Ectonucleotide pyrophosphatase/phosphodiesterase family member 6

Overview
NameEctonucleotide pyrophosphatase/phosphodiesterase family member 6
Smed IDSMED30026121
Length (bp)1718
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 (SMED30026121) t-SNE clustered cells

Violin plots show distribution of expression levels for Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 (SMED30026121) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 (SMED30026121) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 (SMED30026121) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026121

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30026121SMESG000040292.1 SmedASXL_002004SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30026121SMESG000040292.1 SmedASXL_002004SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026121SMESG000040292.1 dd_Smed_v4_1269_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026121SMESG000040292.1 SMESG000040291.1 Contig37370uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026121SMESG000040292.1 SMESG000040291.1 Contig37370newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30026121SMESG000040292.1 OX_Smed_1.0.21408ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neoblastSMED30026121SMESG000040292.1 dd_Smed_v6_1269_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Human
Match: ENPP6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:HGNC Symbol;Acc:HGNC:23409])

HSP 1 Score: 171.785 bits (434), Expect = 7.007e-47
Identity = 112/397 (28.21%), Postives = 194/397 (48.87%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKT---DLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S  +KLL+  LDGFR DYI       L GF ++   G  V+ + P FP+  +PN Y++ TG +   H ++GN ++     + FD   +        W  +EPLWVT     ++ ++Y+ P CE     + P++C+ Y      ++ F ++V +A+ S  SG A +A +Y++ +D   H +GP S    D  L  +D  ++++ + +         +    ++ SDHGM  I    + I L + I  ++++++ ++G  VS+W  PG    +  +L      T  H  +Y    +P  +    G  +SP L LVA+ G+FI+ N    P         + +  GWHGY  E  +M    LA+GP  +   +   I   DVY ++ +++ + P  +NGS
Sbjct:   21 SARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGSEPLWVTLTKAKRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDIN-FANAVSDALDSFKSGRADLAAIYHERIDVEGHHYGPASPQRKD-ALKAVDTVLKYMTKWIQERGLQDRLNV---IIFSDHGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAPGKHSEIYNKL-----STVEHMTVYEKEAIPSRFYYKKGKFVSP-LTLVADEGWFITENREMLPFWMNSTGRREGWQRGWHGYDNELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Human
Match: ENPP5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5 [Source:HGNC Symbol;Acc:HGNC:13717])

HSP 1 Score: 142.51 bits (358), Expect = 4.053e-36
Identity = 117/411 (28.47%), Postives = 196/411 (47.69%), Query Frame = 1
Query:  136 LMLMFFIFFKLSVA---------QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEF--DHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAH--FKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
             +L+ FI   LS++         QK+LL+  DGFRWDY+ K     F  + + G +V++V  VF    +PN Y++ TGL+  +HG++ N ++     + F  DH N     D   W +A P+W+T++  G  S     P  +       P+H +PY+ +S+  ++  + + E   S      ++ ++Y +  D + H  GP S  L   ++  ID  + +   L+         + ++L++ SDHGM Q ++ R I L++  L  +   LI+Q    +I  K G  D V        A T AH    +Y    +PE W+      + P ++ VA+ G+ I  N+      DD+   G HGY     +M    LA+GP  +     + ++ TD+Y LL H+L +    HNGS
Sbjct:    5 FLLVSFILAALSLSTTFSLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNI---YDSKFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRFPTHYMPYN-ESVSFEDRVAKIIEWFTS--KEPINLGLLYWEDPDDMGHHLGPDSP-LMGPVISDIDKKLGY---LIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQY-LDKDHYTLIDQSPVAAILPKEGKFDEV------YEALTHAHPNLTVYKKEDVPERWHYKYNSRIQP-IIAVADEGWHILQNK-----SDDFL-LGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGS 391          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Human
Match: ENPP5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5 [Source:HGNC Symbol;Acc:HGNC:13717])

HSP 1 Score: 142.51 bits (358), Expect = 4.053e-36
Identity = 117/411 (28.47%), Postives = 196/411 (47.69%), Query Frame = 1
Query:  136 LMLMFFIFFKLSVA---------QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEF--DHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAH--FKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
             +L+ FI   LS++         QK+LL+  DGFRWDY+ K     F  + + G +V++V  VF    +PN Y++ TGL+  +HG++ N ++     + F  DH N     D   W +A P+W+T++  G  S     P  +       P+H +PY+ +S+  ++  + + E   S      ++ ++Y +  D + H  GP S  L   ++  ID  + +   L+         + ++L++ SDHGM Q ++ R I L++  L  +   LI+Q    +I  K G  D V        A T AH    +Y    +PE W+      + P ++ VA+ G+ I  N+      DD+   G HGY     +M    LA+GP  +     + ++ TD+Y LL H+L +    HNGS
Sbjct:    5 FLLVSFILAALSLSTTFSLQPDQQKVLLVSFDGFRWDYLYKVPTPHFHYIMKYGVHVKQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPIRNKSFSLDHMNI---YDSKFWEEATPIWITNQRAGHTSGAAMWPGTDVKIHKRFPTHYMPYN-ESVSFEDRVAKIIEWFTS--KEPINLGLLYWEDPDDMGHHLGPDSP-LMGPVISDIDKKLGY---LIQMLKKAKLWNTLNLIITSDHGMTQCSEERLIELDQY-LDKDHYTLIDQSPVAAILPKEGKFDEV------YEALTHAHPNLTVYKKEDVPERWHYKYNSRIQP-IIAVADEGWHILQNK-----SDDFL-LGNHGYDNALADMHPIFLAHGPAFRKNFSKEAMNSTDLYPLLCHLLNITAMPHNGS 391          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Human
Match: ENPP4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:HGNC Symbol;Acc:HGNC:3359])

HSP 1 Score: 130.568 bits (327), Expect = 4.221e-32
Identity = 115/396 (29.04%), Postives = 178/396 (44.95%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYH-VDSMRLDEFNSSV--KEAVRSLM------SGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S+  KLLL+  DGFR DY+K  +        ++G  VE V  VF     PN YSI TGLY   HG++ N +Y +  K+ F  SN    +D   W +A P+WVT++ Q  +          SS   + P   VP H   S     +NSSV  +E + ++       +   + A +Y +  D   H +GP+       +L +ID  I     L+           +++++ SDHGM Q ++ R I L+  I  S    LI+     +I  K   ++  E   +L +     H  +Y    +P  +       + P ++LVA+ G+ I  NE     GD       HGY      M   L A+GP    G K   I++ D+Y ++ HIL + P  +NG+
Sbjct:   23 SLPPKLLLVSFDGFRADYLKNYEFPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDAVTKKHFSDSND---KDPFWWNEAVPIWVTNQLQENR----------SSAAAMWPGTDVPIHDTISSYFMNYNSSVSFEERLNNITMWLNNSNPPVTFATLYWEEPