F+ K    W+  + T        + D    E+++PT +T R  Y ++  L  +  V+  G TG GKSV+    L ++ +   Y+   +NFSA+TS+ +TQ+II +KL+R+RK + G P  KR V+FVDDLNMP  ++YG+QPPIELLRQ+ D G ++D+       + D  ++SA  PPGGGRN V+ R IRHF++L +   +++++ +IF  I++  F   F     +    +V +++ +Y K     LPTPAKSHYVFNLRD S+ ++G+L      +    ++ RL+ HE  RVF+DRL   ED+  +F ++    A+           H  ++  +     + +IFGD++       D+IYD++  ++  A  ++ +LDDYN  +   + LV FQ A+EH+SR+ R+++Q+ G+ALLVG+GG+G+QS TR+AA +  ++   IE++R Y  + + +DL++L   AG + K +VFLF+D QI  E F+EDI+ +LN+G+VPNL+  DE    LE++  A R   K+ G   +     ++ YFI +V+Q LHIVL MSP+G+AFR+R RMFPSL+NCCTIDWF  WP +AL  V+  F   ++  +E  +E + +MC   H SV  ++E + N LRR  Y TPTSYLELI  +  +L+ KR ++I+ ++R   GL KL   +  V KM+++L AL+P L+  S   + L+ K+  D    +  R  +  ++  A VKA E+Q I DD + DL EA+P L  A  +LD+L + DI+ +R    PP L+  VMEA+ I+L  KP+              W S+ +LLGD  FL RL  +  +++ PQ + KL +KYI  PDF P+ V   S AC+ +C W+ A+D Y    K+V PK+ KL  A+ EL+IT+  L EK+A L +VE ++Q L D+ D+    K+ L   + L   +L RA +L   L  E+ RW E+ +   E   NITG+V ++AA VAY G FT  +R S++E W + C  + IP   SF +++ILG+P +IR WN  GLP D  S +NGI+V    RWPL IDPQ QAN+WI+N E  + L IIKLTD+NF+R LENSI+ G PVLLE + E L+P LEPIL K IF   G   +RLGD+ I+Y+K+F+FY+TT++ NPHYLPE+  KV ++NF +T  GLEDQLL  V   EKP LEE++  LI+    +K +LK +E++IL +L +S+GNIL+NE  I+ L  SK+ S  I  +   AE T+  I+  R  Y+PVA  GS+++F I+ ++ IDPMYQYSL +F  LF  +IE S K+E+L+ R++ L +   L+ Y N+ R LFE HKL++S  +C+ +++ +  ++D  W F L G   L+    P P   W+    W       E  P   GL ++

HSP 2 Score: 598.201 bits (1541), Expect = 1.194e-170
Identity = 296/678 (43.66%), Postives = 449/678 (66.22%), Query Frame = 2
            L    KLI+++C + +K+V A+  F+ +NLG+ FI+ PP DL + + D +C +PL+F+LS G+DPM A  +F  + GY + ++ SISLGQGQGPIA KM+  A++ G WV LQNCHLA SWM ++E++ +    P++  K+ FRL+L+S PS  FPV++LQN VK+TNEPPKGLRAN+ R++     S   FF+      +W  ++FG+CFFHA++QER+KFGPLGWNI YEFN+SD   ++  ++++  +  ++P +AL Y+TGE  YGGRVTD  D+R L ++L+ F++ + +E E Y +S SGIY++P   + Q + +YI +LP+  +PE++G+HENA++    +ET+ L + IL   PR ++G EGKS ++ +QEL   +  ++PE  ++E   +   V   +    S+ TVL QE+ RFN L+ ++ ++L  L KAI G VVM+ E+E+V+NS L  +VP  W+  +YPSLKPLGS+V DLI R +F   W++   P ++WISGF+F Q FLTG LQN ARKY +PIDE+ F++ +  T  D +  I+                   PEDG  V+G+F++ +RWD +  ++ ++LP  +   +P++  +P +       + Y CP+YKT AR GTLSTTGHSTNFV+ + LP+  S+++WI +G A LCQL +
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: che-3 (Cytoplasmic dynein 2 heavy chain 1 [Source:UniProtKB/Swiss-Prot;Acc:Q19542])

HSP 1 Score: 796.579 bits (2056), Expect = 0.000e+0
Identity = 709/2632 (26.94%), Postives = 1264/2632 (48.02%), Query Frame = 1
            EEM + +QF+ E + Q     D  E++ KE      E  +  ++  + +++  +   W   L + + N+        EL+ ++ E  IV  +K       + K +++         ++ ++   ++ FK     L+      +   HW +M   +G     T E+    D L+    + ++ ++L+++ + A  E  +   + ++     + +F L +Y+ S    L          ++L D Q LL       Q++K SP+   F  +  +WE +L  ++  +    ++Q  W+YLEPIF        +P E  +F  VD  ++ ++ +  K+   +    ++ + K L      L   QK LN +LE+KR  FPRF+F+ +D+LLEIL ++ +PQ +Q H+KK F+GI+R++F+   E II M+S+EGET  LS   +I P      VE WL ++ + M  ++K +   ++     +     +  +P Q V+C++     +EV  + ++ N L     L    SQ+ + +K    N+   ++++   L +L +  +H  DVV+ +   Q  S+N++ W  QLR+Y   G + + Q+S+E  Y  EY GN  +LV TPLTD+CY TL  A+ + LGG P GPAGTGKTE+ K LA  + +Q +VFNC +G+D  +MG+ F G+ + GAW CFDEFNR++  VLS V+ QIQ+IQ AI        F G  + +NP   +F+T+NP   GY GRQ++PDNLK LFR+V M  PD  LI    LYS GFVDA ALA KIV+ ++L  + LS Q HYD+G+RA+K VL   G LR+   + +NE+ L+++A+    L K    D   F  +I D+F  V      F+     +     +  ++  +  ++K+ Q+YE +  R G+++VG    GK+  ++ L  +L       T +  KV     NPKA+   +L G  D  + EW+DG++ +  RE  V +D     W++ DG +D  W+E +N+VLDDN+ L + SGE IQ  + +N +FE   L+ ASPATVSR GMIY+    +  +  + S++     +   ED   L  D+  W+ +    F R  C K + + +I  +     L + L         ++ ++T+          Q + L   G            ++    R +F   V F+ ++       P PK+I                 C++++  G     ++  D  S +++ +    E + P  +TA    + D+  +     + +  ++ G TG GK  L+ +     P+ +  +  +  SA++S++    +I     +       V+ P      ++F+  +N+PA +KYG    + LL+Q + +  +FD  +   + + +   + +M P G G    +S+R+      + +N  + + +  I+ T +    E     V  R  +++ +  +++Y K  ++F PT +   ++F+ RD +  +  V L+ H  L  G KL  +   E  R+F DRL  E D+LKF +I++  +  +   +T I K   +++    V  E   GL        D  ++++     LAK +  F  +  + +    S + F  A      + RVL    GH  L G  G GR+ + R+ A M + ++F   +T N+   ++ ++LK  + +A  + + +V +  D+Q+++  F++ I+ LL +G+VP L+   E   ++  +  AA  +   TG        A+  +   R++  +H+VL +    + F+  +   P+++  C + +   +  ++L  +       I+M+         +   +++ +  L E           + P  Y + ++ F +LL +KR  L     R   G+ KL  A  EV KMQ +       L    A+ D+ L  + +     E ++   E + A  E  NV+  E    K   +  L E  P++ +A  ++ ++K   ++ +RS++ PP  ++ +++AV + +G             +++  W +  K L      D + NF A+ +  +  KK+      + + F+    + AS A   L  W+ A  +Y    + +AP           L  AEK++E   K L      + E++ K + L  +  + +      +D I +       A  L+  L GE  RW    +   E    +    L+++A + YLG  +   R S+++     C    +P   +FK +       +   W   GLP D  S++NG I+  S   PL ID  GQ + ++ K +EKS      K    + +  +E +I+FG  ++++++  E +  L PIL+K +  Q     +  G   I++N DFK Y  TR       P    ++ ++NF  T   L  QLL +    EKPELEE+ + L+ ++   K +L+ LE  +L+ L+SSQGN+LEN   ++ L+ SK  ++ I++    +E    E+   ++ Y P+++  S LFF  S++   +PMY YS+N  ++LF  +I++ E      TR+E L     L+V+ +I R +F   +L+F++    A +

HSP 2 Score: 181.03 bits (458), Expect = 1.479e-44
Identity = 165/623 (26.48%), Postives = 281/623 (45.10%), Query Frame = 2
            K++ ++ ++P+++   +  F+   L    I+PP F+L   F +S    P++F+L+ GADP   L +F            SIS+GQGQ   A + I ++   G W+ L N HL    + S+ K    +  P   H+NFRLWLT+     FP  +LQ  +K+T EPP G+R NLLR+Y           D    N      +F L + HAL+QERR F P GW   YEF  SD+R++   V Q+     D+ E     L ++     YGGR+ +D D ++L S L + +  + +          GI         Q YI +I +S+P    P ++GL EN   +    E ++  S I                D I ++   + KKL ++ DL        +  ++ ++ VL  E I    LI  +  ++ ++ K++K   + +  +++   S++  + P+ W +       P   Y+N ++++    L  F         + P  F  S  ++   FL  + Q  +R+  IP+D++            T  ++  +    V GL L+GA +D  + +   ++    ++  PI++L        + SST        PVY +S R
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 546.199 bits (1406), Expect = 3.243e-155
Identity = 340/951 (35.75%), Postives = 525/951 (55.21%), Query Frame = 1
             ++ERHW QM       +K    +  +  LT G      + +H   +++I   A  E  LE+ L +M+E W+  + EL  Y++    ++   DD+   L +H      MK SP+ K FE+  + W++KL  +N + DVW+ VQ  W+YLE +FS S +I   +P E  +F  +      +M +   +P  L      G + +L+RL D   +L +IQK L +YLE++R  FPRF+F+ +++LLEI+  +KD  R+Q HLKK F GI  ++  E+   I    S EGE + +V  +     +  +  WL  +E  M +++ + +  S        I++        W+  +P Q++   + I+W  E+ + +    G ++        ++ +   V        R  + AL    VH RD    +  +++ + N F WL  +R+Y    +   V  C +   +++  YG EYLG   RLV TPLTDRCY T+  AL   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D++AMG+   GL Q GAW CFDEFNR+E  +LS V+QQIQ+IQ A+  G    V   G  L++N    +FITMNPGY+GR  LPDNLK LFRS+AM  PD  LI ++ L+S GF  A  LA+KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+++    KM     E +    +L++++ +  +PK +++DI L   ++SD+FPG+              S V D      +  + +    ++DK+LQ+Y++  + HGLM+VG    GKT A++ L            ++ ++   G   +I+ KA++   LYG  DP + EWTDG+   + R+       + DRR+W++FDG VD  W+EN+N+VLDDNK L L +GE + +   + +IFE ADL+ A+ ATVSRCGM++

HSP 2 Score: 531.176 bits (1367), Expect = 1.251e-150
Identity = 360/1413 (25.48%), Postives = 697/1413 (49.33%), Query Frame = 1
            +E +  G+WQ W   V T++ ES  ++      ++++PT +T R    L  +L   KP+++ GP G+GK++ +   L  L   + +   N+NFS+ T    T ++++   D      R   GV   P +  +  V+F D++N+PA +KYG Q  I  LRQ ++   ++   D S + L     + A  PP   GR+ ++SR +RH  ++ V+     ++ +I+             G FNR           L   L ++ ++VY  +   F     + HYV++ R+ +R ++G+   + P  +L + E+L+RLW HE  R+F DRL  EE+R ++ D +  TTA+ +  N  ++           DE + R L++  +++ + +      L++ ++ R++ F ++     +  + LV+F   ++H+ R+ R+ +Q  GH LL+G  G+G+ + +R  A++    +F +++   Y   ++ +D++ +L +AGC  + L F+  ++ +    F+E ++ LL  G+VP L+  DE   ++ +++  A    ++ G  +DS    +Y +F ++V +NLH+V  M+P G   R R    P+L N C ++WF  W E+AL  V ++    +++D                       R+A+V      H++V++ +E       R    TP  +L+ IK F  L + KR++L   K     GL K+    ++V ++Q  LK    EL       +  L ++  D  + E +++     Q++   +  +  E K   E DLA+  P + +A  ++  +K++ +  V+SM +PP  +KL +EA+CI+LGE             +   W +  +++    F+ R+  F  + + P+ +K++ EKYI  PD++   V  AS AC  + KW  A   Y      V P + +L   E+E     ++      ++ E+E  +    ++  +   + + ++ ++    +K++R+ +L+  L  E+ RW+  +   S++  ++ GD L+S+A +AY G +    R+ +   W    +   +        ++ L        W +  LPVD    +N I+++  NR+PL IDP GQA ++I        +      D +F + LE++++FG  +L+++V E  +PIL P+L + + R  G   + +GD  I+ +  F+ ++ TR     + P+I ++V  +NF +T   L  Q L  V   E+P++++K+N L+    +   +L+ LE  +L  L+ S+G IL++ + I  L   K  + E+++K    +    E+D     Y+ ++   S ++  +  +  I  +Y YSL++ + +F   ++  E S   D   R+  +      +V+R + R +    K+L +L +

HSP 3 Score: 171.014 bits (432), Expect = 1.571e-41
Identity = 139/567 (24.51%), Postives = 250/567 (44.09%), Query Frame = 2
             ++ LIV+  +RPD+++ +    ++      F+      D+LS   N+ +   P++   + G D    +    ED     ++ + SI++G  +G   A   +  A + G WV+L+N HLA SW+  LEK    +      H  FRL+LT+      P SIL+    +  EP  GL+ANLLRS  + P    +      + SR   +   +C+ HALVQER ++ PLGW+  YEF+++DLR++   +   ++   +         LP   L  L  +C YGG++ +  D+ LL  +L+  + A   E++      +      ++P        I ++  L     P   GL  NA+     +    +   +L     + +      E+        + ELA   L+ LP+     + M+R      + +     +E+   ++L+  +R  L  +    +     NNE   +  S+  G+VP  W   + P    +  ++ DL +RL         +N    TFW+ G +  ++++T   Q  A+  T  ++++     I   D STD+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 546.199 bits (1406), Expect = 3.243e-155
Identity = 340/951 (35.75%), Postives = 525/951 (55.21%), Query Frame = 1
             ++ERHW QM       +K    +  +  LT G      + +H   +++I   A  E  LE+ L +M+E W+  + EL  Y++    ++   DD+   L +H      MK SP+ K FE+  + W++KL  +N + DVW+ VQ  W+YLE +FS S +I   +P E  +F  +      +M +   +P  L      G + +L+RL D   +L +IQK L +YLE++R  FPRF+F+ +++LLEI+  +KD  R+Q HLKK F GI  ++  E+   I    S EGE + +V  +     +  +  WL  +E  M +++ + +  S        I++        W+  +P Q++   + I+W  E+ + +    G ++        ++ +   V        R  + AL    VH RD    +  +++ + N F WL  +R+Y    +   V  C +   +++  YG EYLG   RLV TPLTDRCY T+  AL   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D++AMG+   GL Q GAW CFDEFNR+E  +LS V+QQIQ+IQ A+  G    V   G  L++N    +FITMNPGY+GR  LPDNLK LFRS+AM  PD  LI ++ L+S GF  A  LA+KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+++    KM     E +    +L++++ +  +PK +++DI L   ++SD+FPG+              S V D      +  + +    ++DK+LQ+Y++  + HGLM+VG    GKT A++ L            ++ ++   G   +I+ KA++   LYG  DP + EWTDG+   + R+       + DRR+W++FDG VD  W+EN+N+VLDDNK L L +GE + +   + +IFE ADL+ A+ ATVSRCGM++

HSP 2 Score: 531.176 bits (1367), Expect = 1.251e-150
Identity = 360/1413 (25.48%), Postives = 697/1413 (49.33%), Query Frame = 1
            +E +  G+WQ W   V T++ ES  ++      ++++PT +T R    L  +L   KP+++ GP G+GK++ +   L  L   + +   N+NFS+ T    T ++++   D      R   GV   P +  +  V+F D++N+PA +KYG Q  I  LRQ ++   ++   D S + L     + A  PP   GR+ ++SR +RH  ++ V+     ++ +I+             G FNR           L   L ++ ++VY  +   F     + HYV++ R+ +R ++G+   + P  +L + E+L+RLW HE  R+F DRL  EE+R ++ D +  TTA+ +  N  ++           DE + R L++  +++ + +      L++ ++ R++ F ++     +  + LV+F   ++H+ R+ R+ +Q  GH LL+G  G+G+ + +R  A++    +F +++   Y   ++ +D++ +L +AGC  + L F+  ++ +    F+E ++ LL  G+VP L+  DE   ++ +++  A    ++ G  +DS    +Y +F ++V +NLH+V  M+P G   R R    P+L N C ++WF  W E+AL  V ++    +++D                       R+A+V      H++V++ +E       R    TP  +L+ IK F  L + KR++L   K     GL K+    ++V ++Q  LK    EL       +  L ++  D  + E +++     Q++   +  +  E K   E DLA+  P + +A  ++  +K++ +  V+SM +PP  +KL +EA+CI+LGE             +   W +  +++    F+ R+  F  + + P+ +K++ EKYI  PD++   V  AS AC  + KW  A   Y      V P + +L   E+E     ++      ++ E+E  +    ++  +   + + ++ ++    +K++R+ +L+  L  E+ RW+  +   S++  ++ GD L+S+A +AY G +    R+ +   W    +   +        ++ L        W +  LPVD    +N I+++  NR+PL IDP GQA ++I        +      D +F + LE++++FG  +L+++V E  +PIL P+L + + R  G   + +GD  I+ +  F+ ++ TR     + P+I ++V  +NF +T   L  Q L  V   E+P++++K+N L+    +   +L+ LE  +L  L+ S+G IL++ + I  L   K  + E+++K    +    E+D     Y+ ++   S ++  +  +  I  +Y YSL++ + +F   ++  E S   D   R+  +      +V+R + R +    K+L +L +

HSP 3 Score: 171.014 bits (432), Expect = 1.571e-41
Identity = 139/567 (24.51%), Postives = 250/567 (44.09%), Query Frame = 2
             ++ LIV+  +RPD+++ +    ++      F+      D+LS   N+ +   P++   + G D    +    ED     ++ + SI++G  +G   A   +  A + G WV+L+N HLA SW+  LEK    +      H  FRL+LT+      P SIL+    +  EP  GL+ANLLRS  + P    +      + SR   +   +C+ HALVQER ++ PLGW+  YEF+++DLR++   +   ++   +         LP   L  L  +C YGG++ +  D+ LL  +L+  + A   E++      +      ++P        I ++  L     P   GL  NA+     +    +   +L     + +      E+        + ELA   L+ LP+     + M+R      + +     +E+   ++L+  +R  L  +    +     NNE   +  S+  G+VP  W   + P    +  ++ DL +RL         +N    TFW+ G +  ++++T   Q  A+  T  ++++     I   D STD+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-1 (Dynein heavy chain, cytoplasmic [Source:UniProtKB/Swiss-Prot;Acc:Q19020])

HSP 1 Score: 545.428 bits (1404), Expect = 4.089e-155
Identity = 340/951 (35.75%), Postives = 525/951 (55.21%), Query Frame = 1
             ++ERHW QM       +K    +  +  LT G      + +H   +++I   A  E  LE+ L +M+E W+  + EL  Y++    ++   DD+   L +H      MK SP+ K FE+  + W++KL  +N + DVW+ VQ  W+YLE +FS S +I   +P E  +F  +      +M +   +P  L      G + +L+RL D   +L +IQK L +YLE++R  FPRF+F+ +++LLEI+  +KD  R+Q HLKK F GI  ++  E+   I    S EGE + +V  +     +  +  WL  +E  M +++ + +  S        I++        W+  +P Q++   + I+W  E+ + +    G ++        ++ +   V        R  + AL    VH RD    +  +++ + N F WL  +R+Y    +   V  C +   +++  YG EYLG   RLV TPLTDRCY T+  AL   LGG+P GPAGTGKTE+ K L   + +  +VFNC +  D++AMG+   GL Q GAW CFDEFNR+E  +LS V+QQIQ+IQ A+  G    V   G  L++N    +FITMNPGY+GR  LPDNLK LFRS+AM  PD  LI ++ L+S GF  A  LA+KIV  + LC EQLS Q HYD+G+RA+K VL +AGN+++    KM     E +    +L++++ +  +PK +++DI L   ++SD+FPG+              S V D      +  + +    ++DK+LQ+Y++  + HGLM+VG    GKT A++ L            ++ ++   G   +I+ KA++   LYG  DP + EWTDG+   + R+       + DRR+W++FDG VD  W+EN+N+VLDDNK L L +GE + +   + +IFE ADL+ A+ ATVSRCGM++

HSP 2 Score: 531.561 bits (1368), Expect = 6.582e-151
Identity = 360/1413 (25.48%), Postives = 697/1413 (49.33%), Query Frame = 1
            +E +  G+WQ W   V T++ ES  ++      ++++PT +T R    L  +L   KP+++ GP G+GK++ +   L  L   + +   N+NFS+ T    T ++++   D      R   GV   P +  +  V+F D++N+PA +KYG Q  I  LRQ ++   ++   D S + L     + A  PP   GR+ ++SR +RH  ++ V+     ++ +I+             G FNR           L   L ++ ++VY  +   F     + HYV++ R+ +R ++G+   + P  +L + E+L+RLW HE  R+F DRL  EE+R ++ D +  TTA+ +  N  ++           DE + R L++  +++ + +      L++ ++ R++ F ++     +  + LV+F   ++H+ R+ R+ +Q  GH LL+G  G+G+ + +R  A++    +F +++   Y   ++ +D++ +L +AGC  + L F+  ++ +    F+E ++ LL  G+VP L+  DE   ++ +++  A    ++ G  +DS    +Y +F ++V +NLH+V  M+P G   R R    P+L N C ++WF  W E+AL  V ++    +++D                       R+A+V      H++V++ +E       R    TP  +L+ IK F  L + KR++L   K     GL K+    ++V ++Q  LK    EL       +  L ++  D  + E +++     Q++   +  +  E K   E DLA+  P + +A  ++  +K++ +  V+SM +PP  +KL +EA+CI+LGE             +   W +  +++    F+ R+  F  + + P+ +K++ EKYI  PD++   V  AS AC  + KW  A   Y      V P + +L   E+E     ++      ++ E+E  +    ++  +   + + ++ ++    +K++R+ +L+  L  E+ RW+  +   S++  ++ GD L+S+A +AY G +    R+ +   W    +   +        ++ L        W +  LPVD    +N I+++  NR+PL IDP GQA ++I        +      D +F + LE++++FG  +L+++V E  +PIL P+L + + R  G   + +GD  I+ +  F+ ++ TR     + P+I ++V  +NF +T   L  Q L  V   E+P++++K+N L+    +   +L+ LE  +L  L+ S+G IL++ + I  L   K  + E+++K    +    E+D     Y+ ++   S ++  +  +  I  +Y YSL++ + +F   ++  E S   D   R+  +      +V+R + R +    K+L +L +

HSP 3 Score: 171.4 bits (433), Expect = 1.072e-41
Identity = 139/567 (24.51%), Postives = 250/567 (44.09%), Query Frame = 2
             ++ LIV+  +RPD+++ +    ++      F+      D+LS   N+ +   P++   + G D    +    ED     ++ + SI++G  +G   A   +  A + G WV+L+N HLA SW+  LEK    +      H  FRL+LT+      P SIL+    +  EP  GL+ANLLRS  + P    +      + SR   +   +C+ HALVQER ++ PLGW+  YEF+++DLR++   +   ++   +         LP   L  L  +C YGG++ +  D+ LL  +L+  + A   E++      +      ++P        I ++  L     P   GL  NA+     +    +   +L     + +      E+        + ELA   L+ LP+     + M+R      + +     +E+   ++L+  +R  L  +    +     NNE   +  S+  G+VP  W   + P    +  ++ DL +RL         +N    TFW+ G +  ++++T   Q  A+  T  ++++     I   D STD+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Match: dhc-3 (Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G5EDV4])

HSP 1 Score: 259.61 bits (662), Expect = 2.070e-68
Identity = 145/388 (37.37%), Postives = 238/388 (61.34%), Query Frame = 1
            T    L+++ T  KL   KR E+     +Y  G+EK++ A ++V  MQ EL  LQP+L+ TS +T  L++ +E++T++VE  RE++AA +  AN  A ++Q +K + EA+LA A+P L  A+ +L+T+ Q+D++ +++M+ PPY ++L MEAVCI+LG KP  K     G+++ DYW S  KLL D  FL ++++F+ D+V+ + +K +REKY+ + +FDP+ V+  S A EGLC+W++A+D Y+  +KIV PK+ +L  AE  ++  LKQL  K+  L +V  KLQ L+DQ  +  Q+K+ELE  I  C  +++RAE+L+  L GEK +W      ++          + S+  +   G   +  R   +    +     +E+TIPC

HSP 2 Score: 140.584 bits (353), Expect = 2.134e-32
Identity = 130/543 (23.94%), Postives = 242/543 (44.57%), Query Frame = 1
            K++  + +F+  LPVL  I    +++RHW  +       +K      + + L     +  +K E++GA A KE  LE ++ KMK  W    F        G  +L+   ++QM    H+ +SQT+  SP        ++ W D L+++N  + ++ +    W  +E +FS+EDI  QMP E R F  + + W  +  +  +    L    Q D++++L    S LE     ++ G + YL KKR  FPR F LS++ +L ++ ++++P   + ++   F  +   +   ++EII  +S + ET+S+V  +    +K  VEKW+ ++++ +  +++  I   IE  +Y ++     +L+ P Q+      I +T ++  ++   N L     +    I D    V       E   L  L  I   +  +V  +   QV  ++ + W SQLRYY     V++   +    Y  E  G    ++   L D   +  +        G   G          + +A A+ K   + +    +D K +
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dhc36C (gene:FBgn0013810 transcript:FBtr0304742)

HSP 1 Score: 2770.34 bits (7180), Expect = 0.000e+0
Identity = 1470/3037 (48.40%), Postives = 2019/3037 (66.48%), Query Frame = 1
            VK FF  +A+LM+ QL ++   SL ++ +FI  + + N  G E          +M+ +    E  I + PSF +++  L+R    I+ S + +PR+E  L+ ++   +    T    E +V    +      ++  +GP+  L  +  + +L+N      V  F++           +  Y++ +D ++    +V    F    R +    +   C +L+ +LL     ++   I R + + YD I  K   +P DT  L+ ++ ++  A    V  ++   +  +  +++L+D+      +IK N+  F W   + ++F+     I  +  + +E L+ R+  F   L+   + ++ +    ++  +   ++    LD+   ++    + ++Q+N+EE+   W+ SQ+P+       L PY  L+    DF  K D W+       +   I+ D+    +I+ KL KQ  D+P   ++   VK +I+ F+ H+P++  + NPG++ RHW+ +S+IIGF IK + E +L   + Y L +++ K E I  +A KE+ LE+ +AKM  +W+ ++F ++ YRDSG   L+A+DDIQ+LLDD IIK+QTMK SP+IKPFE ++  WE KL+ + +I+D WL+VQATW+YLEPIFSS DI  QMPEEGR+F  VD  WKE+M +  ++P  +V      M  +L  + SLLE IQKGLN YLEKKRLYFPRFFFLSNDELLEILSETKDP RVQ HLKKCFEGI  L FTE+L++  M S+E E +++V  I  +KA+G VEKWLL++E  M  SV   ++++  SY+   R  WVL WPGQ V  +S  YWT E+TE          L  YL KC  QI+ IV LVRG+L +  RITLGAL V+DVHARDV+  +   QV  +  F+WL QLRYY     +    I+  LPYG EYLGNTPRLV+TPLTDRCYRTL +AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGLA  GAW+CFDEFNRI+LEVLSVVAQQI +IQ  I  G    VFEGT L+L+PTC +FITMNPGYAGR ELPDNLK LFRSVAMMVPDYALI EI LYS GF+ A+ L+ KIVATYRLCSEQLS+Q HYDYGMRAVKSVL AAG L+ +  D ENE IL+L++I DVNLPKFL+QDIPLF+GI SDLFPG  LP+AD+ +F    +    ++  Q   + ++K+ Q+YEMI+VRHGLM+VG PFGGKT  Y+ LA AL  +       E K  Y +INPKAITMGQLYGQFD VSHEW+DG+LA+ +R FA++    RKWL+FDGPVDA+WIENMNTVLDDNKKLCLMSGEIIQ+SN  NL+FEP DLE ASPATVSRCGMIY+EP+ LGW P + S+ +  LP   +    QLI  L        L  +R + K++  TS+ + +V L   F   +D+ R++  V       D D +   AQ      +G+FLFS +WS+G SL    R KF++ FR L     P      Y  P+ +    L K   F  P++ +++D+ + K+  G W+ W + ++  +  I  D  +N+III T E+ R    LDL   H KP+++VGPTGTGKSV + +Y++ ++    Y    I+FSA+TSANQTQDIIM+KLD+RRKGV+GPP   R V+FVDD++MP KE YGAQPPIELLR  +DH  W+D+K+   + LID  ++ AMGPP  G N V+ R  R FNV+ +++FN++ +  IF+ IV WH +  GF   F+     +V +T+ +Y  A  + LPTPAKSHY+FNLRDFSRVI+GVLL       +   + RLWVHEV RV+ DRL  + DR   F+ +  T   CF T+  ++ G L    K + E D R LI+ D+     D K Y E+  L+ L + +E +L +YN++SK PM+LV+F+FA+EH+SR+CR++KQ   HALL+G+GGSGRQS TR+A+ + D+E+F +EITR YG  E+ +D+K +L K G      VFLF+D QIK ESF+EDIS LLN+G+VPNL+ ++EK E+ EKM    +  +K    + D +P+A++N+F+   K  LHIVLAMSPIGDA RNR+R FPS++NCCTIDWFQ+WPEDAL  V+ +FL   ++    R   + MC  +H S ++LS +F + L RYNYVTPTSYLELI+TFK LL+ KRN +   +NRYLTG+ +L+ A+++V  MQ +L AL+P+L   S    + +AKV  D+   E +REI+  ++  A  +AA +QEIKD+C+A L EA+PIL  A+A+L+TL   DI +V++MK+PP  +++VMEAVCI+   KP++ P+ S    +EDYW  S ++L D KFLD L NF  D++  + +KKL ++ +    FDP  +++ASTACEGLC+W+IA+ KYD  AKIVAPKK+ LA AE      +K L EK A L +VEA L  +   LDE  ++   L    E CTKKL RA++LI GLGGE++RW+E AKML   + ++TGDVL+S+ VV+YLG FT+ FR   +  W  KC+   + C+  F++  +LGEPV+IR WNI GLP D+FSI++ I++ N+ RWPL IDPQGQANKWIKN EK+N+L +I+L   ++ R +EN+IQFG PVLLEN+GEEL+P+LE +LQKT+F+Q G   ++LGD+VIEYN  F+FY+TT+LRNPHYLPE++ KV LLNFMIT QGL+DQLLGI  A+E+P+LE +KN LI++ ADNKR LKE EDQILEVLSS++ NILE+ETA+ +LSS+K L+ +ISEKQ I E T+ +ID  R  Y P+A H +ILFF I ++ANIDPMYQYSL WF+NL++ SI+N+EK +D+  R+  L +HFT S+Y NICRSLFE  KLLFSL + I ++K  N++++  W FLLTGGV L+NPY NP   W+  + W E+ R + L + KGLRE F  N+ +WK  +DS+SP+

HSP 2 Score: 763.451 bits (1970), Expect = 0.000e+0
Identity = 358/657 (54.49%), Postives = 476/657 (72.45%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dnah3 (gene:FBgn0035581 transcript:FBtr0289982)

HSP 1 Score: 2744.92 bits (7114), Expect = 0.000e+0
Identity = 1488/3201 (46.49%), Postives = 2065/3201 (64.51%), Query Frame = 1
            +++ +L+    P+     +  I++ C ++  +L   WLPRCA L  + R  W  L+P             F  I S MS  L ++++ S+N   + +   K GN                         G  FD       P       + + +   A+P                            K+   P  +EL  +    ++ I+     IPR+E  +    PE +G   FL  +  +        ++  Q  K N  G   YL  VYK Y  L        V+    E +   L A+++ +   Q + D    LR  +PL+LFMLD R + + +     ++ + ++ F    N   NR+IC   ++++ K  E P +T  +VA+Q ++ +     +F +K+E +  ++R++FLL +  +  +++ LN+  F  P  +  V D++  R+   R+  E  LR R ++FE+ L +  ++++ F+ +E   V+T+EE++  V  +D L   I++   + + +N EE++L  + S FP+LA +I+ ++P  +LW+T+ +F      W+   F  LNA  +   +  M+KIM+KL +Q   NP A++ A +++ KI+KF+ +LPVL  IC  G+++RHWDQ+S I+G  + P    +L D +   +   L +LEEI  AA KE+ L   L  M+ DW+++ FE+ +YRDS   IL++LDDIQ LLDDHI+++Q MK SPFI     +   WE +L+ + +IID W +VQ TW+YLEPIFSSEDI+ QMP EGR F  VD  W+++M  ++K+   + AT   +ML+  T +   LE + KGLN YLE+KRL+F RFFFLSNDELLEILSETKDP RVQPHL+KCFEGI  L F + +EI+ M+S E E +++V KI P  A G+VE WL +VE VM++SVK+ + ++ E Y + +R  WV+ WPGQ+V  +SC+ WT EV EAI     L  YL K N QI D+V+LVR +L +G RI + AL V+DVH RDVV+ +   +++++  F+W+SQLRYY   +   E WVC   + T++ YG EYLGN PRLV+TPLTDRCYRTLM ALKL LGGAPEGPAGTGKTETCKDLAKAVAK+CVVFNCSDGLDYKA+GKFFKGLAQ+GAWACFDEFNRIELEVLSVVAQQI +IQ AI + + +F FE T L L+PTC++FITMNPGYAGR ELPDNLKVLFR+VAMMVPDYA+IGEI+LYS GF  AR L+ KIV  Y+LCSEQLSSQ HYDYGMRAVKSVL A+ +LR+   D     I+L +AI DVNLPKFL QDI LF GI  DLFPGV+LP          +  NL  R LQ   W+++KILQIYEM+LVRHGLMIVG   GGKT AYQ LA  L +++   + T++E+ V + IINPKAITMGQLYG+FDPVSHEW DGVLA  FRE        R W+MFDGPVDAVWIEN+NTVLDDNKKLCLMSGEI+QM+  MN++FEPADLEQASPATVSRCGMIYMEP+QLGWR   +SFI   +  + L + ++ L  D+ EWL+   L+F+   CK+++E S I+      + F   L++ +                     Q    W Q +FLF F W+  S+L   G+  FD   R++  G N  +PKPK   L +   FPE+L   D+ F++    NW  W  + D  S +     +A+I+E+I+PT ET   +Y+ +  ++    ++VVGPTGTGKS +I + L+ +PK   L N INFSARTSA   QD IM+KLDRRRKGV+GP   K+C VF DD+ MP+K+ YG+Q P+ELLR W+DHG+W D  DT+K+ L+D  L+ AMG  GG  N +  R+ RH  V+ V+ F D+T++RIFTTI DWHF  G+      L + L  + ++VY+ AI SFLPTPAKSHY F+LRD +RV +G+++VP   + + EKL RLW HE YRVFYDRL  ++DR    D + +   D  K+N+    E+  G     G K+ D D+R L +G+YM  D   K YDE  + + L K M+ +L +YNS S  PM LVMF+FA+EH+SRV RVL+   G+ L+VG+GGSGR+S+ R+AA++AD  +  ++++++Y   +WRDDLK++L+ A  +    VFLFSD Q   E ++EDI+ +LNTGD+PNLY  ++KA I+E M N A    K+ G+ +D+ P  +Y Y+I+R+++ LHI LA SPIGD+F+ R+R++PSLINCCTIDW+  WPE+AL  V   F+                                    +E ++   EA ++ C  ++H+SV   SE+    L R NYVTP++YLEL+K F+     K +E+  L++RY TGLEKL+FA+ +VG+MQ  L  LQP+L V S +TD+++  +E++T E E K+E++ A++  AN  AA +Q IKDDCE DLAEA+P +  A+ +L+TLK  DI +V+SMKNPPY +KL MEAVC++ G KP+RKPD S G M+EDYW  S+++L D KFLD LK F  D++ P  IK++REKYI + DF P+ ++ AS ACEG+C+W+ A+D YD  A+IV PKK  LA AE EL   +++L  K+A+L  +  KLQ L D   E  + KK LED I+ C KKL+RAE+L+GGLGGEK+RW+EAAK L E   NI GDVL++    AYLG FT  +R ++++ W+  C    IP SE+F +   LG P+ IRAW++AGLP D+FS++NGIIV NS+R+ L IDPQ QANKWIKNMEK+N L +IK +D N+++ LE +I FG PVL+ENVGE+L+  L PIL+K + + +G  +++ GD +IEYN +F+ YITT LRNP Y PE+   V +LNFMIT QGL +QLL IV A E+P+L+EKK  LIIESA N+  L  +E +ILEVLS+S+GN+LE+E AIN+LSSSK+LS++I EKQ IA  T++EID  R  Y PV+ H +ILFFCIS++AN+DPMYQYSL+WF+NLF+ +I  + KS+ L  R++ LND+FT S+Y N+CRSLFE  KL+ SL MC+ +L  + +V      F LTGG+      PNP   W+ DK W+ + +A++L  +K L +  +  +D+W + YD+ +P+

HSP 2 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 359/666 (53.90%), Postives = 473/666 (71.02%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dhc62B (gene:FBgn0013811 transcript:FBtr0303106)

HSP 1 Score: 2403.63 bits (6228), Expect = 0.000e+0
Identity = 1260/2844 (44.30%), Postives = 1827/2844 (64.24%), Query Frame = 1
            + E+ +    IC  ++ I  +  EIP  TE L+   E++      ++  L +  +  ++    +++   +      L     +W   I+++ D   +       Q E+         +E ++++   I++   K +  +++M R  +F D    LQ  ID  K   D +  +NKEE +     +++P L  +   + P++ L +  +++      W  GPF  L    +E    +  K   K  K +         DNP  +                 ++ + +   I  F   + ++  +CNP +++RHW +MS+I GFD+ P   ++L   L  GL   L++ E I   A KE QL   L  M ++W+   F    Y+++GV ILS+LDDIQ LLDDHI+K+  M+GS F+KP E+E++ W +K++ +N+ +D W KVQA +LYL PIFSS+DI+AQMPEEGR F IV+ T+   M   ++ P  +       +L+ L  +N LLE+I  G+++YLEKKRLYFPRFFFL+NDE+LEILSETKDP RV PHL KCFEGI+ LEF     ++ MIS++ ET+  + ++  A A G VEKWL+ VE+ M+ +V+     S   Y   KR  WVL+WP   V+ +S +YW   V   +    G     + ++  + + +++DIV LVR   +++  RIT+ +L VIDVHA+DV E++ K +VSS   F+WL+Q+RYY    + WV  I+  +P+ NEYLGN+ RLVITPLTDRCYRTL+ A +L+L GAPEGPAGTGKTET KDLAKA+A QC VFNCSDGLDYKAMGKFFKGLA  GAWACFDEFNRIELEVLSVVAQQI  I  A+     +F+FEGTEL+LNP C + ITMNPGYAGR ELPDNLKVLFRSVAMMVPDYA+IGEISLYS GFVDAR LA KIV TYRLCSEQLSSQ+HYDYGMRAVK+VL+A GN++++ PD E E ILLL+++ DVNLPKFLS D+PLFEGIISD+FPG+ LP  D+ +  S  K    +  L+    F+ K++Q YEMI+VRHG M+VGEP  GK++  Q LA  L+ +      +      V  GI+NPK+ITM QLYG FDP+S+EWTDG++A +FR+FA+     RKW++FDGPVDAVWIENMNTVLDDNKKLCL SGE+I MSN+M+++FE  DL QASPATVSRCGMIYMEP+ LGWR F +S+++   P   +E+ +  +  L +WL+ PC  F+R  C + I+  E + ++    LF   + E     ++EE    ED        + +  + Q   LF+ +W +G  L  + R KFDVF ++L    +P  P+P   +++T     P    + D+ F  K  G W+ W +   R  +  +       +I+PT +TAR  + L + + H+K +++VGPTGTGK+V + NYL+ +L K+ +    I F+   SANQ QD++++KL + ++G+YGPP   + V+FVDD+NMP KE YGAQPP+ELLRQ+ D+GH +D KD+SK+++ + L+++A G PGG R DV +R + HFNV  +N F+D++M RIF  +    F    HG D VF    ++ VS+T ++YK   +    TP+KSHY+FNLRD SRV+ G  LV   ++ + +  +R+W HE  RVFYDRL  + DR   FD +       FK  +E +     + G        E    ++FG Y  +D +     Y+E+ S++       T LDDYNS  +  M + +F FA++H++R+CR++      AL++G+GGSGRQS T++A  M     F  EIT+NYG N+W DD+K +L +AG   K   FL ++NQIK E F++DI  LLN G+VPN++P DEK E+LE ++ AA    +   R ID + + ++++F++R KQ LH++L+ SPIGDA R R+R++PSL+NCCTIDW+ +WPE+AL+M+A   L D+ +  E+ + AI+  C+++H +  + +  F     R+ Y T  S++ELI++F+ L+  K++E +  K RY+ GL+ L  A+  +  MQ +L ALQP+L+  +  + K++ ++ ++T+   A  E +  ++E A+V+A  +Q +K DCE DLA+A+P+L DA+A+L+TLK  DITLV+SMKNPP +IKLVM AVC++ G  PER PD ++GKM++DYW  S +LLG+  FL  LK F  D++  + +K++ +++IP  DFDPK+V  AS+A +GLC+WIIA+  YD  AK+VAPKK KLA AEKE   T++ LA+K+A    +E K+  L  +LD+     ++ E++ E C  KL RAE LIGGLGGEKSRW +AA+ L E Y ++ GDVL+S  ++AYL    + +R+  V+ W KK  ++ IPCS  + + D+LG  V I+ W + GLP D FS +N II  NS+R+ L IDPQ QAN W+KNME+ NRL+ +K   +N+++ +  ++++GTPV++ENV EEL   L+PIL +  F Q G+ ++ LG++V+  N +F+ Y+T  LRNPH+LPE   KV ++NF +T   L DQLL IV AKE+P+L+E +  L  E+A NK  L++ E+ IL+ LS+  G+ILENE AI +L+ SK LS++I EKQ  A+ T  +I+  R  YKPVAVH SIL++ I+D+ NIDPMYQ+SLNW+INL++ SIE + KS+DL  RI++L D FT ++Y N+CRS+FE  KLL+S  +   +L G  +V    +  L+T      N  PNP P W+++ +W  ++R  EL  ++G+ +HF+++   W+++YD  SPE

HSP 2 Score: 668.307 bits (1723), Expect = 0.000e+0
Identity = 323/656 (49.24%), Postives = 441/656 (67.23%), Query Frame = 2
              +K+IVL+ +RPD +  AV+ FI +++G  ++ PP FD+  S+ DS   +PL+F+LSPGADP+ +LL F E  G   +   SISLGQGQGPIA  +I  A + G WV LQNCHLA SWM  LE + E +    NT  NFR+WLT+YP+  FPV+ILQNGVKMTNEPP GL+ NL+RSY ++PI+D +F+ GC    R +  +L+G+CFFHA+VQERRK+GPLGWNI Y FNESDL+ISV Q+ M LN Y  +P +A++YLT ECNYGGRVTD+ DRRL++++L  F NA  V   +Y F+    Y  P     +  + Y+  +LP    PEVYGLH N+ IT+D Q T  L   ++L L  +A+G    G S E  I +    I +++P + D+E   ++YPV Y+ESMNTV+ QE+ RF KL   +R+T  +L   IKG++VM  +LE V  +M   ++P  W +KSYP LKPLGSYV DL +RLN+ HDW  +  P TFW+SGF+FTQ+FLTG +QNFARKY IPID + F++++   +  T     P+DG    GL+LEGARW+     L E  PK+L  ++P+I+ +P  LV +   S Y CP+YKT+ R+GTLSTTGHSTN+V+ + L  ++  +HW+ R VA +CQ  D
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: Dhc16F (gene:FBgn0283476 transcript:FBtr0074509)

HSP 1 Score: 1771.9 bits (4588), Expect = 0.000e+0
Identity = 1005/2648 (37.95%), Postives = 1539/2648 (58.12%), Query Frame = 1
            LD +  +++ C++  ++    +     + + +  +A+   ++     L+RT  D+      W+   F+ LN +    D+VE+N    K   QF        +   ++   + FK  LPV+  + NP ++ RHW ++ D++           I+  E+    D +  G     E L +I + A  E QLE  L  ++  WKE +  +  + D+  V IL+  +++Q +LDD  +   T+  S F+ P + ++  W + +       + W+  Q  W+YLE IF+S DI  Q+P E + F  VD ++KE + ++ K    L      D+ K L ++N LL+ I +GL  YLE KR+ FPRF+FLSNDELLEIL++T+ PQ VQPHL+KCF+ I+RLEF  +           +I+  +S EGE L     +   KA+G VE+WL +VE  M  S K+ +    + Y   +R  W  D P Q+V+ VS + W  ++           + +   +  + IKC   +  +  L R N++S  R  L AL  IDVHA+D V  + + +V   + F WL  LR+Y  D    V+    +  +PY  EYLG    LV+TPLTDRCY  LM A +++LGGAP GPAGTGKTET KDLAKA+AKQCVVFNCSDGLDYK MG+FF GLAQ GAW CFDEFNRI++EVLSV+AQQ+ +I+ A A  +KRF+FEG E+ +N +C +FITMNPGYAGR ELPDNLK LFR ++MMVPDYALI E+ LYS GF D + LA K+V  Y+LCS+QLS Q+HYD+GMRAVKSVL  AG L++  P+ + E I L+ A+ D N+PKFL+ D  LF GI+SDLFPGV+LP +      ++++  L ++ LQ     I K LQ+YE + VR G+M+VG P GG                 +  +Q+     V    +NPKA+TM +LYG  D  + EW DG+L +  R     +D+  +W+M DGPVDAVWIEN+NTVLDDNK LCL + E I+++  ++++FE  DL QASPATVSRCGM+Y++P  LGW P ++++ E ++   L     +    LF    D  L   R   K+ + T  IH V+  +      L+  + + +V+ +   E+   ++++          +F ++ +W+I S+L ++ +  F+  +              K+I    + + P   T++++  + +   +W  W++ + +      P+    ++ +PT +T +  Y  DL      PV+V G TG GK+VL  + + RL +   +   +NFSA+TS+N+TQ++I   L++R+K   G P  K  +VF+DD+NMP  + YGA P IELLRQ++D   ++D++      ++D +L  A  PPGGGRN ++ R +RHF +  + + N+ T+ +IF  I+   F   F      L + +V++ ++VY +     LPTP KSHY+FNLRD S+ I+G+L   + +     +++RL+ HE  RVF+DRL   ED+  F  ++K    D F             +  V++++   ++FGD+M      +++IYDEI     L   +  ++ DYNS++    M L++FQ AMEH  R+ R+L+ D G+ LLVG+ G G+QS TR+A+ + ++  + IE+ RNY  N + +DL+ L   AG D +P+ FL  D+QI +E F+EDI+ +LN+G+VPNL+  DE  +I+   ++          RK D  T   +Y +FI RV+ NLH+V++MSP+GDAFR R RMFPSL+NC TIDWF +WP +AL  VA   L  I      R ++     F H++V   S +F   ++R+ Y TP+SYLEL+K ++ LL  K  E+I  + R   GL KL   ++ +  M  EL+ + P+L   SA    L+  + ++T + +A ++ +  ++ +A  KAA +Q I +D   DL  AMP LR+A  +L  L + DI  ++S   PP L++  MEAVCI+LG KP               W S+  ++ D  F+ RL  +  + +    +KK++ KYI   DF P      S   + +  W+I++DK+    K+V PK  +   AE EL+  +  L +K+ +L  VEAK+Q L D L+E Q+  + ++DN++L   +++RA +L   L  E+ RW E  K L+     + GDVL++AA VAYLG F+  +R  +   W  KC E  IP S  F ++ +LG+P ++R WN+ GLP D+ SI+NGI    + RW L IDPQ QAN+WI+NME++N L +IK+TD+  +R LEN+++ G PVLLE + E ++P L PILQ+  +R +G  YL+LGD VI+Y+ +FK Y+TT+L NPHYLPE+   V L+NF++T  GLEDQLL  + A E P +E ++N L+++   +K++L  LED++L++L +S+GNIL++E  +  L+ +K  S  I+ +    E T+  I  +R  Y+ +A  G+IL+F ++ +A IDPMYQYSL +F  +F   +      + +E RI  L      +++ NI R LFENHK++FS  + +++ + + +V +E + FL  G V        PA   MS   W   +

HSP 2 Score: 488.804 bits (1257), Expect = 8.802e-138
Identity = 270/676 (39.94%), Postives = 403/676 (59.62%), Query Frame = 2
            + L+   KL+ +   R  + +  V  ++   +G+ F +      LSS + D++  +PLIFVLS G+DPM+  LKF     +   K  SISLGQGQGP+A  +I+++++ G WV LQNCHLATS+M++LE I   + +     H +FRL+L+S P + FP+S+LQN VK+TNEPPKG++AN+  + L D   D  FF+    N  W  ++FGLC FHA++ ERRKFGPLGWNI YEF+ESD    ++ +  F++     E+P EA+ Y+ G+  +GGRVTD  D R L ++L IF +  I++ + Y +     YY  P   T   Y  Y++  P+  +PE++G+++NA+I    +ET    + +LL  PR A+ EG++ E+ I Q+    I K L      E I     V+ ++    S+  VL QE+ RFN  + ++  +L+NL KAIKGLVVM+ ELE VF ++L  +VP  WA +S+ S+KPL SY++D  +R++F   W EN  P ++WISGF+F QSFLTGVLQ +AR+  +PID +  +F++               +N +D K+      C      V+G+F+E ARWD     L ++    LF+ +P++  KP   + I  +  Y  P+YKT  R G LSTTGHSTNF+L + L ++     WI RG A
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Match: kl-2 (gene:FBgn0001313 transcript:FBtr0346722)

HSP 1 Score: 1679.84 bits (4349), Expect = 0.000e+0
Identity = 1000/2692 (37.15%), Postives = 1536/2692 (57.06%), Query Frame = 1
            R  ++FL  +  +I+DC    E L ++ ++ N  Q +   L  +   +     +W    ++    + W KG F ++N   +E+  + + K    L K+F D     ++       +D F+  LP++  + NP ++ERHW+++ D+I  +     ++  ++ +         E +++I   A  E Q+E ++  +   WK+  FE+  Y D G+  +  ++D   LL++H+++   MK + F++PF   +  WE  L  +++ ++  L VQ  WLYLE IF  +DI  Q+PEE ++F  +   ++ + ++  +  + + AT  R    +L R +  +  LE IQ+ L  YLE KR  FPRF+F+SND+LLEIL  +K P  VQ HLKK F+ +++LE         + +  GM S +GE +  +  IY     G  E+WL QVE  M+  +K+++  +  S   ++  R +W+  WPGQ+V+  + I WT E T ++   ++ +  K        QI  + KL    R +L    R+ +  L  +++H RDV+E M K        FEW SQLR+Y  R  E+ V  Q +TE  YG EY GN+ RLVITPLTDRCY TL +AL L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLDYK++GK F GLAQ+G W CFDEFNRI +EVLSVVAQQI SI  A++      +FEG  + L  T  +FITMNPGYAGR ELPDNLK +FR ++MMVPD  +I E  L+S GF + R LA K+   Y L  +QLS Q+HYD+G+R++ ++L  AG  R+++P+T  E I+ L A+ D+N+ +  + D+PLF GI+SD+FPGV LP  D+  F  A+ +   +  LQ     + K+++++E    RH +MI+G+    K+  ++TL      + +        V    +NPKA+ + +LYG+++  + EW DGVL+ + R     ++  +KWL+FDGPVDAVWIENMN+V+DDNK L L++ E I M  +++L+FE  DL  ASPATVSRCGM+Y +    GW+PF+ S+++  L I   ++    +R  F++++   LDF R  CK+ + T+E++ VV L KL      ++     +     +E +           LW    F+F  VWSI SS+ E  R + D F REL                   + FP + T++D+ F   +   +  W + +   S     ++   +II+PTG+T R  Y +   L  E PV++VG  GTGK+    + +    K+++    +N SA+T+A   Q+ I  + ++R K  + P   KR + F+DD NMPAK+ YG+QPP+EL+RQWID+ +WF++K   K+++ +TLL++AMGPPGGGR  +SSR    F +L +   +  T+IRIF T++    E  +      +   +   T+N+Y   I+  LPTP KSHY+FNLRD S+V +G LL     L N +   +RLWVHE +RVF DRL  + D+  F +             I  ILG H  ++   +        FGD+      Y+++  +  L   M+  L++YN+      M+LV F+ A+EHI R+ RV+ Q  GH L +GIGGSGRQ  T++AAF+ +  +F IE+T+ Y   ++R+DLK L    G   +  +F+FS +QI + SF+E  + +L+TG++ NL+ SDE  E+  +++  A    KK G  +  T  A+Y+YFI  V+  LH+ L  SPIG+ FR+ +R +P+L++  T +WF+ WP++AL  VA+ FL    +        DE  RE++VI            +    H SV ++SE     ++RYNYVT  +YL+L+  FKKLL  KR E+ T  NR   GL K+    ++V  M  ELKA   ++ + + + +  ++ +E    E   ++E + AE            E+     ADL   MP++  A+ +LD L + DI+ V+S   PP  I+ VMEAV I+LG++P               W ++ K+L +  FL+ LKNF  D ++ + +K++   Y   P+ +P  V   S AC+ L +WI+A++ Y    +IVAPK+ KL  A K LE     LA  K +L+E++  +++L  QL+E      EL    E   K+L+RA  L+  L GE+ RW E    L   +  + GD L+S A ++YLG F   +R  ++  W     ++ IP +   K+   L + V IR WNI GLP D  S +NG+IV   +RWPL IDPQ QAN WIKNME+ N+L  +     +++R LE +++ G PVLL+NVGE L+  + PIL+++   Q G   L+  D  I YN  F+FYITT++ NPHY PEIS+K  ++NF +   GLE QLLGI+  KEKP LEE+K+ L++  A NKR L +L+++IL +L+ S+G++L+++   + L  S+  S  + E  +IAEVT+VEID  R  YKP +   SILFF + DM+ IDPMY +SL  +I LF  SIE S +++ +  RI+ +N++ + +VYRN CR LFE HKLLFS+ M   +L    K+ +E + F+L GG+ LD     PNPAP W+S++ W  +    ++    G+ + F+ +   W   Y +  PE

HSP 2 Score: 455.677 bits (1171), Expect = 1.277e-127
Identity = 249/655 (38.02%), Postives = 378/655 (57.71%), Query Frame = 2
            L    K+ VLR +RPD+I   +  FI   LG  ++DPP  DL ++F++S   +PLIFVLSPG DP  +L+   E     A ++ S+SLGQGQ PIA K+I   I+DG WV L NCHL+ SWM +L+K+    +     HK FRLWL+S P  DFP+SILQ  +KMT EPP+G+++N+ R Y N    +    + C++ S++  +LF LCFFH ++ ER+KF  LGWN+ Y FN+SD  +S   + ++LN+Y + P  AL YL    NYGG +TDD DRRLLI+ +  F+    ++  K+  S    Y+ P DG  Q Y++ I+  P    P+ +G H NADI     ET  LF  +L + +   ++   ++ E  + +LA +IL   P+  + E   K   +  +  +  VL QE+ R+NKL+  + + L +L++ I+GLVVM+++LE+++ ++  G+VP  W  K+Y SLKPL ++  DLI R+  F+ W +    P  FW++ + F   F+T VLQ  AR    PIDE+ ++F +   +++   + +R   G  +  LFLEG  W ++N+ L + LP  L   +P+I  KP + +       Y CP Y    R G+         FV+ +DL + N   ++WI RG A L  L
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah3 (dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB-GENE-091112-7])

HSP 1 Score: 3761.84 bits (9754), Expect = 0.000e+0
Identity = 1877/3092 (60.71%), Postives = 2412/3092 (78.01%), Query Frame = 1

HSP 2 Score: 962.985 bits (2488), Expect = 0.000e+0
Identity = 438/660 (66.36%), Postives = 539/660 (81.67%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah7 (dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:ZDB-GENE-070912-282])

HSP 1 Score: 3155.54 bits (8180), Expect = 0.000e+0
Identity = 1606/3111 (51.62%), Postives = 2175/3111 (69.91%), Query Frame = 1

HSP 2 Score: 844.729 bits (2181), Expect = 0.000e+0
Identity = 386/664 (58.13%), Postives = 508/664 (76.51%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 2973.34 bits (7707), Expect = 0.000e+0
Identity = 1564/3152 (49.62%), Postives = 2136/3152 (67.77%), Query Frame = 1
            HI+    K  +  C   F +   I++++  S G P+     +N +  +C  +   L  +W P+   L   K TL   + PK+       + +F+   ++L+S QL+ +V  S+  F                FD L     PL  ++L   + K+ + P+F +L+  ++     I  + + +  ++  L     G        + + KL + ++    QT   N V     GP  +   Y  +Y  L+N  A+ +V   ++E H      K+++ ++ L  E+S L   +   +  LD   L   + K+ + L +++V   V  + + +  IC  ++ I ++  ++P  TE ++ +  ++ +  T  +  L     EA +R+ +L+D      E + LNTT+  WP +I+ +FD +   +   + + + DL  R  K    L+++ + +E+F   E   ++ +++    +  +  ++ D ++ ++ +NKEE++  WE++ +P +  + ++++PY +L+   L +      W+ G F +LN  +IE ++ E  + M+K++K F               G +K                 + S V  ++ +FK ++P++ ++CNPGI+ RHW+QMS+I G D+ P   S+L   L   L  +LE  E I A A+KE  LE+ +  M E W  + F    YRD+GVSILS++D+IQ +LDD I+K+QTM+GSPFIKPFE E+K+WE++L+ + D ID WLKVQ  WLYLEPIFSSEDI+ QMPEEGR F IV+  W+EVMA  VK+P  L AT    + ++L +S +LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE +  +  I  ++A+G VEKWL+QVE++M+ S++ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT EV EAI +  NGLK Y  +  +Q++DIV+LVRG L    R TLGAL  IDVHARDV+  + +  VSS   F+WL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F            +Q  + F+DKI+Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA ++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS++M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S+++  LP  L  +D+  L++ LFEWL+ P L  +R  C+++I +S  + VV L +LF  LL    N          ED   K     N+  W+   F F+ VWS+G       RS+FD F RE+  G     P P ++   +   F E+  +YD+ +E K  G W  W      ES+S +P    + K+ +II+PT +T R TY +DL + + +P+++VGPTGTGKSV +   L+  L KD +L   INFSARTSANQTQ+IIM++LD+RRKGVYGPP  K+C++FVDD+NMPAKE +GAQPP+ELLRQ+ DHG+W+D KDTSK+ L D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D +M+RIF+ IV ++   + F      +G  +VS+T+ VY+KAI + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHE+YRVFYDRL  ++DR   F +        FK N + +  HL    K + +E++R L+FGDYM  D     ++Y E+ S++   + +ET LD+YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FM++  +F  EI+++YG NEWR+DLKRL+  AG   +  VFL +D QIK E+F+ED+  +LNTG+VPN++  DEK EI+E    A R   +   + ++ +P+A++ YF+ R K+NLHIV+A SPIGDAFRNRLR FPSLINCCTIDWFQ WPE+ALE VANKFLE +++ +  R+ +V +CK +H S   LS  FL  L R+NYVTPTSYLELI  F+ LL  +R+ +++ KNRY  GL+KL FA  +V +M+ EL  LQP+L        K++  +E ++VEVEAK +++  ++E A +KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  D+T+V++MKNPP  +KLVM AVC+M   KPER  D S TG+ I DYW  S KLLGD  FL  LK +  D++  Q + K+R +Y+  PDFDP  V  AS+A EGLC+WI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + K +LE  ++LC +KL+RAE+LIGGLGGEK+RW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR+   + W + C    IP S+ F +   LG+P+KIRAWNIAGLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ + L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K +F+Q GVD +RLG++VIEY+ DF+FYITT+LRNPHYLPE++TKVCLLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+EDQILE L SS+GNILE+E+AI +L ++KL+S EI++KQ IAE T++EI ++R GY+ +A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI +S KS++LE R+ YL D+FT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP++ G++E F  + + +  +YDS+ P

HSP 2 Score: 859.366 bits (2219), Expect = 0.000e+0
Identity = 403/656 (61.43%), Postives = 502/656 (76.52%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 2946.38 bits (7637), Expect = 0.000e+0
Identity = 1559/3152 (49.46%), Postives = 2129/3152 (67.54%), Query Frame = 1
            HI+    K  +  C   F +   I++++  S G P+     +N +  +C  +   L  +W P+   L   K TL   + PK+       + +F+   ++L+S QL+ +V  S+  F                FD L     PL  ++L   + K+ + P+F +L+  ++     I  + + +  ++  L     G        + + KL + ++    QT   N V     GP  +   Y  +Y  L+N  A+ +V   ++E H      K ++ ++ L  E+S L   +   +  LD   L   + K+ + L ++++S    +   +   IC  ++ I ++  ++P  TE ++ +  ++ +  T  +  L      ++ ++ +L+D      E + LNTT+  WP +I+ +FD +   +   + + + DL  R  K    L+++ + +E+F   E   ++ +++    +  +  ++ D ++ ++ +NKEE++  WE++ +P +  + ++++PY +L+   L +      W+ G F +LN  +IE ++ E  + M+K++K F               G +K                 + S V  ++ +FK ++P++ ++CNPGI+ RHW+QMS+I G D+ P   S+L   L   L  +LE  E I A A+KE  LE+ +  M E W  + F    YRD+GVSILS++D+IQ +LDD I+K+QTM+GSPFIKPFE E+K+WE++L+ + D ID WLKVQ  WLYLEPIFSSEDI+ QMPEEGR F IV+  W+EVMA  VK+P  L AT    + ++L +S +LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE +  +  I  ++A+G VEKWL+QVE++M+ S++ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT EV EAI +  NGLK Y  +  +Q++DIV+LVRG L    R TLGAL  IDVHARDV+  + +  VSS   F+WL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F            +Q  + F+DKI+Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA ++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS++M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S+++  LP  L  +D+  L++ LFEWL+ P L  +R  C+++I +S  + VV L +LF  LL    N          ED   K     N+  W+   F F+ VWS+G       RS+FD F RE+  G     P P ++   +   F E+  +YD+ +E K  G W  W      ES+S +P    + K+ +II+PT +T R TY +DL + + +P+++VGPTGTGKSV +   L+  L KD +L   INFSARTSANQTQ+IIM++LD+RRKGVYGPP  K+C++FVDD+NMPAKE +GAQPP+ELLRQ+ DHG+W+D KDTSK+ L D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D +M+RIF+ IV ++   + F      +G  +VS+T+ VY+KAI + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHE+YRVFYDRL  ++DR   F +        FK N + +  HL    K + +E++R L+FGDYM  D     ++Y E+ S++   + +ET LD+YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FM++  +F  EI+++YG NEWR+DLKRL+  AG   +  VFL +D QIK E+F+ED+  +LNTG+VPN++  DEK EI+E    A R   +   + ++ +P+A++ YF+ R K+NLHIV+A SPIGDAFRNRLR FPSLINCCTIDWFQ WPE+ALE VANKFLE +++ +  R+ +V +CK +H S   LS  FL  L R+NYVTPTSYLELI  F+ LL  +R+ +++ KNRY  GL+KL FA  +V +M+ EL  LQP+L        K++  +E ++VEVEAK +++  ++E A +KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  D+T+V++MKNPP  +KLVM AVC+M   KPER  D S TG+ I DYW  S KLLGD  FL  LK +  D++  Q + K+R +Y+  PDFDP  V  AS+A EGLC+WI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + K +LE  ++LC +KL+RAE+LIGGLGGEK+RW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR+   + W + C    IP S+ F +   LG+P+KIRAWNIAGLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ + L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K +F+Q GVD +RLG++VIEY+ DF+FYITT+LRNPHYLPE++TKVCLLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+EDQILE L SS+GNILE+E+AI +L ++KL+S EI++KQ IAE T++EI ++R GY+ +A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI +S KS++LE R+ YL D+FT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP++ G++  F         +YDS+ P

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 399/655 (60.92%), Postives = 501/655 (76.49%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Match: CR450723.1 (dynein, axonemal, heavy chain 12 [Source:NCBI gene;Acc:799461])

HSP 1 Score: 2942.91 bits (7628), Expect = 0.000e+0
Identity = 1555/3155 (49.29%), Postives = 2125/3155 (67.35%), Query Frame = 1
            HI+    K  +  C   F +   I++++  S G P+     +N +  +C  +   L  +W P+   L   K TL   + PK+       + +F+   ++L+S QL+ +V  S+  F                FD +     PL  ++L   + K+ + P+F +L+  ++     I  + + +  ++  L     G        + + KL + ++    QT   N V     GP  +   Y  +Y  L+N  A+ +V   ++E H      K ++ ++ L  E+S L   +   +  LD   L   + K+ + L ++++S    +   +   IC  ++ I ++  ++P  TE ++ +  ++ +  T  +  L      ++ ++ +L+D      E + LNTT+  WP +I+ +FD +   +   + + + DL  R  K    L+++ + +E+F   E   ++ +++    +  +  ++ D ++ ++ +NKEE++  WE++ +P +  + ++++PY +L+   L +      W+ G F +LN  +IE ++ E  + M+K++K F               G +K                 + S V  ++ +FK ++P++ ++CNPGI+ RHW+QMS+I G D+ P   S+L   L   L  +LE  E I A A+KE  LE+ +  M E W  + F    YRD+GVSILS++D+IQ +LDD I+K+QTM+GSPFIKPFE E+K+WE++L+ + D ID WLKVQ  WLYLEPIFSSEDI+ QMPEEGR F IV+  W+EVMA  VK+P  L AT    + ++L +S +LLE I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE +  +  I  ++A+G VEKWL+QVE++M+ SV+ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT EV EAI +  NGLK Y  +  +Q++DIV+LVRG L    R TLGAL  IDVHARDV+  + +  VSS   F+WL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F            +Q  + F+DKI+Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G  +E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FREFA ++   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMS++M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S+++  LP  L  +D+  L++ LFEWL+ P L  +R  C+++I +S  + VV L +LF  LL    N          ED   K     N+  W+   F F+ VWS+G       RS+FD F RE+  G     P P ++   +   F E+  +YD+ +E K  G W  W      ES+S +P    + K+ +II+PT +T R TY +DL + + +P+++VGPTGTGKS+ +   L+  L KD +L   INFSARTSANQTQ+IIM++LD+RRKGVYGPP  K+C++FVDD+NMPAKE +GAQPP+ELLRQ+ DHG+W+D KDTSK+ L D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D +M+RIF+ IV ++   + F      +G  +VS+T+ VY+KAI + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHE+YRVFYDRL  ++DR   F +        FK N + +  HL    K + +E++R L+FGDYM  D     ++Y E+ S++   + +ET LD+YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FM++  +F  EI+++YG NEWR+DLKRL+  AG   +  VFL +D QIK E+F+ED+  +LNTG+VPN++  DEK EI+E    A R   +   + ++ +P+A++ YF+ R K+NLHIV+A SPIGDAFRNRLR FPSLINCCTIDWFQ WPE+ALE VANKFLE +++ +  R+ +V +CK +H S   LS  FL  L R+NYVTPTSYLELI  F+ LL  +R+ +++ KNRY  GL+KL FA  +V +M+ EL  LQP+L        K++      ++    VEAK +++  ++E A +KA E+Q +K++CE+DLAEA+P L  A+++LDTLK  D+T+V++MKNPP  +KLVM AVC+M   KPER  D S TG+ I DYW  S KLLGD  FL  LK +  D++  Q + K+R +Y+  PDFDP  V  AS+A EGLC+WI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + K +LE  ++LC +KL+RAE+LIGGLGGEK+RW +AA  L   Y N+TGDVL+SA V+AYLG FT  FR+   + W + C    IP S+ F +   LG+P+KIRAWNIAGLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ + L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K +F+Q GVD +RLG++VIEY+ DF+FYITT+LRNPHYLPE++TKVCLLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+EDQILE L SS+GNILE+E+AI +L ++KL+S EI++KQ IAE T++EI ++R GY+ +A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI +S KS++LE R+ YL D+FT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP++ G++  F         +YDS+ P

HSP 2 Score: 848.195 bits (2190), Expect = 0.000e+0
Identity = 399/655 (60.92%), Postives = 501/655 (76.49%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3984.49 bits (10332), Expect = 0.000e+0
Identity = 1939/3091 (62.73%), Postives = 2459/3091 (79.55%), Query Frame = 1

HSP 2 Score: 1004.59 bits (2596), Expect = 0.000e+0
Identity = 464/660 (70.30%), Postives = 552/660 (83.64%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3939.81 bits (10216), Expect = 0.000e+0
Identity = 1929/3097 (62.29%), Postives = 2444/3097 (78.92%), Query Frame = 1

HSP 2 Score: 1004.2 bits (2595), Expect = 0.000e+0
Identity = 464/660 (70.30%), Postives = 552/660 (83.64%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3454.84 bits (8957), Expect = 0.000e+0
Identity = 1690/2583 (65.43%), Postives = 2080/2583 (80.53%), Query Frame = 1

HSP 2 Score: 994.956 bits (2571), Expect = 0.000e+0
Identity = 461/660 (69.85%), Postives = 548/660 (83.03%), Query Frame = 2

HSP 3 Score: 68.1662 bits (165), Expect = 4.268e-10
Identity = 30/65 (46.15%), Postives = 40/65 (61.54%), Query Frame = 1
            W+P CA LF  ++  W HL+P+    ++  V+ FFA IASLMS QLR MV  SL D   F  +H+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3354.69 bits (8697), Expect = 0.000e+0
Identity = 1660/2584 (64.24%), Postives = 2037/2584 (78.83%), Query Frame = 1

HSP 2 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 450/660 (68.18%), Postives = 531/660 (80.45%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Match: ttc21a (tetratricopeptide repeat domain 21A [Source:Xenbase;Acc:XB-GENE-981816])

HSP 1 Score: 3337.35 bits (8652), Expect = 0.000e+0
Identity = 1654/2583 (64.03%), Postives = 2035/2583 (78.78%), Query Frame = 1

HSP 2 Score: 965.296 bits (2494), Expect = 0.000e+0
Identity = 450/660 (68.18%), Postives = 534/660 (80.91%), Query Frame = 2

HSP 3 Score: 68.1662 bits (165), Expect = 4.268e-10
Identity = 30/65 (46.15%), Postives = 40/65 (61.54%), Query Frame = 1
            W+P CA LF  ++  W HL+P+    ++  V+ FFA IASLMS QLR MV  SL D   F  +H+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3801.91 bits (9858), Expect = 0.000e+0
Identity = 1883/3090 (60.94%), Postives = 2416/3090 (78.19%), Query Frame = 1

HSP 2 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 457/660 (69.24%), Postives = 540/660 (81.82%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah3 (dynein, axonemal, heavy chain 3 [Source:MGI Symbol;Acc:MGI:2683040])

HSP 1 Score: 3746.05 bits (9713), Expect = 0.000e+0
Identity = 1868/3115 (59.97%), Postives = 2400/3115 (77.05%), Query Frame = 1

HSP 2 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 457/660 (69.24%), Postives = 540/660 (81.82%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah7c (dynein, axonemal, heavy chain 7C [Source:MGI Symbol;Acc:MGI:3639762])

HSP 1 Score: 3121.26 bits (8091), Expect = 0.000e+0
Identity = 1625/3112 (52.22%), Postives = 2162/3112 (69.47%), Query Frame = 1

HSP 2 Score: 874.774 bits (2259), Expect = 0.000e+0
Identity = 405/665 (60.90%), Postives = 514/665 (77.29%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah7a (dynein, axonemal, heavy chain 7A [Source:MGI Symbol;Acc:MGI:2685838])

HSP 1 Score: 3111.63 bits (8066), Expect = 0.000e+0
Identity = 1624/3110 (52.22%), Postives = 2156/3110 (69.32%), Query Frame = 1

HSP 2 Score: 870.922 bits (2249), Expect = 0.000e+0
Identity = 400/664 (60.24%), Postives = 509/664 (76.66%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Match: Dnah7b (dynein, axonemal, heavy chain 7B [Source:MGI Symbol;Acc:MGI:2684953])

HSP 1 Score: 3111.63 bits (8066), Expect = 0.000e+0
Identity = 1623/3111 (52.17%), Postives = 2163/3111 (69.53%), Query Frame = 1

HSP 2 Score: 868.996 bits (2244), Expect = 0.000e+0
Identity = 404/665 (60.75%), Postives = 512/665 (76.99%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8TD57|DYH3_HUMAN (Dynein heavy chain 3, axonemal OS=Homo sapiens OX=9606 GN=DNAH3 PE=2 SV=1)

HSP 1 Score: 3760.3 bits (9750), Expect = 0.000e+0
Identity = 1870/3122 (59.90%), Postives = 2406/3122 (77.07%), Query Frame = 1

HSP 2 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 460/660 (69.70%), Postives = 546/660 (82.73%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8BW94|DYH3_MOUSE (Dynein heavy chain 3, axonemal OS=Mus musculus OX=10090 GN=Dnah3 PE=1 SV=2)

HSP 1 Score: 3746.05 bits (9713), Expect = 0.000e+0
Identity = 1868/3115 (59.97%), Postives = 2400/3115 (77.05%), Query Frame = 1

HSP 2 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 457/660 (69.24%), Postives = 540/660 (81.82%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q63170|DYH7_RAT (Dynein heavy chain 7, axonemal OS=Rattus norvegicus OX=10116 GN=Dnah7 PE=2 SV=2)

HSP 1 Score: 3109.32 bits (8060), Expect = 0.000e+0
Identity = 1620/3109 (52.11%), Postives = 2157/3109 (69.38%), Query Frame = 1

HSP 2 Score: 875.93 bits (2262), Expect = 0.000e+0
Identity = 399/647 (61.67%), Postives = 509/647 (78.67%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|Q8WXX0|DYH7_HUMAN (Dynein heavy chain 7, axonemal OS=Homo sapiens OX=9606 GN=DNAH7 PE=1 SV=2)

HSP 1 Score: 3101.23 bits (8039), Expect = 0.000e+0
Identity = 1618/3113 (51.98%), Postives = 2153/3113 (69.16%), Query Frame = 1

HSP 2 Score: 877.085 bits (2265), Expect = 0.000e+0
Identity = 398/647 (61.51%), Postives = 504/647 (77.90%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Match: sp|E9Q8T7|DYH1_MOUSE (Dynein heavy chain 1, axonemal OS=Mus musculus OX=10090 GN=Dnah1 PE=1 SV=1)

HSP 1 Score: 2335.07 bits (6050), Expect = 0.000e+0
Identity = 1292/3075 (42.02%), Postives = 1885/3075 (61.30%), Query Frame = 1
            ++     I  ++   LR +V  SL  FT+FI           +  ++G +     +     PL IV+L +    + Y    +  + +L+  +   + ++  +P++E  +  ++   G  L L +V  +E LV               +  + Y   Y+KY  L NN    ++  FLK         +++        +   +  +   S  ++    +N+D  K+   K R+ L +  ++      ++E++ SIC  +  I+ K+ E P   E L  ++++++      VF      EE + ++M   DY  +      L T  F+       WP  I    D+   +     E+  +   +    F+E+LE +   +  F    E+    E+   V+    ++ Q+ DC+      N  E +     + +  L+ M+K   PY  LW TA D+   +++W+  P   ++A  +E +++E  K MHK +KQF D P  Q+VA  ++ +I++FK ++P++Q + NPG++ RHW+ +S+ I  +++P    +    L   L  H+E + ++   A KE+ +E+ L KM+++W  + F +  Y+++   IL + D+   LLDDHI+ +Q+M  SP+ KPFE+ +  WE KL    ++++ WL  Q  WLYLEPIFSSEDI  Q+P E +++  ++  W+++M  + +N   +     + +L  L D N LL+ +QKGL++YLE KR  FPRF+FLS+DELLEILS+TKDP  VQPHL+KCFE I RL F E LEI  M SAEGE + +   IYP+     VE WLL+VE  M  SV  +I  +I++Y    R  WVL+WPGQ+ I     YWT EV EA+   N       + + Q+ D+V LVRG L+  +R+ L AL VI+VHA+DVV  +    V SV+ FEW+SQLRYY    ++++  ++ E  YG EYLGN+ RLVITPLTDRCY TL  AL L  GGAP GPAGTGKTET KDL KA+A Q VVFNCSD LD+ AMGKFFKGLA AGAWACFDEFNRI++EVLSVVAQQI +IQ A  Q ++RF+FEG E+ L P+C +FITMNPGYAGR ELPDNLK LFR VAMMVPDYA+I EISLYS GF +A  LA KI  T++L SEQLSSQ HYD+GMRAVK+V++AAGNL+++ P T NE ++ L+AI DVN+PKFL +D+ LF GI+SDLFP +   + D+ I   A++ +  K  L+  E F+ K +Q+YE  +VRHGLM+VG    GK+         +       +  G + E  V+Y ++NPK+ITMGQLYG+FD ++HEWTDG+ + + R  A+A D  +KW MFDGPVDAVWIENMNTVLDDNKKLCL SGEII+++  M ++FE  DL  ASPATVSRCGM+Y+EP+ LG  PF+E +++  LP  +     Q  + LF   ++  ++F+R+  K++I ++  +  + L KL          +  +++  +++ S +  +        ++  F+FS VWS+G++   + R  F  + R        L  + + +KL     FPE   +YD+  +     + +             WV  +D  +  ++ PD     II+PT +T + +Y L + LT+ KPV+ +GPTGTGK++ ++N L++     Y+++ + FSARTSANQTQD+I +KLD+RRKGV+GPP  +  + F+DDLNMPA E YGAQPPIELLRQW+DHG W+D+K      +L+D   + AMGPPGGGRN ++ R+ RHFN L   E ++ +  RIF+ I++ W         +     G  N   L + LV +T+NVY    +  LPTPAKSHY FNLRD S+V +G+L+   + + +  +L+RLW HE  RVF DRL  EEDR  +FD +     + F     K+               + +++GD+M+   D K Y+ ITS   + + +E +++DYN I+ A + LV+F  AM HI R+ R L+Q  G+ALL+G+GGSGR S TR+A+ MA++E F IE+++NYG +EWR+D+K++L+KAG    P+ FLFSD QIK ESF+EDI+ +LN+GD+PN+Y +DE+ +I+  M+    I+E+     +  T   +   +  RV+ N+H+VL MSPIG+ FR RLR FPSL+NCCTIDWF  WP +AL+ VA  FL +I   E  E   + ++ +C F H+SV     E+L  L R+NYVTP SYLEL+  F  L+  K+ EL T KNR  +GL+KL   S++V KMQ EL+ ++P L   +  T   + +++ DT   E  R+ + AE+  AN KA ++Q I DD + DL EA+P L  A+ASL  L +ND+T VR+M+ PP  +KLV+EAVCIM G KP++ P    G  ++DYW     LL D  +FL+ L  F  D++    IK + + YI   +F P  +   S AC  +C+W+ A+ KY + AK V PK+  L  A+ +LE+T + L E K  L EVE  +  +  +  E   +K+ELE   E C ++L RA++LI GL  EK RW E  + L     NI GDVL++A  VAYLG FT  +R ++ E W  +     +P +    ++  LG PVKIR+W IAGLP D+ S++NG+I   S RW   IDPQGQANKWIKNME+ + L + KL+D +F+R++EN+I+FG P LLENVGEEL+P LEP+L K  ++QQG   L+LGD VI Y++DF+ YITT+L NPHY PEISTK+ L+NF ++P GLEDQLLG V A+E+P+LEE KN LI+ +A  +++LK++EDQIL  LSSS+GN +++   I VL +SK+ + EI  K  IAE T+ +ID TR  Y PVAV   ILFFC+SD+AN+DPMYQYSL WF+N+FL  I NSE++++L+ RI  +N + T S+Y N+CRSLFE HKL+F+  +C+ ++  + K+N   WR+LL+GG ++   + NPAP W+SD+ W +++  S LP+       F     ++++++DS  P

HSP 2 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 330/653 (50.54%), Postives = 454/653 (69.53%), Query Frame = 2
            L    KL++LRC+R DK+  A+Q F+  +L   FI+P   +L + F +SN  +PLIFVLSPG DP   L KF E+  + + K ++ISLGQGQGP A  M+  +I+ G WV  QNCHLA SWM +LE++ E I  P+  H++FRLWLTS PS  FPVSILQNG KMT EPP+G++ANLL+SY  + +SD+ F   C     + ++L  LC FH    ERRKFGPLG+NIPYEF + DLRI + Q++MFL++Y ++P + L Y  GE NYGGRVTDD DRR ++++L+ FYN  ++  E + +S SGIY+  PP      Y+ YI+SLP+N  PE++GLH+NA+IT    ET  LF+ IL   P+ +S  G+S E+ ++++A++IL ++P   +L+ + K++PV+Y ESMNTVL QE+IR+NKL+ V+  TL ++ KAIKGLVVM+ ELE +  S+    VP  W +K+YPSLKPL S++ DL+ RL+F H WI + +P  FWISGF+F Q+FLTG LQNFARK+ I ID + F+F++   + S++IK RP+ G  ++GLFLEGARWD  N  L ES PK L+  + +IWL P     +     YLCP+YKT  R GTLSTTGHSTN+V+ +++P+N  Q HWI RGVA +C LD
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A267EPJ6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017039g2 PE=4 SV=1)

HSP 1 Score: 4360.06 bits (11307), Expect = 0.000e+0
Identity = 2118/3104 (68.23%), Postives = 2568/3104 (82.73%), Query Frame = 1

HSP 2 Score: 1074.31 bits (2777), Expect = 0.000e+0
Identity = 507/659 (76.93%), Postives = 560/659 (84.98%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A1I8J3L2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 4336.18 bits (11245), Expect = 0.000e+0
Identity = 2116/3127 (67.67%), Postives = 2565/3127 (82.03%), Query Frame = 1

HSP 2 Score: 1074.69 bits (2778), Expect = 0.000e+0
Identity = 507/659 (76.93%), Postives = 560/659 (84.98%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A4S2M5I4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003580 PE=4 SV=1)

HSP 1 Score: 4321.54 bits (11207), Expect = 0.000e+0
Identity = 2122/3138 (67.62%), Postives = 2560/3138 (81.58%), Query Frame = 1

HSP 2 Score: 1012.68 bits (2617), Expect = 0.000e+0
Identity = 480/701 (68.47%), Postives = 550/701 (78.46%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: K1PBH3 (Dynein heavy chain 3, axonemal OS=Crassostrea gigas OX=29159 GN=CGI_10010858 PE=4 SV=1)

HSP 1 Score: 4232.56 bits (10976), Expect = 0.000e+0
Identity = 2070/3093 (66.93%), Postives = 2522/3093 (81.54%), Query Frame = 1

HSP 2 Score: 1034.25 bits (2673), Expect = 0.000e+0
Identity = 491/659 (74.51%), Postives = 559/659 (84.83%), Query Frame = 2

HSP 3 Score: 201.445 bits (511), Expect = 3.470e-47
Identity = 93/143 (65.03%), Postives = 113/143 (79.02%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Match: A0A2C9KDA1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078588 PE=4 SV=1)

HSP 1 Score: 4229.48 bits (10968), Expect = 0.000e+0
Identity = 2055/3095 (66.40%), Postives = 2526/3095 (81.62%), Query Frame = 1

HSP 2 Score: 1013.06 bits (2618), Expect = 0.000e+0
Identity = 486/666 (72.97%), Postives = 557/666 (83.63%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: dnah12 (dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:ZDB-GENE-090311-9])

HSP 1 Score: 3007.24 bits (7795), Expect = 0.000e+0
Identity = 1572/3151 (49.89%), Postives = 2146/3151 (68.11%), Query Frame = 1
            HI+    KI +  C   F +   ++++   S G P+  G  +N +  +C  + + L  +W P+   L   K T+            +E + AF+   ++L+S QL+ +V  S+  F                FD L     PL  + L   E K+ + PSF+++++ ++  +  I  + + +  V+  L              + + KLV         T K+    N   P  +   Y   Y  L+N  A+  V  F++E H      + I+ +Q L  E+S L       +  LD   L   + K+ +   ++L+   +   R+    IC  ++ I  K  + P  TE ++ +  ++  A T  +  L  +  E  +R  +LL   T   ED++LN+ +  WP +I+ +FD+    ++  +++ E++L+ +  K   +LE++ + +E+F   E   ++ M++ V  +  +Q  + + +D +  +NKEE++  W+Q+ +P +  M +N++PY +++   L +      W+ G F +LN  ++E ++ E  + ++K++K F                    PG             +  KV  +I +FK H+P++ ++CNPGI+ RHW+QMS+I+  D+ P   ++L   L   L  ++E  E I AAA+KE  LEK L  M E W  + F    +R+SGVSIL+A+D+IQ +LDD I+K+QTM+GSPFIKPFEKE+K WE++L+ + D ID WLKVQA WLYLEPIFSS+DI+ QMPEEG+ F  VD  W+EVM   VK+P  L AT    +L++L +SN+LLE+I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI +L+F   L+I  M S+EGE + ++  I  ++A+G VEKWL+QVE+VM++S++ VIN S  +Y  TKR +WV +WPGQ+V+C S +YWT+EV EAI +   GLK+Y  +  SQ+ DIV+LVRG L    R TLGAL  IDVHARDVV  M +  VS    F+WL+QLRYY     V VC I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   L+ F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K PD ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F    ++   K  +Q  + F+DK++Q YEM++VRHG M+VGEPF GKT+    LA  LT +   G   E KV Y  +NPK+ITMGQL+GQFDPVSHEWTDG++A  FRE+A A+   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMSN+M+LIFE  DL QASPATVSRCGMIYMEP+QLGW P + S++   LP  L  +++  L+ +LF WLI P L  +R NC++++ T+  + VV L +LF  LL E    P  EE              +NI  W+   F FS VWSIG S     R +FD F RE+  G    +P P ++   +   F ++  +YD+ +E K  G W  W  +I   ++    + K+ +II+PT +T   T F  L +F +  +P++ VGPTGTGKSV +   L+  L K+RYL   INFSARTSANQ+Q+IIM +LD+RRKGV+GPP  K+C++FVDD+NMPA E +GAQPPIELLRQ+ DHG+W+D KDTSK+ L+D  L+SAMGPPGGGRN V+ R +RHFN+  +N F+D+TM RIF+ +V ++  +  F      +G  +V++T+ VYKKA+ + LPTPAKSHY FNLRDFSRV++G LL+   +L N   ++RL+VHEV+RVFYDRL  ++DR   + ++K    + FK + + +  HL    K+ +ED+R L+FGDYMT D     ++Y E+ S+++ ++ +E++L +YN   K  M+LV+F++ +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A FMAD  +F  EI++NYG NEWR+DLK LL KAG   +  VFL +D QIK+E+F+ED+  +LNTG+VPNL+  DEK EI+E M +A R   +   + ++ +P+A++ +F+ R ++NLH+V+A SPIGDAFRNRLR FPSLINCCTI+WFQ WPE+ALE VANKFLE +EM ++ R+ ++++CK +H S   LSE+FL+ L R+NYVTPTSYLELI  F+ LL  KR+ ++  K RY  GL+KL FA  +VG+M+ EL  LQP+L        K++  +E ++V+VEAK +++  E+E A+ KAAE+Q +K++CE+DLAEA+P L  A+++LDTLK +D+T+V+SMKNPP  +KLVM AVC+M   KPE+  D + TG+ I DYW  S KLLGD  FL  LK +  D++    + K+R +Y+  PDFDP  V  AS+A EGLCKWI A++ YD  AK+VAPKK  L +A++ L  T+  L +K+A+L EVE +L  L   L+E  + + +L+  ++LC +KL+RAE+LIGGLGGEK+RW++AA  L   Y N+TGDVL+SA V+AYLG FT  FR +  + W K C    IP S+ F +   LG+P+KIRAWNI+GLP DSFSIDNG+IV+NS RWPL IDPQGQANKW+KN E+ N L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K IF+Q G+D +RLG++VIE++ DF+FYITT+LRNPHYLPE++TKV LLNFMITP+GLEDQLLGIV AKE+PELEE++N LI++SA NK++LKE+ED+ILE L SS+GNILE+E+AI +L S+K++S EIS+KQ IAE T+++I ++R GY+P+A H SILFF I+D+ANIDPMYQYSLNWF+NL++ SI++S KS+ LE R+ YL +HFT ++Y N+CRSLFE  KLLFS  +C  LL  K ++    + FLLTGGV L N  PNP PNW+ DK W E+ RAS+LP ++GLR     HF         +YDS+ P

HSP 2 Score: 823.157 bits (2125), Expect = 0.000e+0
Identity = 387/655 (59.08%), Postives = 491/655 (74.96%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: dnah2 (dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-130530-910])

HSP 1 Score: 1941.39 bits (5028), Expect = 0.000e+0
Identity = 1076/2700 (39.85%), Postives = 1622/2700 (60.07%), Query Frame = 1
            S E+FKKK   TM++      F   +       QI   + QLE L +EE       S+   EQ     +  + K++D   ++W  +  +    D W  G F  L    +E+    M K ++KL ++  D     ++    K +I++FK  +P++  + +P +++RHW+Q+   +   FD   + E +L   +  GL +H E++ EI  AA KE  +E++L  + + W+E   ++  Y+D G   +  AL+D Q+ L        TMK S F++ FEKE+  WE  L  + ++I++ L VQ  W+YLE IF  EDI  Q+P E  +F  ++ +WK +M    K+ + L  T    +L++L++ NS LEEIQK L+ YLE KR  FPRF+FLSND+LLEIL ++++P  VQPHLKKCF+ I  L   +    + E  GM SA+GE    V   +P   +G VE WL  VE  M  ++K  + +   +   +  KR +WV DWPGQ++I  S I WT +VT+ +         + LK    K  S +      +RGNL+   R+ + AL  ++VHARDV++ +AK     VNAF+WL QLR Y+++   +  + Q +T   YG EYLGN+ RLVITPLTDRCY TL +AL L+ GG+P+GPAGTGKTET KDL K +    +V NCSDGLDYK+MG+ + GLAQ GAW CFDEFNRI +EVLSVVAQQI SI  A++ GL  F+FEG ++ L  +C +FITMNPGYAGR ELPDNLK +FR ++M+VPD  LI EI+L+  GF + + LA K+   Y L  +QLS Q HYD+G+RA+ S+L  AG  R+  PD  +E ILL+ ++ D+N+ K  S D+PLF GII DLFP V+ P  D+      +++ L +  LQ   + + K++Q+YE    RH  MIVG+    K+  +Q L  AL+ +   G      V    +NPKA+++G+LYG++D  ++EWTDGVL+ + R     +    KW++FDGPVD +WIE+MN+V+DDNK L L++GE I M  +++L+FE  DL  ASPATVSRCGM+Y + + LGW+P+++S+I+      +  DH+   + LF+  I   + F R +CK+L+  +E++ V+ L +L+ SL        S E      D++      + + LW    F+FS +WSI +S+ E GR K D F RE+ G                  +FP + TIY++  + K+    + W +  D+  +      +A   +I++PT +T R  + ++  +  + PV++ GP GTGK+ +  + L  L   ++    IN S++T++N  Q II +++++R KG Y P   K+ + F+DDLNMPA + +G+QPP+ELLR WID+G W+D++       +D  LL++MGPPGGGR  +S R+   FN++ +    ++ +  IF T+++   +  F      +G +L  +T+ +Y    A FLPTPAK HY+FNLRD S+V +G+L          + + RLW+HE +RVF DRL  + D   F  ++            EK+     L+   +  + +  IFGD++ +  +Y+++   K L   ME+ L+DYN +    PMSLV+F+ A+EH++RV RV+ Q  G+ LLVGIGGSGRQS +R+AA++ ++ +F +E+T+ Y + E+R+D+K+L    G D KP VFLF+D QI  ESF+EDI+ +L++G+VPNLY SDE  E+   + ++AR E       +  T  AM+NY IERV+ NLHIVL MSP+G+ FRNR+R +P+L+NC T+DWF  WP+DAL  VA ++L+ + +   E  +  +  +    H+SV Q S+     L+R+NYVTPT+YLEL+  +KKLL  KR EL    ++   GL K++    +V  M +EL+  + ++     Q ++ L  + Q   E + ++  ++A  E    +  + + + ++ + DL EA+P L +AM +L++L + D+T ++S   PP L++ VM+AV I+ G +P               W  + + LG+  F+ +L +F  D+++ + +KK+ + Y  +PDF P+I+   S A + LC W+ A++ Y    ++V PK+ +L  A  +L      LAE + +  EVE KL+ L +Q DE   +K++L    E    KLDRA +L+ GL GE+ RW +  + L +    + GD L++AA ++Y+G F   +R  ++   W K+  ++ +PCS  F     L +P  +R WNI GLP D+FS +NG+IV   NRWPL +DPQGQA KWIKNME    L +I L   +F+R LEN++QFG+PVLL+NV EEL+P L PIL K+     G   L+LGD  +EYN DF+FYITT+L NPHY PEISTK  ++NF +  QGLE QLLGIV  +E+PELEE+K+ L+I  A  KRKL+ELED+IL +L+ + G++L++   +N L +SK+ + E+S++   +E T+++ID  R  Y+P A   SILFF ++DM  IDPMYQ+SL+ +I+LF +SIE S++S  LE RI  LND+ T +VYR  CR LFE HKLLFS  MC  +L+   K+N + + F L GG+ LD      NP  +W++D  W  +    +L +  GL   F+     W   Y S  PE

HSP 2 Score: 521.161 bits (1341), Expect = 1.773e-147
Identity = 276/656 (42.07%), Postives = 396/656 (60.37%), Query Frame = 2
            L K++++R +R D++   V SFI +NLG  F++PP  D+ +   DS   +PLIFVLSPG DP  AL++  E  G   S   ++SLGQGQ PIA +MI + +++G WV L NCHL+ SWM  L+K+ E++ + E++H +FRLWL+S P  +FP++ILQ G+KMT EPPKG+++N+ R Y    +     F  C+    +  +LF LCFFH+++ ER+KF  LGWNI Y FN+SD  +S   M ++L++Y E+P +AL YL    NYGG VTDD DRRLL + +  ++    V    +  S    YY P DG+   Y EYIR LP   +PEV+G H NADI     ET  LF  +L   P+     A+G G S ED + E++ D+ +K+PE  D E   K      S  +N VL QE+ R+N L+  +R++L  L+K IKGLVVM++ LEE+F  +   +VP  W  K+YPSLKPL S+  DL QR+  F  W E  + P  FW+SGF F   FLT VLQ+ AR++ + +D + +EF +++ D++ ++   P+DG  + GL+LEGA WDK+N  L E+ P  L   +P I  +P +       + Y CP Y    R G         +FV+ +DL +  +S  HWI RG A L  LD+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:HGNC Symbol;Acc:HGNC:2941])

HSP 1 Score: 1565.82 bits (4053), Expect = 0.000e+0
Identity = 969/2687 (36.06%), Postives = 1514/2687 (56.35%), Query Frame = 1
            +G++  C ++L       + L   E + +   + +P L  + + +    +++     +      W +  +  LN   ++       K + KL K     P    VA  ++G++ +FK  LP+L  + N  +++R+                    +    Y L+  L+    IG+           + ++ + W+ MKF +  Y    ++ G  IL ++D+IQ  LDD+ +  Q+M GS FI PF   ++ WE  L  ++++I+VW+ VQ  W+YLE IF   DI +Q+PEE +KF  +D  +K++M+++V++P     CLV     D L+ L+D    LE  QK LNDYL+ KR  FPRFFF+S+DELL IL  + +P  VQ H+ K ++ I  L F   T    + G ++SAEGE + +     P  A+G VE W+  V   M  + + +  ++I  Y   K R  W+LD+ G +V+  + ++WT EV +            +K Y  K + QID++V+ +   L   +R  L  + +IDVHARD+V++  +  ++    FEW SQLR+Y   +  +++V Q S E  YG EY+G   RLVITPLTDR Y TL  AL + LGGAP GPAGTGKTE+ KDLAKA+   CVV NC +G+DY A+GK F GLAQ GAW CFDEFNRI+  VLSV++ QIQ+I+ A+   LKRF FEG E+SL+    +FITMNPGYAGR ELP+++K LFR V ++VPD   I EI L+S GF+ A+ LA K+   Y+L  EQLS Q HYD+G+RA+KSVL  AG L++  PD  NE ++L++A+ D+NLPKF+ +D+PLF G+ISDLFPG+D P+  +  F  AV+  L + K       +DK++Q+YE ++ RH  M+VG   GGK+    TL  A T +     M         +NPKA+++ +LYG  DPV+ +WTDG+L+ +FR+     D + R++++FDG VDA+W+ENMN+V+DDNK L L +GE I++ N   L+FE  DL+ ASPATVSRCGM++++P  L + P+ + ++    P    ++   L R LFE  +   ++ +             K ++  ++++ VVQL  +  +LL+        E+  ++E               L+  F+ +   S+G++LLE+GR KFD   ++L+  ++    K     L      P  L T++DF F+  +   W  W + + +   +  PD K  +I++PT +T R  + L+  +  ++PV++VG +GT K+    N+L  L  D  +   INFS+RT++   Q  +   +++R K  YGPP  K  +VF+DDLNMP  ++YG Q PI LL+  +D G  +D+ K+ +   L D   ++AMG  GGGRN+V SR I  F+V  +    +  +  I+++I+  H    F+     +   L   T+ +YK  I    PTP+K HY+FNLRD SRV  G+ L          + +R+W +E  RVFYDRL  E D+      +K    + F              G  +D  +R  ++FGDY T     + ++Y++I          +  L++YN  +K  M+LV+F  A++H++RV R+++ D GHALLVG+GGSG+QS T++AAF A  ++F I ++R Y ++ +R+DLK L +K G + K  VFLF+D  + +E F+E I+ +L +G VP L+P DEK  +L    N  R E  K G     +  +++ YFI +   NLHIVL MSP+GD  R R R FP L+N   IDWF  WP  AL  VA  FL +  M        VI  +C   H SV + S  F   LRR NYVTP +YL+ I T+  LL  K   ++    R   GL+KLE AS ++  +  +L   +  L   S+  + LL ++  +T   E K+++   + ++   +       K D E+ LAEA+P L  A  +L  L ++D+T +RS   PP  +++V E + +M G K             E  W ++  ++ +  FL  L     DS++   +K +R  ++   +   + ++  S A  G+ K++ AV  Y   A+ + PK+ K+A  EK    + ++L + +++L+ ++ +L  L ++       K+ L++  +L  ++L  A++LI GLG E  RWTE  + L ++   + GD L+SAA ++Y G F   FRN +V E W K  +E  IP S+ F++  +L + V+I  W    LP D  S+ NGI+   ++R+P+CIDPQ QA  WIK  E+ N L I    D +F++ LE +I++G P L ++V E ++P+++ +L+K +   +G   + LGD  ++Y+ +FK Y+ T+L NP Y P +  K  ++N+ +T +GLEDQLL ++   E+ ELEE++  LI E++ NKR LK+LED +L  L++S GN+L+N   ++ L  +K  + E+ EK  +AE T  +IDK R+GY+P A  G+ILFF +++MA ++ MYQYSL  F+ +F  S+  S  +  L  R+  + +  TL+VY   C  LFE HKLLFS  M I + + + +   E   F L G ++L+        +W+ D+ W ++VR +EL P+  G L E  + N  +WK+ +D  SPE

HSP 2 Score: 432.565 bits (1111), Expect = 1.270e-120
Identity = 231/650 (35.54%), Postives = 362/650 (55.69%), Query Frame = 2
            KL++LRC R D++  AV  ++T  +G+ ++ PP     + F  S   SP++F+LSPG +P N L+K  E  G+  +++  +++GQGQ  +A ++++ A+  G W++LQNCHL   W+K LEK  E I  P   H +FRLWLT+ P  DFP+ ILQ  +K+  EPP GL+ N+  +Y    +        C  +  + ++++ L FFHA+VQERRK+G +GWN+PY+FNESD  + +  +  +L          +P  +L YL GE  YGGR  D  DRR+L   +   Y  D +     PF    +    Y  PPDG+ ++Y+E I SLP+   PEV+GLH NA+I    Q    +++ ++   P+   SG G S ++ I ++A DI  KLP  FDL++I K+     S + + VL QEL RFN+L+  +  +L  LQ+A+ G V M++EL+EV  ++  G++P  W   +  +LK LG+++    +R   +  W+E   P+  W+SG +  +S+LT ++Q   R+   P+D       +T + +  ++  +P  G  V GL+LEGA WD E   L  S PK L   +PI+ + P +   +   +T   PVY TS RR  +         V   DL      +HW+ +GV
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: ENSAMXT00000016172.2 (pep primary_assembly:Astyanax_mexicanus-2.0:4:1379218:1548247:-1 gene:ENSAMXG00000015711.2 transcript:ENSAMXT00000016172.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1501.88 bits (3887), Expect = 0.000e+0
Identity = 914/2701 (33.84%), Postives = 1463/2701 (54.17%), Query Frame = 1
            T  +E FK +E       R+N  F          LD    QI + +  + +L +   +       +  L    K +     LW          + W   P+ E+N   +E +    +K +  L K+        +      G     KN L  L+ I    NP I+ RHW Q+    G      E+++L D L   LH   +++  I   A KE  +EK L ++   W  M+F    +  + V +L + +D+   L+D+ ++ Q +  S  +  F +E+  W+ +L   + +I +W +VQ TW +LE IF  SEDI +Q+PE+ ++F  +D  +KE+  ++ K P+ + AT +  +  RL D    L   +K L +YL+ KRL FPRF+F+S+ +LL+ILS   DP +VQ HL K F+   +++F    +       IGM S E E +       P    G VE WL +V + M  +V+  + +++ +Y    R +W+ D+P Q+ +  + I+WT +V  A +       N +K+Y  K  SQ++ ++ ++ G L+ G+R  +  +  IDVHARDVV  +   +V +  AF WLSQLR+   +R    +      +  Y  EYLGNTPRLVITPLTDRCY TL  +L L + GAP GPAGTGKTET KDL +A+     VFNCS+ +DYK+ G  +KGLAQ GAW CFDEFNRI +EVLSVVA Q++SIQ AI    KRF F G E++L P+  +FITMNPGYAGR ELP+NLK LFR  AM+VPD+ LI EI L + GF++AR LA K +  Y+LC E LS Q HYD+G+RA+KSVL  AG+L++  P+   + + L++A+ D N+PK ++ D+P+F G+I DLFP +D+P K D D F   V++++   KLQ  + F+ K++Q+ E++ VRH + +VG    GK+Q  ++L            M+   V +  +NPKA+T  +L+G  +P + EW DG+ + + RE A       KW++ DG +D +WIE++NTV+DDNK L L S E I ++  M L+FE + L  A+PATVSR G++Y+  A LGW P + S+I+ +  I   + ++ +   LF+  +  CLD +R   KK+I   E   V  L  L   LL      P                  + +Y   +  F+F+ +W+ G +L +     + V F +              +   K+  FP + T++D+  + ++   ++ W   + R  M   P+  +   ++ T ET R +YF++  L   +P+++VG  GTGKSVL+   L  L  D+Y   N+ F+  T++   Q ++   L+++    YGPP  KR + F+DD+NMP  + YG   P  L+RQ +D+ HW+D+       +     +S M P  G    ++ R+ RHF+V  ++    + +  I+ +I+  H    GF  V  + G  LV   ++ +++  A+FLPT  K HY+FNLRD S + +G+L      +   + L+++++HE  RV+ D++  ++D    FD ++      F  ++E+ L       KV++      L  G     +  Y  + S ++L K +   LD YN ++ A M+LV+F  AM HI R+ R+L+   G+ALLVG+GGSG+QS TR+AAF++  E+F I + + YG  + + DL  L IKAG      VFL +D Q+  E F+  ++ LL +G++P+LYP DE   I+  ++N  R      G+ +  +    + +FIERV++ L + L  SP+G   R R R FP+++NC  IDWF  WP++ALE V+ +FL+++E ++   ++++     + H SV + S+++L   RRYNY TP S+LE IK ++ LL  KR +L     R   GL+KL   S +V  ++ +L A + +L   +   D+L+  V  +T +V  ++ +   E+E     A      + DCE DLA+A P L  A  +L+TL +N++T ++S  +P   +  V  AV +++        D S        W ++  ++     FLD L NF+ ++++   +K + + Y+ +P+F P++V   S A  GLC W+I + K+      V PK+  L  A  EL    ++L+  KA+++ +   L  LT + ++    K + +   E   + +  A +L+GGL  E  RW EA     ++   + GDVL+  A V+YLG FT  +R+ +++   K     +++ IP +     + +L +   + AW   GLP D  S +N  I+ +  RWPL +DPQ Q  KWIKN    N L +I++    ++ ++E ++  G  VL+EN+ E ++P+L P+L Q+TI + +   Y+++GD   EYN  F+  + T+L NPHY PE+  +  L+NF +T  GLEDQLL  V + E+P+LEE K+ L  +    K  LK LED +L  LSS+ GN L +   +  L  +K  + EI EK   A+VT+ +I++ R  Y+P A   S+L+F ++D+  I PMYQ+SL  F  +F  ++  +   E L+ R+  L D  T SV++   R LFE  KL ++  +   +L    ++N     FLL   V    P      +++S   W  +     +   + L    +++  +WK   + + PE

HSP 2 Score: 405.216 bits (1040), Expect = 2.448e-112
Identity = 232/672 (34.52%), Postives = 371/672 (55.21%), Query Frame = 2
             P  ++    L KL ++R +RPD++  A++ F+ + LG  ++     D   SF +S   +P+ F+LSPG DP+  + K G   GY  +     ++SLGQGQ  +A + +D A ++G WV+LQN HL   W+ +LEK  E+    E + +NFR+++++ PS        P  IL+N +K+TNEPP G+ ANL ++  N    +    + C   + + ++LF LC+FHA+V ERRKFGP GWN  Y FN  DL ISV  +  +L   +++P + L YL GE  YGG +TDD DRRL  + L+ F   +++E E Y  +P   +  P +     Y +YI       +P +YGLH NA+I    Q + +LF  +L   PR A    G G S ++ ++ + ++ L+KLPE F++  +M +  V        V  QE  R N L   ++ +L  L   +KG + M N++E + N++ + +VP+ W  ++YPS+  L  +  DL+ R+     W  + N+P   W++GF+  QSFLT ++Q+ AR+   P+D++  + ++    N  D    P +GA V+GLF+EGARWD +  ++ ++  K L  +IP+I++K    V +D+  T   Y CPVYKT  R  T         +V   +L    + + W   GVA L Q+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Match: dnah5 (dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:ZDB-GENE-110411-177])

HSP 1 Score: 1425.61 bits (3689), Expect = 0.000e+0
Identity = 872/2592 (33.64%), Postives = 1396/2592 (53.86%), Query Frame = 1
            +K  ID F    P+L+++ N  +  RHW +++++ G  F+++ T+   L + +   L K+ E++E+I  +A KE  +E+ L ++  +W    F   +++  G  +L   +  +I   ++D ++   ++  + +  PF+ +++ W   L +  DII+ W+ VQ  W+YLE +F   DI  Q+P+E ++F  +D +W ++M  + + P    SC+       +L  L D    LE  QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  + F ++                                  +V +V+I+  K+V +  I   V+ K     +    Q+ +    + WTK+  EA+T     +  + K        ++ ++ +   +L + ER     L  I VH +D+ +++  L + S + FEWL Q R+Y     DR   + +        Y NE+LG T RLVITPLTDRCY TL  AL +++GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ +KGLAQ+G+W CFDEFNRI+L VLSV AQQI  +     +  K F F +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FR+VAMMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P T+ ES ++++ + D+NL K + +D PLF  +I DLFPG+ L KA +    +A+   +T+  L  H  W + KI+Q++E   VRHG+M +G    GK+                 T+ +   D G       +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+     W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + L W P +E ++     +  +    +++R LF         F   +    ++  E   ++Q   +   L+     QP  +  E   +              ++ L++F+ +WSIG+ L +  R K + + R      ++  Y  P S           + T++D+     + G W  W   ++          + + I++P  +  R  + +       K V+++G  GT K+V+I  YL +   + + A ++NFS+ T+    Q  + + +D+R    YGPP  K+  +F+DD+NMP   ++G Q   E++RQ ++   +F+ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I   H+  + GF+    ++   LV  T  +++      LPTPA  HY+FNLRD SR+ +G+L V    +   + L+ LW HE  RV  DR T  ED + +FD             +E+ LG       VV  +V    F D++ D                 K+Y+ I S  +L  R+  FL  YN SI  A M LV F  AM H+ ++ R+++   G+ALLVG+GGSG+QS TR+A+F+A + IF I +TR+Y      +DLK L   AG   K + F+ +DN+IK ESF+E ++ +L++G+V NL+  DE  EIL  +    + E  +       T   ++ YF+ RV+QNLH+VL  SP           FP+LI+ CT+DWF  WP+DAL  V+  FL   DI+     +  +V     + + V +   ++    RR  +VTP SYL  I+ +K +  +K   L ++K    TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+  A  ++    Q+  +    ++Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP+LI  +M+ V ++   +       +    I   W  S+KL+    FL  L+ F  D++N + ++ L   Y   PD++ +  +       GLC W  A+  +    + V P K  L + E  L I    L + +A+LD  +A+L  +  + ++    K+ L ++ E C  K+  A  LI GL GEK+RWTE +K  + +   + GDVL++ A ++Y G F   FRN ++  W K+     IP   +  + ++L +   +  WN+ GLP D  SI NGIIV  + R+PL IDPQ Q   WI+N E  N L I  L    F   LE+S+  G P+L+E+VGEEL+P L+ +L+K   +      +++GD  ++  K F+ Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG V   EK ELE+ +  L+ +   NKRK+KELED +L  L+S++G+++++E+ I VLS++K  S+E+++K  IA  T+V+I+  R  Y+PVA  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+  S KS     RI  + +H T  V+    R L+E HK LF+L + + +    N++  E +  L+ GG +LD     P P+ W+ D  W  +V  S+L     + +    +  +W+S +D ++PE

HSP 2 Score: 417.542 bits (1072), Expect = 4.358e-116
Identity = 232/661 (35.10%), Postives = 377/661 (57.03%), Query Frame = 2
            Q LD   +L+++R   PD+ +   + +I D++G+ + +    DL  ++ +S+  +P+I +LS G+DP + ++  G+ Q     + A +S+GQGQ   A K++ Q + +G W +LQNCHL   +   L+++ + +   ++ H++FRLW+T+    +FP+++LQ  +K TNEPP+GL+A L R+Y  +N  + D       ++  +W  ML+ + F H+ VQERRK+GPLGW+IPYEFN++D   +V+ +Q  L+D      +    + Y+ GE  YGGRVTDD D+RLL +  +++++  +   E   F     Y+ P   +   Y++YI+ LP    PEV+GLH NADIT  ++    +   IL   P+  +SG G++ E ++  LADD+L+KLP ++    +MKR   M   E MN  LRQE+ R  +++++VRSTL +L+ AI G +VM+  L +  + M   ++P  W   S+ S   LG +  +L++R   F  WI    P+ FW++GF+  Q FLT + Q   R      +D +    E+T +    DI   P++G  VYGL+LEGA WD+ N  L +S PK+LF  +P++ +       +  S  Y CP+YK  AR           N +  +DL  +    +WI RGVA LC +
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001140.1 (pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 gene:ENSPMAG00000001005.1 transcript:ENSPMAT00000001140.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 2528.82 bits (6553), Expect = 0.000e+0
Identity = 1329/2678 (49.63%), Postives = 1795/2678 (67.03%), Query Frame = 1
            + + R +N+ E+      ++   F+ V+ R        L + WL     ++         L+PK +  N   + ++F   A+LM++ L+ +   S+ D+T+ I   + G               P  ++ L +++  I ++P FK+ + +L+  +  ++++   +PRVE  L+ +  M      L+ V+  E   +L +    E +Q     ++ P+ +L  Y+ +  L+  +AE +V  FL E H     ++ +  Y++L   +      V    +F L    L   + KR + L   L+    +E+++  + +C  ++ I  K    P +T+ L+ ++E++++    E+ +L+ +  EA + L+FLLD+A++   +++ N T F W   +  +F      +  + EQ +E L+ R  +FEE LE   K  E+F    +  + ++ + ++    L  +++   + +E  N EE    W  SQ+P    +   L PY RL+  A++F  K+  W++GP  ++N   +E D+    + ++KL +    +P A  +  ++K  ++ F+ HLP+ QV+CNPG++ RHWD +S+++GF +   E+  L  FL   L   L K  +I   A+KE+ LEK L KM  +W EM+F L  YRDSG SILSA+DDIQMLLDDHI+K+QTM+GSPFIKPFE +MK WE KL+ + +I+D WLKVQATWLYLEPIFSS DI+AQMPEEGR+F  VD TW++++ +++ +   L       ML+RL  S  LLE I KGLNDYLEKKRL+FPRFFFLSNDELLEILSETKDP RVQPHLKKCFEGI R+EFTE L+I  M S+EGE + ++  I  +KA+G VEKWLL++E VMI SV  VI +++E+Y  T R  WV  WPGQ V+CVS  +WT EV EAI      L+ YL +CN QID++V LVRG L+   R+TLGAL V+DVHARDV+  + K  ++  + F+WLSQLRYY   G +    I+  LPYG EYLGNTPRLVITPLTDRCYRTL  AL L+LGGAPEGPAGTGKTET KDLAKAVAKQCVVFNCSDGLDY A+GKFFKGL   GAWACFDEFNRI+LEVLSVVAQQI +IQ  I  G    +FEGTEL LNPTC +FITMNPGYAGR ELPDNLK LFR+VAMMVPDYA+I EI LYS GFV AR L+ KIVATYRLCSEQLSSQHHYDYGMRAVKSVLTAAGNL+ K P +ENE IL+L++I DVNLPKFL+ D+PLFEGI SDLFPGV LPK D+ +   A+K+N  K  LQ  ++F +KILQIYEM++VRHG MIVGEPFGGKT AY+ LAAAL DI     M E KV   ++NPKAITMGQLYGQFD +SHEW+DGVLA+ +R FA +    RKWL+FDGPVDAVWIENMNTVLDDNKKLCLMSGEIIQ+++  NLIFEP DLE ASPATVSRCGMIYMEP  LGWRP + S++    P  L+  H  LI  LFE L+  CL F+R + K+L  TS+ + V  L  L    +D+             +++ +K +  +++  W++G+FLFS VWS+G+S    G+  FD   REL  G  PL     K   L++         S  FP   ++Y++ F ++  G W+ W      E++S++P    D   N+II+PT +T R T  +++ +TH+KPV+ VGPTGTGKSV I N+L++ L K+ Y    INFSA+T+A QTQ+IIM KLDRRRKGVYGP   KR V+FVDD+NMPA+E+YGAQPP+ELLRQW+DH +W+D KD S + L +  +L AMGPPGGGRN V++R +RHFN + +NEF+D +M  IF+ I+ WHF     F   F+ L + LV STM VYK A  + LPTP KSHY+FNLRDFSRVI+GV L           + RLWVHEV RVFYDRL  + DR      ++ T     K +  ++  H S   G+V D+D+R L+F D+     D K Y E++ ++ L   +E  L+++N++SK PM+LV+F+FA+EH+ R+ R+LKQ   HALLVG+GGSGRQS TR+AA MAD E+F +EI++ Y  NEWR+DLKR+L ++    +  VFLF+D QIKQESF+EDI+ LLN+G++PNL+  DEK EI EKM+   R  +K   ++ D +P+A+ N F++R +  LH+VLAMSPIGDAFRNRLR FPSL+NCCTIDWFQ+WP DAL+ VA ++LED+E+ E T  + + MCK +H S   LS++F    +RYNYVTPTSYLELI TFK LL  KR E++ +K RY  GLEKLE A+ +V  MQ EL ALQP+L+    Q    +A +E+++ EV     ++ A++  AN +A  ++ IKD+C+ADLAEA+PILR A+A+LDTL Q DIT+V++MK+PP  +KLVMEA+ I+ G KP+R PD S +G+M+ED W  + +LLGD KFL  L +F  D++    +K +R KYI   +FDP  +RNASTA EGLCKW+IA++ YD  AK+VAPKK+KL  AE EL + +  L  K+  L EV+ KL  L   L+  +Q+K +LE+ +++CTKKLDRAEQLIGGLGGE+SRW EAA++L  RY ++TGD L+S+ +VAYLG F  +FR 
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: DNAH6 (dynein axonemal heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:2951])

HSP 1 Score: 1966.04 bits (5092), Expect = 0.000e+0
Identity = 1148/3006 (38.19%), Postives = 1750/3006 (58.22%), Query Frame = 1
            PL + E  +    +++ PS  E +D   ++I  ++  V S +++           P +      +  G+   L T+  ++K +   +    +  +        Y + ++++         L++ A   + H +   ++ +  Y +   +   ++    L + ++D  +L   +     RC + + +LL       +R+   +I     D   K+  +P+ T   V    FL E     +  L+EE +  V+    +  +    P ED+ + +TL      + N  D A        E+  + L   +L+    ++ + +  +D    ++ + +   R +  L E     D+ + Q  Q    +     E + F  L  +   L     +W +  ++ +    WL+  F  L+   + +++ +  KI+++L K    N     V   +K K++  +  LPV+  + NP ++ RHW+ + +IIG  ++  E   +L   +   +  + E+++++   A+ E  LE  L K+++ WK  +F +  +RDS  V IL+  D+IQ+LLDD II   T+  S ++ P +  +  W+ +L+  N  ++ W+  Q  WLYLE IFS+ DI  Q+P E + F  VD +WK++M +  + P+ L A  Q  +L    ++N+LLE+IQK L  YLE KR+ FPRF+FLSNDELLEIL++T++PQ VQPHL+KCF+ I RLEF           T   +I+ M+S EGE +S+   +   KA+G VE WL +VE  M  S++++   +I  Y    R  WV+   P Q+V+ V+ + W +++T+ +    G  D+L    +       +++ +  LVRGNL    R  + AL  +DVHARD+V +M + +V + N FEW  QLRYY D   +  V +++ ++  YG EYLG  PRLVITPLTDRCY  LM AL+L+LGGAP GPAGTGKTET KDLAKA+A QCVVFNCSDGLDYK MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ +I+ A A  + RF+FEG E+ L  TC  FITMNPGYAGR ELPDNLK LFR +AMMVP+YALI E+ LYS GF  +R LA K+   Y+LCSEQLS Q HYD+GMRAVKSVL  AG+L+++ P    E ++L++A+ D NLPKFL+ D  LF GI+SDLFPGV++P  D+    S++++ L  RKLQ     + K++Q+YE +LVRHG+M+VG   GGKT  Y  L+ AL  +   G  +      KV   ++NPK+I+MG+LYG+ + ++ EW DG++A+  R  AVA D +  KW++ DGPVDA+WIEN+NTVLDDNK LCL + E I+++ ++++IFE  DL+ ASPATVSRCGM+Y++  +L W P++++++   +     ED  Q I  LFE  ++  L F+   C + +   +I  V  L  L  SLL   +  P ++     E S +  I  Q         F+F ++W++G +L+E+   +FD F +         + +    KL  S      L  Y   ++ K    W+  V      +   + +    E+++PT +T R  Y ++  L  +  V+  G TG GKSV+    L ++ ++ +Y+   INFSA+TS+ +TQ+II +KL+++RK + G P +KR ++FVDDLNMP  ++YG+QPPIELLRQ+ D G ++D++      + D       +     PPGGGRN V+ R IRHF++L +   +++++ +IF  I+   F   F     ++   +V + + +Y +     LPTPAKSHY+FNLRD S+ ++G+L      + +  ++ RL+ HE  RVF+DRL   ED+  F  ++    +  F   +E    + H              ++FGD+M       D++Y+++T ++ L   ++ +LDDYN  S   M LV FQ A+EH++R+ R+++Q+ G+ALLVG+GG+G+QS TR+A  M  +  F IE++R Y  + + +DL++L   AG + K  VFLF+D QI  E F+EDI+ +LN+G+VPNL+  DE    LEK+  A R + K+ G   +     +  +FI RV+  LHIVL MSP+GDAFR R RMFPS++NCCTIDWF  WP +AL  V+  F   +++  +  +E +  MC   H SV +L+E +   LRR  Y TPTSYLELI  +  +L  KR++L   ++R   GL KL   ++ V K+Q+EL AL+P L   S   + L+ K+  D    +  R ++  ++  A VKA E+Q +  D + DL EA+P L+ A  +LD+L ++DI+ VR   NPP  ++ VMEA+CI+L +KP+              W S+ +LLGD  FL RL ++  ++++   I+KL+  YI   DF P+ V   S AC+ +C W+ A+D Y    K V PK+ +LA A+ EL+ T+  L +K+ +L +VE ++  L DQ D +   K+ L  N+ L   ++ RA +L   LG E+ RW E+         N+ G+V +++A VAY G FT  +R  +++ W  +C E+ IP + +F ++ ILG+P +IR WN  GLP D+ S +NGI+V    RWPL IDPQ QAN+WI+N E  N L IIKLTD NF+RTLEN+I+ G PVLLE + E L+P LEPIL K  F   G   +RLGD+ ++Y+K+F+FY+TT++ NPHYLPE+  KV ++NF +T  GLEDQLL  V   EKPELEE++N LI+    +K +LK +ED+IL++L +S+GNIL+NE  I  L  SK+ S  I  +   AE T+  I+  R  Y+PVA  GS+++F I+ ++ IDPMYQYSL +F  LF M+IE SEK  DL  R+E L     L+ Y NI R LFE HKL+FS  +CI +L+    V+D  W   L G   +D   P  P   W+++  W+      + LP  KGL+

HSP 2 Score: 602.823 bits (1553), Expect = 4.921e-173
Identity = 305/678 (44.99%), Postives = 443/678 (65.34%), Query Frame = 2
            L    KL++++    +K+V A+  F+ +NLG+ FI+ PP DL + + D +  +PL+FVLS G+DPM A  +F  + GY + ++ +ISLGQGQGPIA K+I++A++ G WV LQNCHLA SWM ++E+I + +  P    H N+RL+L+S P+ +FPV++LQN VK+TNEPPKGLRAN+ R++     +   FF+       W  ++FG+CFFHA++QER+KFGPLGWNI YEFN+SD   ++  + +F  D   +P +AL Y+TGE  YGGRVTD  D+R L ++L+ F++   +E   Y +S SGIYY+  + T Q + +YI +LP+N +PE++G+HENA++    QET  L   IL   PR +  G G S ++ ++ELAD IL KLPE  D+E  M+    R       S+ TVL QE+ RFN L+ V+RS+L  L+KAI G VVM+ E+E+++NS L  +VP  W+  +YPSLKPLG +V DL  R  F   WI+   P +FWISGF+F Q FLTG LQN ARKY +PIDE+GF ++        TS   +            DI++   +DG  V+GLF++ +RWD E+ ++ ++L   +   +P++  +P +    D  S Y  P+YKTSAR GTLSTTGHSTNFV+ + +P+    ++WI++G A LCQL+D
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003955.1 (pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003955.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1796.56 bits (4652), Expect = 0.000e+0
Identity = 977/2106 (46.39%), Postives = 1347/2106 (63.96%), Query Frame = 1
            P++   F N +  +  +    L  SW PR   LF DK            +  ++  ++F   +++L+S QLR+++  ++  +                FD       P   V+L   +  +   PS ++L+  ++     I +S + +P V   L      + + ++T    E ++T      +   + N  GP+ +L  Y  +YG L+N  A   V  F+ E          ++ ++ L  E+  L   +   +  L    L   +  +      LL+   + ++R  N  IC+ ++ +  +  ++P ++E ++ +  ++  A +  +  L ++ +E   R+ FLLD   +  EDI  N+ +  WP  I+  FD     ++  + + E +L  R  +    L+++++ ++ F   E   ++ + + V  +  +  ++ D  D +  +NKEE +  WE + +P +  +   LDP+ +L+   L +      W+ G F ELN  T+  ++ E  + M+K +K F      QK A +        K + D  +  +   Q   +P +Q   +RHW QMS+++  DI P   ++L   L   L  +L+K E+I AAA+KE+ LEK L  M E W  + F   +YR++GVSILS++D+IQ  LDD I+K+QTM+GS FIKPFE E+K+WE++LV + + +D WLKVQA WLYLEPIFSS+DI+ QMPEEGR F  VD  W+EVM    ++P  LVAT    +L++L + N LL++I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI RL F   L+I  M S+EGE + +V ++  ++A+G VEKWLLQVE+VM+ SV+ VI  +  +Y  T+R  WV +WPGQ+VICVS ++WT EV EAI      GL++Y  +   Q+ DIV+LVRG+L+   R+TLGAL  IDVHARDVV +M    VS+   F+WL+QLRYY    +V V  ++  + Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AM KFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   +  F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F  A ++  ++  +Q  + F+DK++Q YEM++VRHG M+VGEPF GKT+  Q LA  LT ++  G   E +V    +NPKAITMGQL+GQFDPVSHEWTDG++A  FREFA +    RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQMS  M+LIFE  DL QASPATVSRCGMIYMEP+QLGW+P ++S++    P    ED+  L+++LF WL+ P L  +R  CK L           + KL+ +   ++      +E  +        + A +IY  LQ  F FS VWS+G+S    GR KFD F REL  G +  +P P ++   +     ER  +YD+ +E K  G+W  W   I    +      K+ +II+PT +TAR TY +DL + H +P++ VGPTGTGKSV I N L+  L K+RYL   +NFSA+TSANQTQ+IIM+KLD+RRKGV+GPP  KR V+FVDD+NMPA EK+GAQPPIELLRQ+ DHG+W+D KDTSK+ L D  LL+AMGPPGGGRN V++R +RHFN+  +N F+D TM+ IF++++ ++  +  F   F  +G  +VS+T+ VYKKA+ + LPTP KSHY FNLRDFSRVI+GVLL+          ++RL+VHEVYRVF+DRL  ++DR   + + +    D FK + + +   L   G+ +  ED+R L+FGDYM  D     ++Y E+ S++  +  +E  L++YN   K  M+LV+F + +EH+SR+ RVLKQ  GHALLVG+GGSGRQS TR+A  M+   +F  EI+++YG  EWR+D+K
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003959.1 (pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 gene:ENSPMAG00000003592.1 transcript:ENSPMAT00000003959.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1784.23 bits (4620), Expect = 0.000e+0
Identity = 973/2119 (45.92%), Postives = 1348/2119 (63.61%), Query Frame = 1
            P++   F N +  +  +    L  SW PR   LF DK            +  ++  ++F   +++L+S QLR+++  ++  +                FD       P   V+L   +  +   PS ++L+  ++     I +S + +P V   L      + + ++T    E ++T      +   + N  GP+ +L  Y  +YG L+N  A   V  F+ E          ++ ++ L  E+  L   +   +  L    L   +  +      LL+   + ++R  N  IC+ ++ +  +  ++P ++E ++ +  ++  A +  +  L ++ +E   R+ FLLD   +  EDI  N+ +  WP  I+  FD     ++  + + E +L  R  +    L+++++ ++ F   E   ++ + + V  +  +  ++ D  D +  +NKEE +  WE + +P +  +   LDP+ +L+   L +      W+ G F ELN  T+  ++ E  + M+K +K F             D P  ++  S      +  +   P +Q +C+  I++RHW QMS+++  DI P   ++L   L   L  +L+K E+I AAA+KE+ LEK L  M E W  + F   +YR++GVSILS++D+IQ  LDD I+K+QTM+GS FIKPFE E+K+WE++LV + + +D WLKVQA WLYLEPIFSS+DI+ QMPEEGR F  VD  W+EVM    ++P  LVAT    +L++L + N LL++I KGLN YLEKKRL+FPRFFFLSNDE+LEILSETKDP RVQPHLKKCFEGI RL F   L+I  M S+EGE + +V ++  ++A+G VEKWLLQVE+VM+ SV+ VI  +  +Y  T+R  WV +WPGQ+VICVS ++WT EV EAI      GL++Y  +   Q+ DIV+LVRG+L+   R+TLGAL  IDVHARDVV +M    VS+   F+WL+QLRYY    +V V  ++  + Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AM KFFKGLA +GAWACFDEFNRIELEVLSVVAQQI  IQ AI   +  F FEGTEL LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L+ KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPG+ LP AD+ +F  A ++  ++  +Q  + F+DK++Q YEM++VRHG M+VGEPF GKT+  Q LA  LT ++  G   E +V    +NPKAITMGQL+GQFDPVSHEWTDG++A  FREFA +    RKW++FDGP+D +WIE+MNTVLDD  +LCLMSGEIIQMS  M+LIFE  DL QASPATVSRCGMIYMEP+QLGW+P ++S++    P    ED+  L+++LF WL+ P L  +R  CK + E       ++L + F   L                D  +  +  + +++ ++ L           F FS VWS+G+S    GR KFD F REL  G +  +P P ++   +     ER  +YD+ +E K  G+W  W   I    +      K+ +II+PT +TAR TY +DL + H +P++ VGPTGTGKSV I N L+  L K+RYL   +NFSA+TSANQTQ+IIM+KLD+RRKGV+GPP  KR V+FVDD+NMPA EK+GAQPPIELLRQ+ DHG+W+D KDTSK+ L D  LL+AMGPPGGGRN V++R +RHFN+  +N F+D TM+ IF++++ ++  +  F   F  +G  +VS+T+ VYKKA+ + LPTP KSHY FNLRDFSRVI+GVLL+          ++RL+VHEVYRVF+DRL  ++DR   + + +    D FK + + +   L   G+ +  ED+R L+FGDYM  D     ++Y E+ S++  +  +E  L++YN   K  M+LV+F + +EH+SR+ RVLKQ  GHALLVG+GGSGRQS TR+A  M+   +F  EI+++YG  EWR+D+K
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004701.1 (pep scaffold:Pmarinus_7.0:GL479445:9390:42654:-1 gene:ENSPMAG00000004281.1 transcript:ENSPMAT00000004701.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1451.8 bits (3757), Expect = 0.000e+0
Identity = 700/1097 (63.81%), Postives = 868/1097 (79.12%), Query Frame = 1
BLAST of Dynein heavy chain, axonemal vs. Ensembl Yeast
Match: DYN1 (Cytoplasmic heavy chain dynein; microtubule motor protein; member of the AAA+ protein family, required for anaphase spindle elongation; involved in spindle assembly, chromosome movement, and spindle orientation during cell division, targeted to microtubule tips by Pac1p; motility along microtubules inhibited by She1p [Source:SGD;Acc:S000001762])

HSP 1 Score: 695.656 bits (1794), Expect = 0.000e+0
Identity = 659/2612 (25.23%), Postives = 1210/2612 (46.32%), Query Frame = 1
            L  +++ +  Y  +WR+  +         + P+  ++ L +++D+    +   +L   +KQF       ++   +  +++   +   +L  + +  ++ RHW+ +   IG      ++    E SL D +   L  +   L +I   A KE  +EK+L ++K+ WKE ++E+ E+  SG+ ++   D ++    + + +  +MK S + K FE++    E KL  +++I   W++VQ  WL L  I     DI   +P E  KF  +   +K +   + +  + +  +     D   +LT DS   L+ I+  L+ +LE++R  FPRF+FL ND+LL+I+   K   +V   +KK F  I  + F E   I G+ S EGE L++  KI   K     ++WL  ++  +  SV     D +      K G      V  +  Q ++  + + WT E+ E     N    Y  + + +I  ++ KL + +    ++I   AL V  +H  +V+  +            W    ++Y +         V++ Q    L Y  EY+G   RL+ TPL    + TL  +L    GG   GPAGTGKTET K   + + +  VVFNC D  DY+ + +   G+ Q GAW CFDEFNR++ +VLS V+  IQ IQ  +  G         E  L+P   +FIT+NPGY GR ELP+NLK  FR  +M  P    I E+ L  MGF D+++LASKIV    L S + SS +HY +G+R +K VL     L  +  + E     +++++  V LP     D  +F+  +S +F     P  +       +KD   +     +E F+ K +Q Y M   +  L++VG+   GKT  ++T+  A+        +        +I+ K +T   LYG     + EW DG+   + R    +      + R W++FD  +D  ++E MN+VLDDNK L L +GE + +     ++FE  +L+  +PAT++RCG+++               I  ++   LN+ +  L   L  + +D   D I          S+  D+  L  +F    D   I    +  + ET     V +IS+     W Q L   S        I  SLL       +G S+     R     IN  Y    S +L+  ++     ++L+   FC E          + ++  E+  +  PD     I+IPT +T + +  F DL L  ++ +I+ GP G+GK++++NN L       Y    INFS  T    T + I++ L R        KG+   P    K  V+F D++N+P  +KYG+Q  +  LRQ ++  G W  K   +K   I+ + ++ A  PP   GR  +S R  RH  +L +   +  ++ +I+    + +++  F  V  F    +    +++++Y +  A +  T  +SHY+F+ R+ +R+++GV    +T +  G +     L+RLW +E +R+F DRL   +++  F  ++   T D +  N +  LG++S +  +    +          D K  ++   +  + +R +TF D+     +  + +V+ +  ++HI R+ R LKQ  GH +L+G   +G+   TR  A++   +I   +I R+   +++   LK+ +            +  ++ I + +F+E ++ LL   D+P+L+  +E  ++L  ++N  R      G  +D T   +Y++F+  + +NLH+V  +    +   + +   P+L N C I+W   W    +  VAN  ++ I M+       E  +E +      + E ++ + +  +N L  +            N  +P  +++ ++   KL+  K  +L   +     GLEKL  +  +V ++   L     EL     +    L K+  +  E E K+E     ++   V+  + ++ K+     + +  P + +A   +  +K+  +T +RSM NPP  +K+VMEAVC +LG +                W    + +    F+  + ++     + PQ  K + E+++ +P+F  + +  AS AC  L +W+ A   +    + V P + ++   E E   T   L   +    ++EA ++    +     +  + ++  +      LDR+  L+  L  EK RW    K  S+    + G+ ++S+    Y G      R  ++    +   +  +    +++ +D L    +   W   GL  + + ++N  I++N+ +  P  +DP       I N    N+  ++   +  FV+ LEN+I+FG+ V++++ GE  +PI+  ++ +          + +GD+ ++ + DFK +I +   +      + ++V L++F+   + +E ++  I   +E  E++ K+  LI  + + K KLK LE ++LE L++SQGN+LEN+  +  L++ K  +  I +K + +E    + D     Y  +  H   +F  +         Y  S+  F++ F  + I+ S ++    TR++ +       VY     +L +  K++ ++TM

HSP 2 Score: 68.1662 bits (165), Expect = 2.968e-11
Identity = 53/205 (25.85%), Postives = 96/205 (46.83%), Query Frame = 2
            A + I ++  +G W++LQN  ++ SW+K+ L K  EE    E  H+ F++++T + + D  P  +LQ   +   E   G+          D + D   ++FF G           F L +FHAL+  R +  P G++  Y FN+ D + +   ++  L  N    +P   +        YGG++ ++KD  ++  L   +F  +D
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO34727 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNG1])

HSP 1 Score: 3867.39 bits (10028), Expect = 0.000e+0
Identity = 1933/3121 (61.94%), Postives = 2411/3121 (77.25%), Query Frame = 1

HSP 2 Score: 906.36 bits (2341), Expect = 0.000e+0
Identity = 432/660 (65.45%), Postives = 514/660 (77.88%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO45806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRR2])

HSP 1 Score: 3081.58 bits (7988), Expect = 0.000e+0
Identity = 1606/3116 (51.54%), Postives = 2148/3116 (68.93%), Query Frame = 1

HSP 2 Score: 837.795 bits (2163), Expect = 0.000e+0
Identity = 392/649 (60.40%), Postives = 506/649 (77.97%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO37961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE81])

HSP 1 Score: 2196.78 bits (5691), Expect = 0.000e+0
Identity = 1135/2097 (54.12%), Postives = 1476/2097 (70.39%), Query Frame = 1

HSP 2 Score: 564.688 bits (1454), Expect = 6.351e-163
Identity = 264/423 (62.41%), Postives = 328/423 (77.54%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO34077 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQG6])

HSP 1 Score: 1978.37 bits (5124), Expect = 0.000e+0
Identity = 1076/2711 (39.69%), Postives = 1647/2711 (60.75%), Query Frame = 1
            + KS E FK   + + EE ++ V  L D+ Q                       Q+ + K Q   L +  ++   EQ+    L  + K+L+   ++W    ++    DTW  G F EL    +E     + K ++K+I++  D     ++   +K +I++FK  +P++Q + N  +++RHW Q+   +      T ++ +L   +  GL +  E++ EI  AA+KE  +E+ ++ +   W ++  ++  Y+D G   L   D++   L+D+ +   TMK S ++K FE E+  WE  L  + +++++ L VQ  W+YLE IF  EDI  Q+P E  +F  V+  WK +M    K+P+ L  T    +L+ L D N+ LEEIQK L+ YLE KR  FPRF+FLSND+LLEIL ++K+P+ VQPHLKKCF+ I  L+        ++ E +GM SAEGE +     +     +G VE WL  VE  M  ++K+++          ++KR +WV +WPGQ+ I  S + WT +  +A++      D     +      S ++   +++RG+L   +R+ + AL  I+VH RDV+E + K   + V AFEWLSQLR Y+D+   +  V Q +T+  YG EYLGN+ RLVITPLTDRCY TL +AL L+ GG+P+GPAGTGKTET KDL KA+    +V NCS+GLD+K+MG+ + GLAQ GAW CFDEFNRI +EVLSVVAQQI SI  A++ G  RFVFEG E++L  +C +FITMNPGYAGR ELPDNLK +FR ++M VPD  +I EI L++ GF + + LA K+   Y L  +QLS Q HYD+G+RA+ SVL  AG  ++  PD  +E ILLL ++ D+N+ K  +QD PLF GI+SDLFPG++ P  D+    +A+   L     Q     I KI+Q+YE    RH  ++VG+   GK+  ++ L +A+T +  DG      V    INPKA+++G+LYG+FD  ++EWTDGVL+ + R+    +    KW++FD PVD +WIE+MN+V+DDNK L L++GE I M + ++L+FE  DL  ASPATVSRCGM+Y +   LGW+P+++S+++  +    ++  ++ ++ LFE  +   L+F +H+CK+ + TSE++ VV L  LF +L                E++ V++ + ++    L+  FLF  +WS+ +S+ E  R K D F REL G                   FP + T+Y++  + K    W  W + + R     +P     +I+IPT +T R  + +   +  ++PV++ GP GTGK+ +    L +L    Y    IN SA+TS+N  Q+II +K+++R KGVY P   K+ + F+DD NMPAK+ +G+QPP+EL+R WID+G W+D+   +  ++ D  LL++MGPPGGGR  +S R+   FN++ +    ++ + RIF T+++   +  F+     LG ++  +T+ +Y   +A  LPTP + HY+FNLRD S++ +G+L            + RLWVHE +RVF DRL    DR  F  ++            +K+     L+   +  + +  IFG++M DD +Y+++   K + + ME  ++DYN       ++LV+F+ A+EH++R+ RV+ Q  G+ LLVGIGGSGRQS TR+A+++ ++++F IE+T++Y + E+RDDLKRL  +AG D KP VFLF+D Q  +E F+ED++ +L++G+VPNLY  DE  E+   + + A  E+      +  TP +M+++FIERV+ NLHIVL MSP+GD FRNR+RM+P+ +NC TIDWF  WP DAL  VA ++LE+IE+ DE T+  +  +    H SV  +S   L  L+R+NYVTPT+YLEL+  ++ LL  K+ EL    ++   GL+K++    +V  M +EL+    ++     Q ++ L  + Q   E + +++++ A  E   ++  + + + ++ + DL EA+P L++AM +L++L + D+T ++S   PP L++ VMEAV I+   +P               W  + + LGD  F+ +L N+  D++  + +KK+   Y  +PDF P+I+   S A + LC W+ A++ Y    ++V PKK +L  A  +LE     LAE KA+L EV  ++++L  Q DE   +K+EL    EL   KLDRA +L+ GL GE+ RW  +  +L E    + GD L++AA ++Y G F   +R+ +V + W  +  ++ + C+ +F     L +P  +R WNI GLP D+FS +NG++V   NRWPL IDPQGQA KWIKNME  + L II L  ++++RTLEN++QFG+PVLL+NV EEL+P L PIL K++ +  G   ++LGD  +EY+ DF+FYITT+L NPHY PEISTK  ++NF +  QGLE QLLGIV  +E+PELEE+K+ L+I  A  K+KL+ELED+IL +L ++QG++L++E  +N L+SSK  SQE++E+ T++E T+++ID  R GY+P A   SILFF ++DM  IDPMYQ+SL+ +I+LF  SIE S++S +L+ RI+ LN++ T +VY+  CR LFE HKLLFS  MC  +L+   K+N + + F L GGV LD      NP   W++D  W  +    +LP+  G+   F+     W   Y S  PE

HSP 2 Score: 311.612 bits (797), Expect = 2.084e-84
Identity = 150/330 (45.45%), Postives = 215/330 (65.15%), Query Frame = 2
            L +++V+R +RPD++     SFI +NLG  F++PP  D+ S  +DS+  +PLIFVLSPG DP +ALL+  E+ G  +++  ++SLGQGQ PIA +MI + ++DG WV L NCHL+ SWM  L+K+ E++ + E+ H +FRLWL+S P  +FP+SILQ G+KMT EPPKGL+AN+ R Y    +   + F  C+   ++  +LFGLCFFH+++ ERRKF  LGWNI Y FN+SD  +S   + ++L++Y E P +AL YL    NYGG VTDD DRRLL S +   +N   ++   Y  S    YY P DG    Y      + YI++ P+
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Match: EDO31800 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWW2])

HSP 1 Score: 1947.94 bits (5045), Expect = 0.000e+0
Identity = 1131/2903 (38.96%), Postives = 1672/2903 (57.60%), Query Frame = 1
            Y N ++ Y         L++ A  +  H +      ++ Y    ++   +    P+ + + D R+L   +     K  E++     +  ++    + +   D   ++  +P+ T   V    FL E    E     E     ++ L  L+D   +P   ED+ +  TL      + NV D +     +  ++    +   +++  + ++E+ +  +D K  +  +  E    + +L ELQG++D   D        +     E ++F  L  +   L     LW + +++      W +  F ELN  T+ N++++  K + +L K    N     V   +K K++  ++ LPV+  + NP +++RHWDQ+  I  +  K  E  +L         +H E +EE+   A+ E  LE  L K+++ WK  +F +  +RDS  V IL  +DDIQ +LDD +I   T+ GS  + P    ++ W+ +L   ++ +D W+  Q  WLYLE IFS+ DI  Q+P E + F  VD +WKE+M +  + P+ L A  Q  +L+   ++N+LL++IQK L  YLE K + FPRF+FLSNDELLEILS+T++P  VQPHL+KCF+ I +LEF   ++                         I+GMIS EGE +S+  V+  +  +   +   WL  + N  +N  KK+   S   Y+   R       P  I+   + I   +    +  I  P  L           +++  LVRG L    R  LGAL  IDVHARD+V  M   +V S N FEW+ QLRYY D   +  V ++S  +  YG EYLG + RLVITPLTDRCY  LM AL+L+LGGAP GPAGTGKTET KDLAKA+AKQCVVFNCS+GLD+K MG+FF GLAQ+GAW CFDEFNRI++EVLSV+AQQ+ +I+ A      RF+FEG E+ L P+C  FITMNPGYAGR ELPDNLK LFR +AMMVP+YALI E+ LYS GF  ++ LA K+   YRLCSEQLS Q HYD+GMRAVKSVL  AG L++  PD E E ++L++A+ D NLPKFL+ D  LF  I++DLFPG ++P  D+    S ++D +  + LQ     + K++Q+YE ++VRHG+M+VG    GKT  Y  L   LT +        Y   V   I+NPK++TMG+LYG+ + ++ EW DG++A+  R+         KW++ DGPVDA+WIENMNTVLDDNK LCL + E I+++N ++++FE  DL  ASPATVSRCGM+YM+P +LGWRPF+ S+++      + E+  + + +LF+  +D  L F    C + ++  +I  V  +  LF S     +  P               +    ++  +   FLF F+WSIG +L+E+    FD F R+L       +     +++  S      L  Y   F+ +    W++ +      +   S +    ++++PT +T R  + +D  L+  K V+  G TG GKSV+    L  +  K  Y+A  +NFSA+TS+ +TQ++I TKL+++RK + G P  KR V+FVDDLNMP  + YG+QPPIELLRQ+ D   ++D++      + D  + SA  PPGGGRN V+ R +RHF++  +    ++T+  IF +IV   F   F          +V +++ +Y +     LPTPAKSHYVFNLRD S+ I+GVL      + +  ++ RL+ HE  RVF DRL  +ED+  F  I+            E    H   +      +   ++FGD+M       DK+Y+E+T LK +   +  +LDDYN  S   M LV F  A+EHISR+ R+++Q  G+ALLVG+GG+G+QS TR+A  M+ ++ F IE+TR Y  + +R+DLK+L   AG   +  VFLF+D QI  E F+EDI+ +LN+G+VPNL+  +E   +L    N  R   K+ G   +     +++YFI RV+ NLHIVL MSP+GDAFR R RMFPSL+NCCTIDWF  WP +AL  V++ F E++++  E  ++ +  MC   H SV  +++ F   LRR  Y TPTSYLELI  +  +L+ KR +LI  ++R   GL+KL   +  V  MQ+EL AL+P+L   S   +KL+ K++ D  E +  R ++ AE+  A  KA E+  I  + + DL EA+P L  A  +LD+L ++DI+ +R    PP L+  VME++CI+LG KP+              W S+  +LGD  FL +L ++  D +    ++KL+ KYI  P F  ++V   S AC  +  W+ A+D Y    + V PK+ KLA A+ ELE+ +  L EK+A L EVE+K+ +L    D +   K+ L  NI     +L RA +L   LG E+ RWTE          N+ G+V ++AA VAY G FT  +R+ ++  W ++C E+ +P S+ F ++++L +P +IR WN  GLP DS  +I++ I+   + R  L +    +AN+WI+  E  N L IIKLTDNNF+RTLEN I+ G PVLLE VGE L+P LEPIL K  F Q G   +RLGD+ I+Y+K+F+FY+TT+L NPHYLPE+  KV ++NF +T  GLEDQLL  V   E+P+LE+++N LI+    +K +LK +ED+IL++L  S+GNIL++E  IN L+ SK+ S  IS +   AE T+ +I   R  Y+PVA  GS+++F ++ +A +DPMYQYSL +F  LF   IE+SEK++DL+ R+E L ++ T SVY N+ R LFE  KL+FS  +C  +++ +  + DE W F L G   LD   P  P   W++D +W+      + L S KG +  F

HSP 2 Score: 605.905 bits (1561), Expect = 7.557e-174
Identity = 316/686 (46.06%), Postives = 446/686 (65.01%), Query Frame = 2
            L   ++LI ++  + +K+V A   F+ +NLG+TF++ P  DL   F + +   PLIF+LS G+DPMNA L+F  D  Y   +I +ISLGQGQGP+A K+I  A ++G WV LQNCHLA SWM ++E   +++   E   H++FRL+L+S P++ FPV++LQN VK+TNEPPKGLRAN  R++   + DP      F+      RW  ++FG+CFFHA++QER+KFGPLGWNI YEFN+SD   ++  ++MFL D   +P +ALT++TG+  YGGRVTD+ D+R L ++L  F++  I+E + Y FS SGIY+ P   +   Y EY+ +LP+   PEV+G+HENA+I    QET+QL   +L   PR AS G GK+ ++ + ELAD IL KL +  D+E   K         RY      S+ TVL QE+ RFN L+ V++++L  LQKAIKGLVVM+ EL++V+ S L  +VP+ WA  SYPSLKPLGS+V DL+ R  F   WI +  P +FWISGF+F Q FLTG LQN ARKY +PID++ F + +   + N  ++                     P+DG  V+GL+L+GARWD ++ MLG++    +   +PI+ ++P   +  D  S Y+ P+YKTSAR G LSTTGHSTNFV+++ LP +L Q  WI +G A LCQL++
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah12 (dynein axonemal heavy chain 12 [Source:NCBI gene;Acc:101164478])

HSP 1 Score: 2771.11 bits (7182), Expect = 0.000e+0
Identity = 1509/3126 (48.27%), Postives = 2066/3126 (66.09%), Query Frame = 1
            PM     +N +  +C      +  +W P+  +LF +++T        +STG+ +   +F+   ++L+S QLR++             +HK    F   FD  +    P+  + L   + K+   P+ ++++  ++     I  + + +  V+  L     G          N K+   Y      T K     N  GP  +   Y  Y  L+N  A+ +V  FLKE H      KK++ + +L  E+S L   V  ++  LD           C++L++ L +            IC  ++ I  KV +IP +TE +  +++++       V  L  E +EA   +++LL+      EDIKLN+T++ WPH+I   F+ +   +Q+ R++ E++L  R  +   +LE++  +I+ F    E+  ++E   +V+   +   ++ + ++ +  +NKEE+   WE + +P +  M + ++PY ++      W+      L FH     W+ G F +LN  T+E  + E  + ++K++K F    +  AQ+VA    K +G+                       I KFK+++PV+ ++CNPG++ RHW++MS I GFD+ P   +SL   L   L   LE+ E I  AA+KE  LEK +  M + W  + F    ++D+GVSI +ALDDIQM+LDD I+K+QTM GSPF+KPF+ EMK WE++L+ + + ID WLK+QA WLYLEPIFSS+DI+ Q+PEEGR F  VD  W+E+M   VK+   L AT    +L+RL DSN+LLE+I KGLN YLEKKRL+FP                                               M S+EGE + ++  I  ++A G VEKWLLQ+E+ MI+SV+ +I+ S  +Y  T R +WV +WPGQ+V+C S I+WT EV +A+    GLK Y  +  +Q+++IV+LVRG L    R TLGAL  IDVHARDVV+++ + +VS    FEWL+QLRYY     V V  I+ ++ Y  EYLGN+PRLVITPLTDRCYRTL+ A  LNLGGAPEGPAGTGKTET KDLAKA+A QCVVFNCSDGLDY AMGKFFKGLA +GAWACFDEFNRIELEVLSVVAQQ+  IQ AI   L+ F FEGT L LNP C + ITMNPGYAGR ELPDNLKVLFR+VAMMVP+YALI EISLYS GF++A+ L++KIV TYRLCSEQLSSQ HYDYGMRAVK+VL AAGNL+ K P+ ENE ILLL++I DVN PKFLS DIPLF GI SDLFPGV LP AD+ +F  A ++      +Q  + F DK++Q YEM++VRH  M+VGE F GKT+    LA  L+ +   G  +E KV +  +NPK+ITMGQL+GQFD VSHEWTDGV+A  FREFA+A+   RKW++FDGP+D +WIE+MNTVLDDNKKLCLMSGEIIQMSN+M+LIFE  DL QASPATVSRCGMIYMEP+QLGW+P + S+I   LP  L   D+  LI DLF WLI P L  +R +C++++ T+  H VV L +LF  +LDE ++  P  E   T                W+   F  S VWS+G       R KF+ F R+   G N  +P P++I+  +     E+  +YD+ +E K  G W  W +TI+  ++    + K  EII+PT +T R TY +DL ++ + P++ VGPTGTGKSV + + L+  L KD YL   INFSA TSANQTQ+IIM+K+D+RRKGV+GPP  KR V+FVDDLNMPA+E++GAQPP+ELLRQ++DHGH +D KDTSK+ L+D   ++AMGPPGGGRN V+SR +RH N++ +N F+D+TM+ IF++IV +  +   F   F  +G  +V++ M VYKKA+A+ LPTPAKSHY FNLRDFSRVI+G LL+   +L   + L+RL+VHEVYRV++DRL  +EDR   + ++     D F    +++ G L    K+ ++D++ L+FGDYM      D+++Y E+ S++  A+ +++ L++YN + K  M+LV+F + +EH+SR+ RVLKQ  G+ALLVG+GGSGRQS TR+A  MA   +F  EI++NYG  EWRDDLK++L++ AG   +  VFL +D QIK E+F+EDI  +LNTG+VPNL+  DEK EI+E ++  A+  +K     ++ +P+ ++ +F+ R K+NLH+V+A SPIG AFR RLR FPSLINCCTIDWFQ WPE+ALE VAN FLE +EM EN R+ ++ +CK +H S  QLS +F   L RYNY+TPTSYLELI TF++L++ KR  ++  K RY+ GL++L FA  EV KM+ EL  LQP+L        K++  +E +++EVEAK  ++  ++E A +KA E+Q +K +CE DLAEA+P L  A+ +LDTLKQ +DI++V++MKNPP  +KLVM AVC+M   KP+R PD + TGK I DYW  S KLLGD  FL  LK +  D++    ++ +R +++  PDFDP  V NAS+A EGLCKWI A++ YD  AK+VAPKK KLA A++ L  T   L +K+A+L EVE +L  L    +E  + K  LE  +E C +KL+RAE+LIGGL GEK  W++AA  L   Y N+TGDVL+SA V+AYLG FT  FR +  + W   C    IP S+ F +   LG P++IRAWNIAGLP DSFSIDNG+IV NS R PL IDPQGQANKW+KN+EK N L++IKLTD +++RTLEN IQFGTP+LLENVGEEL+P LEP+L K  F+ QGV+ ++LG+ VIEY+ DF+FY+TTRL+NPHYLPE++TKV LLNFMITP+GLEDQLLGIV A ++PELEE++  LI++SA+NKR+LKE+ED ILE L SS+GNILE+E+AI +L S+K++S EI++KQ   IAE T+++I ++R GY+ VA H SILFF I+D+ NIDPMYQYSL WF+NL++ SI++  KS+ L+ R+EYL DHFT ++Y N+CRSLFE  KLLFS  +C  LL  K   + ++  FLLTGG+ L N   NP P+W+ DK W E+ RASELP  +GL E F  N + +K +YDS+ P

HSP 2 Score: 803.897 bits (2075), Expect = 0.000e+0
Identity = 396/656 (60.37%), Postives = 488/656 (74.39%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1466.06 bits (3794), Expect = 0.000e+0
Identity = 894/2591 (34.50%), Postives = 1433/2591 (55.31%), Query Frame = 1
            +K  ID+F    P+L+++ +  +  RHW +++++ G ++   +E   L + +     K+ E++E+I  +A KE  +E+ L ++  +W    F    +++ G  +L      +++  L+D ++   ++  + +  PF+ +++ W   L + +DII+ W+ VQ  W+YLE +F   DI  Q+P+E + F  +D +W ++M  + + P    SC+       +L  L +    L+  QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F E++   I+ + S E ET+ +     P  A+G VE WL  +      S+  VI  +  +  I   G  ++D+      Q+ +    + WT++  EA+T  +  +  + K N      ++ ++ +   +L + ER     L  I VH RD+ +++ +L + + + FEWL Q R+Y  +   ++ +        Y NE+LG T RLVITPLTDRCY TL  AL + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQ+G+W CFDEFNRIEL VLSV AQQI  +        K FVF +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FRSV+MMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P ++ ES ++ + + D+NL K + +D  LF  +I DLFPG++L K  +    +A+   + +  L  H  W + K++Q+YE   VRHG+M +G    GKT   Q L  A+T+       +E +     +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+     W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + LGW P +E +++   P     +  +++R LF         F   + +  ++  E   ++Q   +   L+      P  E+                    L+ L++F+ +WS G+ L    R K +++FR               I+ +     P R  T++D+     + G+W  W   ++          K + I++P  +  R  + +D      K V+++G  GT K+V++ +++ +   +  L   +NFS+ T+    Q  + + +D+R    YGPP  K+  + +DD+NMP   ++G Q   E++RQ ++   +++ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I + HF  + GF     R    LV  T  +++      LPTPAK HY+FNLRD SR+ +G+L      + +   L+ LW HE  RV  DR TM +D +++FD  + KL         +E+ LG      KVVD  V    F D++ D                 K+Y+ I S ++L  R+  FL  YN SI    M +V FQ AM H+ +V R+++   G+ALLVG+GGSG+QS TR+A+F+A ++IF I +TR Y      +DLK L   AG   K + F+++DN+IK+ESF+E ++ +L++G+V NL+  +E  EIL  +    + E  +       T   +Y+YF+ RV+ NLH+VL  SP+G+ FRNR   FP+LI+ CT+DWF  WP+DAL  V++ FL   DI+     +  +V     + + V +   ++    RR  +VTP SYL  I+ +K +   KR E++       TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+ EA  E++  E +    KA   Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP LI   M+ V ++L  +       +    I   W  S+ L+    FL  LK F  D++N + + +L + Y   P+++ +  R AS+   GL  W  A+  +    K V P K  LA+ E  L +    L + +A+LD  +A+L  +  + +E    K  L ++ + C +K+  A  LI GL GEK RWTE +K  + +   + GDVL++ A ++Y G F   FR+ ++  W  +  + +IP   +  + ++L +   +  WN+ GLP D  SI NGIIV  + R+PL IDPQ Q   WIKN E  N L I  L    F   LE S+  G P+L+E+VGEEL+P+L+ +L+K   +      +++GD  ++  K FK Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG V   EK E+E+++  L+ +   NKRK+KELED +L  L+S+QG+++++E+ I VL ++K  ++E+++K  IA  TQ++I+  R  Y+PVA  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+  S KS +   RI+ + ++ T  VY    R L+E HK LF+L + + + ++GKN  + E    L+ GG +LD    P     W+ D  W  +V  S+L     + +   ++   WKS +D ++PE

HSP 2 Score: 426.402 bits (1095), Expect = 1.076e-118
Identity = 238/668 (35.63%), Postives = 383/668 (57.34%), Query Frame = 2
            LP+ ++ L    +L+++RC  PD+ +   + +I D +G+ + +    D+  ++ +SN  +PLI  LS G+DP ++++  G+           +S+GQGQ   A K++ Q + +G W +LQNCHL  ++M   +++ + +I  E  + +FRLW+T+   ++FP+++LQ  +K TNEPP+GL+A L R+Y  +N  + D       ++ ++W  ML+ + F H+ VQERRKFGPLGWNIPYEFN++D   +V+ +Q  L+D     L     + Y+ GE  YGGRVTDD D+RLL +  ++++N ++ E++   +   GI   P   +   Y+ YI+ LP    PEV+GLH NADIT  +++   +   IL   P+  +SG G++ E ++  +ADD+L+KLP +   F+++ + K  P+   + MN  LRQE+ R  ++I +VRSTLI+L+ AI G ++M+  L +  + M   ++P  W  KS+ S   LG +  +L++R   F  W+    P+ FW++GF+  Q FLT + Q  AR      +D +    E+T +    DI   P  G  VYGL+LEGA WD+ N  L ES PK+LF  +P+IW+     V  D    Y CP+YK   R           N + ++ L       HW+ RGVA LC +
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1236.48 bits (3198), Expect = 0.000e+0
Identity = 752/2097 (35.86%), Postives = 1177/2097 (56.13%), Query Frame = 1
            T L   CY TL  AL + +GGAP GPAGTGKTET KD+ + + K  VVFNCSD +D++ +G+ FKGLAQ+G+W CFDEFNRIEL VLSV AQQI  +        K FVF +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FRSV+MMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P ++ ES ++ + + D+NL K + +D  LF  +I DLFPG++L K  +    +A+   + +  L  H  W + K++Q+YE   VRHG+M +G    GKT   Q L  A+T+       +E +     +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+     W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + LGW P +E +++   P     +  +++R LF         F   + +  ++  E   ++Q   +   L+                   +K+    N +L  + L++F+ +WS G+ L    R K +++FR               I+ +     P R  T++D+    +  G+W  W   ++          K + I++P  +  R  + +D      K V+++G  GT K+V++ +++ +   +  L   +NFS+ T+    Q  + + +D+R    YGPP  K+  + +DD+NMP   ++G Q   E++RQ ++   +++ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I + HF  + GF     R    LV  T  +++      LPTPAK HY+FNLRD SR+ +G+L   H++     + L+ LW HE  RV  DR TM +D +++FD  + KL         +E+ LG      KVVD  V    F D++ D                 K+Y+ I S ++L  R+  FL  YN SI    M +V FQ AM H+ +V R+++   G+ALLVG+GGSG+QS TR+A+F+A ++IF I +TR+         LK L   AG   K + F+++DN+IK+ESF+E ++ +L++G+V NL+  +E  EIL  +    + E  +       T   +Y+YF+ RV+ NLH+VL  SP+G+ FRNR   FP+LI+ CT+DWF  WP+DAL  V++ FL   DI+     +  +V     + + V +   ++    RR  +VTP SYL  I+ +K +   KR E+  L NR  TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+ EA  E++  E +    KA   Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP LI   M+ V ++L  +       +    I   W  S+ L+    FL  LK F  D++N + ++ L + Y   P+++ +  R AS+   GL  W  A+  +    K V P K  LA+ E  L +    L + +A+LD  +A+L  +  + +E    K  L ++ + C +K+  A  LI GL GEK RWTE +K  + +   + GDVL++ A ++Y G F   FR+ ++  W  +  + +IP   +  + ++L +   +  WN+ GLP D  SI NGIIV  + R+PL IDPQ Q   WIKN E  N L I  L    F   LE S+  G P+L+E+VGEEL+P+L+ +L+K   +      +++GD  ++  K FK Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG V   EK E+E+++  L+ +   NKRK+KELED +L  L+S+QG+++++E+ I VL ++K  ++E+++K  IA  TQ++I+  R  Y+PVA  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+  S KS +   RI+ + ++ T  VY    R L+E HK LF+L + + + ++GKN  + E    L+ GG +LD    P     W+ D  W  +V  S+L     + +   ++   WKS +D ++PE

HSP 2 Score: 427.557 bits (1098), Expect = 2.004e-119
Identity = 239/677 (35.30%), Postives = 386/677 (57.02%), Query Frame = 2
            LP+ ++ L    +L+++RC  PD+ +   + +I D +G+ + +    D+  ++ +SN  +PLI  LS G+DP ++++  G+           +S+GQGQ   A K++ Q + +G W +LQNCHL  ++M   +++ + +I  E  + +FRLW+T+   ++FP+++LQ  +K TNEPP+GL+A L R+Y  +N  + D       ++ ++W  ML+ + F H+ VQERRKFGPLGWNIPYEFN++D   +V+ +Q  L+D     L     + Y+ GE  YGGRVTDD D+RLL +  ++++N ++ E++   +   GI   P   +   Y+ YI+ LP    PEV+GLH NADIT  +++   +   IL   P+  +SG G++ E ++  +ADD+L+KLP +   F+++ + K  P+   + MN  LRQE+ R  ++I +VRSTLI+L+ AI G ++M+  L +  + M   ++P  W  +S+ S   LG +  +L++R   F  W+    P+ FW++GF+  Q FLT + Q  AR      +D +    E+T +    DI   P  G  VYGL+LEGA WD+ N  L ES PK+LF  +P+IW+         K  K+V   R   Y CP+YK   R           N + ++ L       HW+ RGVA LC +
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: dnah5 (dynein axonemal heavy chain 5 [Source:NCBI gene;Acc:101171908])

HSP 1 Score: 1193.33 bits (3086), Expect = 0.000e+0
Identity = 813/2591 (31.38%), Postives = 1318/2591 (50.87%), Query Frame = 1
            +K  ID+F    P+L+++ +  +  RHW +++                              E+I  +A KE  +E+ L ++  +W    F    +++ G  +L   S  + I  L D  ++    M  S +  PF+ +++ W   L + +DII+ W+ VQ  W+YLE +F   DI  Q+P+E + F  +D +W ++M  + + P    SC+       +L  L +    L+  QK L  YLEKKRL FPRFFF+S+  LLEIL +  D   +Q HL   F+ I  ++F E+ + I+ + S E ET+ +     P  A+G VE WL  +      S+  VI  +  +  I   G  ++D+      Q+ +    + WT++  EA+T  +  +  + K N      ++ ++ +   +L + ER     L  I VH RD+ +++ +L + + + FEWL Q R+Y  +   ++ +        Y NE+LG T RLVITPLTD                           ET KD+ + + K  VVFNCSD +D++ +G+ FK LAQ+G+W CFDEFNRIEL VLSV AQQI  +        K FVF +G  + +NP   +F+TMNPGYAGRQELP+NLK+ FRSV+MMVPD  +I  + L S GF+D   LA K    Y+LC EQLS Q HYD+G+R + SVL   G  ++  P ++ ES ++ + + D+NL K + +D  LF  +I DLFPG++L K  +    +A+   + +  L  H  W + K++Q+YE   VRHG+M +G    GKT   Q L  A+T       M+        +NPKAIT  Q++G+ D  +++WTDG+ + ++R+   A+ +   W++ DGPVDA+WIEN+N+VLDDN+ L L +G+ I M+    ++FEP +++ ASPATVSR GM++M  + LGW P +E +++   P     +  +++R LF         F   + +  ++  E   ++Q   +   L+  ++ Q      E                  L+ L++F+ +WS G+ L    R K +++FR               I+ +     P R  T++D+     +  +W  W   ++          K + I++P  +  R  + +D      K V+++G  GT K+V++ +++ +   +  L   +NFS+ T+    Q  + + +D+R    YGPP  K+  + +DD+NMP   ++G Q   E++RQ ++   +++ +K     +++D   L+AM  PGGGRND+  R+ R F++      ++ ++ +IF  I + HF  + GF     R    LV  T  +++      LPTPAK HY+FNLRD SR+ +G+L      + +   L+ LW HE  RV  DR TM +D +++FD  + KL         +E+ LG      KVVD  V    F D++ D                K+Y+ I S ++L  R+  FL  YN SI    M +V FQ AM H+ +V R+++   G+ALLVG+GGSG+QS TR+A+F+A ++IF I +T  Y      +DLK L   AG   K + F+++DN+IK+ESF+E ++ +L++G+V NL+  +E  EIL  +    + E  +       T   +Y+YF+ RV+ NLH+VL  SP+G+ FRNR   FP+LI+ CT+DWF  WP+DAL + ++ FL   ++D + +   E +  M  F      +  + F+N                                       TGL+KL+ AS+ V  +  EL+  + EL + + + D +L +V   TV+ EA  E++  E +    KA   Q I D   AD       L  A P L +A A+L T+K +DI  VR++  PP LI   M+ V ++L  +       +    I   W  S+ L+    FL  LK F  D++N + + +L + Y   P+++ +  R AS+   GL  W  A+  +    K V P K  LA+ E  L +    L + +A+LD  +A+L  +  + +E    K  L ++ + C +K+  A  LI GL GEK RWTE +K  + +   +  DVL++ A ++Y G F   FR+ ++  W  +  + +IP   +  + ++L +   +  WN                                             L I  L    F   LE S+  G P+L+E+VGEEL+P+L+ +L+K   +      +++GD  ++  K FK Y+TT+L NP Y PEIS +  +++F +T +GLEDQLLG                                     V+ + + +++++E+ I VL ++K  ++E+++K  IA  TQ++I+  R  Y+P A  GSIL+F I++M+ ++ MYQ SL  F+ LF +S+ +S KS +   RI+ + ++ T  VY    R L+E HK LF+L + + + ++GKN  + E     L  G +LD    P     W+ D  W  +V  S+L      L +   ++   WKS +D ++PE

HSP 2 Score: 420.239 bits (1079), Expect = 6.463e-117
Identity = 234/668 (35.03%), Postives = 380/668 (56.89%), Query Frame = 2
            LP+ ++ L    +L+++RC  PD+ I    + +I D +G+ + +    D+  ++ +SN  +PLI  LS G+DP ++++  G+           +S+GQGQ   A K++ Q + +G W +LQNCHL  ++M   +++ + +I  E  + +FRLW+T+   ++FP+++LQ  +K TNEPP+GL+A L R+Y +N  + D       ++ ++W  ML+ + F H+ VQERRKFGPLGWNIPYEFN++D   +V+ +Q  L+D     L     + Y+ GE  YGGRVTDD D+RLL +  ++++N ++ E++   +   GI   P   +   Y+ YI+ LP    PEV+GLH NADIT  +++   +   IL   P+  +SG G++ E ++  +ADD+L+KLP +   F++++  +   +   + MN  LRQE+ R  ++I +VRSTLI+L+ AI G ++M+  L +  + M   ++P  W  +   +   LG +  +L++R   F  W+    P+ FW++GF+  Q FLT + Q  AR      +D +    E+T +    DI   P  G  VYGL+LEGA WD+ N  L ES PK+LF  +P+IW+     V   R   Y CP+YK   R           N + ++ L       HW+ RGVA LC +
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Match: si:dkeyp-86b9.1 (dynein axonemal heavy chain 10 [Source:NCBI gene;Acc:101170214])

HSP 1 Score: 963.37 bits (2489), Expect = 0.000e+0
Identity = 634/1922 (32.99%), Postives = 1026/1922 (53.38%), Query Frame = 1
            E L K   +L+ + +++P + ++ K L   S+++            W +  +   +   +++ I    + + +L K     P    VA  +   + +F+  L +L  + N  +++ HW+++ +  G  FD+   +  +L    +  LHK+   ++EI  +A KE  +E T       WK  KF +    +     V +L A+D+I + LD+ ++K Q M GS F  PF   ++ WE  L   ++ I++WL+VQ  W+ LE IF  EDI +Q+PEE +K   +   + E+M  +   P+   C    G+   L  L +    LE IQK L ++L+ KR  FPRFF +S+DELL +L    DP  +Q H+ K ++ I  L      + Q  +  M+S EGE +    K  P +A+  VE W++ V   M  + + +  +++  YV      W+  +   +V+  + ++WT EV  AI   N      LK Y  + + QID++V  +       +R+ +  + V DVHARD+V+N     +  V+ FEW SQLR+Y       ++V Q +T L YG EY+G   RL ITPLT R Y TL  AL + LGGA  GPAG GKTET KDLAKA+   CVV +C++ +D   +GK   GLA+ G W CFDEFNRI   VLSVV+ QIQ+I+ A+    K F FEG ++SL+    ++ITMNP Y  R ELP+++KV FR V ++ PD   I EI L+S GF+ A+ LA K+   Y+    QLS Q HYD+G+ + KSVL  AG +++   +  +E ++L++A+ D+NLPK +S+D+P+F G+ISD+FPG+D  +  F  F   V++ L K         +DK++QIYE++L +   MIVG+  GGK+    TL  A T                 +NPKA ++ +LYG FDP + +WTDG+ + +FRE   + D + ++++FDG VD+ W+ENMN+VLDDNK L L +G+ I++ +   L+FE  DL+ ASPATVSRC +++++P  L + P+ + +++  L              LFE  +  C+D +  N + ++  ++++ V QL  +   LL+   +   V                      L+  FL +   S+G++L+ESGR KFD    +L   ++ L               P   T+YDF F+ ++   W  W + +       +P  K  + I+PT +T R  + L+  +  ++PV++VG  GT K+ +I N L     D  ++  INFS++T++   Q  +   +++R K  YGPP  K+ +VF DD+NMP  + +G Q P+ LLR  +D G  +D+K       I  L  ++AM   GGGRN+V  R +  F+V  +      ++  I+ +I+  H    F      + + +   T+ ++   I    PTP+K HY F+ R+ SR+  G+ L  P  +    E+ +R+W +E  R F+DRLT E D+      +K    + F+T+ E +L                ++FGDY       + ++Y++I               DY+ +SKA   L  F+ A+EH++RV R+L+ D GHALL+G  GS  Q+ T++AAF AD E+F I + R Y +  +R+DLK L +K G + +  VFLF+D  I +E F+E I+ +L    VP L+  DEK  I++++ + A  E   + ++      +++ YF+ +   NLHIVL +S  GDA + R R FP L++   IDW+  W   AL  VA   LE+  + +    A++      H S+   S++ L   +R NY T  S+L+ I ++  LL  ++NE + L+ + L G L +L  A +++ ++ ++L   +  L   +A     L +++++

HSP 2 Score: 373.629 bits (958), Expect = 0.000e+0
Identity = 214/655 (32.67%), Postives = 349/655 (53.28%), Query Frame = 2
            L    KL++LRC+R D++  A+  ++T  +G   + PP  +  + +  S   SP++F++S G+DP   L+KF E  G   +K   I++GQGQ  +  K++++A+  G+W++LQNCHL   W+K LEK  E+I  P   + NFR+W+T+   +DFP+ ILQ   K+  EPP+ ++ N+  +Y    IS  +    C  +  + ++++ L FFHA+VQER K+G  GW++P  FN+SD   S+  +  +L    E     +P E+L YL GE  YGGR  D  DRR+L   +  ++   +    +  + F    + Y  PP G   +Y E I  +P+   PEV GL    +I    Q   ++++ + +  P    G G   ++ I  +A DI K+LPE FD+ ++ +      S + + VL QEL RFNKL+  ++ +++ L +A+ G V M+ E +++ ++     VP  W   +  +LK L  +++ L +R   + +W +    P   W+SG +  +S+L  V+Q   RK   P+D+  F  E+T +    DI  R +    + GLFLEGA WD EN  L  S PK+L   +PI+ + P +  ++   +T   PVY TS RR            V   DL   +  +HW+  GV 

HSP 3 Score: 338.961 bits (868), Expect = 0.000e+0
Identity = 223/717 (31.10%), Postives = 387/717 (53.97%), Query Frame = 1
            E++E  D+    LA+   +L    A+    L++ D     S   PP  +++V E + ++ G+K             E  W ++ K++ +  FL  L     DS++   I  +  K++       + +++ S A  G+ K++ +   Y   AK V PKK ++   EKE   +  +L   K  L+ ++ +   L ++ ++    K+   D  +L  ++L  A++L+ GL  E+  WT+  + L +++  + GD L++AA ++Y G F   FRN++V + W +   +  IP S+ FK+ + L   ++I +W   GLP D  S+ NGI+    +R+PLCIDPQ QA  WIKN EK N L  +  L D +F++ LE SI++G P LL++V E+++PI+  +L++ +   +G   + LGD  + Y+ +FK ++ T L NP Y P +  K  ++N+  T +GLEDQLL +     +   +++  +L+ E ++NK  LK L D +L  L +S GN+L+N   I  L  +K  + E  +K ++A+   VE    R GY+PVA  G++LFF +SDMA ++ MYQYSL  +++LF +S++ S    +L+ R+E + +  T +V+      LF  HKLLFS+ M + + + +  V  +   FL   L+G G  +  P+      W+ D+ W ++ + +EL       L    + N+  WKS +D ++PE
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000040511.1 (SMESG000040511.1)

HSP 1 Score: 3420.56 bits (8868), Expect = 0.000e+0
Identity = 1691/1712 (98.77%), Postives = 1692/1712 (98.83%), Query Frame = 1

HSP 2 Score: 1332.01 bits (3446), Expect = 0.000e+0
Identity = 643/660 (97.42%), Postives = 644/660 (97.58%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000040511.1 (SMESG000040511.1)

HSP 1 Score: 3370.87 bits (8739), Expect = 0.000e+0
Identity = 1669/1690 (98.76%), Postives = 1670/1690 (98.82%), Query Frame = 1

HSP 2 Score: 1333.16 bits (3449), Expect = 0.000e+0
Identity = 643/660 (97.42%), Postives = 644/660 (97.58%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3041.91 bits (7885), Expect = 0.000e+0
Identity = 1598/3118 (51.25%), Postives = 2142/3118 (68.70%), Query Frame = 1

HSP 2 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 418/669 (62.48%), Postives = 511/669 (76.38%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000012956.1 (SMESG000012956.1)

HSP 1 Score: 3038.44 bits (7876), Expect = 0.000e+0
Identity = 1600/3132 (51.09%), Postives = 2145/3132 (68.49%), Query Frame = 1

HSP 2 Score: 878.241 bits (2268), Expect = 0.000e+0
Identity = 418/669 (62.48%), Postives = 511/669 (76.38%), Query Frame = 2
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Match: SMESG000013737.1 (SMESG000013737.1)

HSP 1 Score: 2976.42 bits (7715), Expect = 0.000e+0
Identity = 1545/2961 (52.18%), Postives = 2078/2961 (70.18%), Query Frame = 1

HSP 2 Score: 501.901 bits (1291), Expect = 6.598e-142
Identity = 237/433 (54.73%), Postives = 315/433 (72.75%), Query Frame = 2
The following BLAST results are available for this feature:
BLAST of Dynein heavy chain, axonemal vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DNAH30.000e+059.90dynein axonemal heavy chain 3 [Source:HGNC Symbol;... [more]
DNAH70.000e+051.98dynein axonemal heavy chain 7 [Source:HGNC Symbol;... [more]
DNAH120.000e+050.03dynein axonemal heavy chain 12 [Source:HGNC Symbol... [more]
DNAH10.000e+042.05dynein axonemal heavy chain 1 [Source:HGNC Symbol;... [more]
DNAH61.194e-17038.47dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
che-31.479e-4426.94Cytoplasmic dynein 2 heavy chain 1 [Source:UniPro... [more]
dhc-13.243e-15535.75Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-13.243e-15535.75Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-14.089e-15535.75Dynein heavy chain, cytoplasmic [Source:UniProtKB... [more]
dhc-32.070e-6837.37Dynein Heavy Chain [Source:UniProtKB/TrEMBL;Acc:G... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dhc36C0.000e+048.40gene:FBgn0013810 transcript:FBtr0304742[more]
Dnah30.000e+046.49gene:FBgn0035581 transcript:FBtr0289982[more]
Dhc62B0.000e+044.30gene:FBgn0013811 transcript:FBtr0303106[more]
Dhc16F8.802e-13837.95gene:FBgn0283476 transcript:FBtr0074509[more]
kl-21.277e-12737.15gene:FBgn0001313 transcript:FBtr0346722[more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah30.000e+060.71dynein axonemal heavy chain 3 [Source:ZFIN;Acc:ZDB... [more]
dnah70.000e+051.62dynein, axonemal, heavy chain 7 [Source:ZFIN;Acc:Z... [more]
dnah120.000e+049.62dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah120.000e+049.46dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
CR450723.10.000e+049.29dynein, axonemal, heavy chain 12 [Source:NCBI gene... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttc21a0.000e+062.73tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+062.29tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a4.268e-1065.43tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a0.000e+064.24tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
ttc21a4.268e-1064.03tetratricopeptide repeat domain 21A [Source:Xenbas... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnah30.000e+060.94dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah30.000e+059.97dynein, axonemal, heavy chain 3 [Source:MGI Symbol... [more]
Dnah7c0.000e+052.22dynein, axonemal, heavy chain 7C [Source:MGI Symbo... [more]
Dnah7a0.000e+052.22dynein, axonemal, heavy chain 7A [Source:MGI Symbo... [more]
Dnah7b0.000e+052.17dynein, axonemal, heavy chain 7B [Source:MGI Symbo... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8TD57|DYH3_HUMAN0.000e+059.90Dynein heavy chain 3, axonemal OS=Homo sapiens OX=... [more]
sp|Q8BW94|DYH3_MOUSE0.000e+059.97Dynein heavy chain 3, axonemal OS=Mus musculus OX=... [more]
sp|Q63170|DYH7_RAT0.000e+052.11Dynein heavy chain 7, axonemal OS=Rattus norvegicu... [more]
sp|Q8WXX0|DYH7_HUMAN0.000e+051.98Dynein heavy chain 7, axonemal OS=Homo sapiens OX=... [more]
sp|E9Q8T7|DYH1_MOUSE0.000e+042.02Dynein heavy chain 1, axonemal OS=Mus musculus OX=... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267EPJ60.000e+068.23Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8J3L20.000e+067.67Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A4S2M5I40.000e+067.62Uncharacterized protein OS=Opisthorchis felineus O... [more]
K1PBH33.470e-4766.93Dynein heavy chain 3, axonemal OS=Crassostrea giga... [more]
A0A2C9KDA10.000e+066.40Uncharacterized protein OS=Biomphalaria glabrata O... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+049.89dynein, axonemal, heavy chain 12 [Source:ZFIN;Acc:... [more]
dnah21.773e-14739.85dynein, axonemal, heavy chain 2 [Source:ZFIN;Acc:Z... [more]
si:dkeyp-86b9.11.270e-12036.06dynein axonemal heavy chain 10 [Source:HGNC Symbol... [more]
ENSAMXT00000016172.22.448e-11233.84pep primary_assembly:Astyanax_mexicanus-2.0:4:1379... [more]
dnah54.358e-11633.64dynein, axonemal, heavy chain 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000001140.10.000e+049.63pep scaffold:Pmarinus_7.0:GL478666:370:47701:-1 ge... [more]
DNAH64.921e-17338.19dynein axonemal heavy chain 6 [Source:HGNC Symbol;... [more]
ENSPMAT00000003955.10.000e+046.39pep scaffold:Pmarinus_7.0:GL495754:4342:49943:-1 g... [more]
ENSPMAT00000003959.10.000e+045.92pep scaffold:Pmarinus_7.0:GL495754:4357:49943:-1 g... [more]
ENSPMAT00000004701.10.000e+063.81pep scaffold:Pmarinus_7.0:GL479445:9390:42654:-1 g... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DYN12.968e-1125.23Cytoplasmic heavy chain dynein; microtubule motor ... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO347270.000e+061.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458060.000e+051.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379616.351e-16354.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340772.084e-8439.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318007.557e-17438.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnah120.000e+048.27dynein axonemal heavy chain 12 [Source:NCBI gene;A... [more]
dnah51.076e-11834.50dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah52.004e-11935.86dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
dnah56.463e-11731.38dynein axonemal heavy chain 5 [Source:NCBI gene;Ac... [more]
si:dkeyp-86b9.10.000e+032.99dynein axonemal heavy chain 10 [Source:NCBI gene;A... [more]
back to top
BLAST of Dynein heavy chain, axonemal vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5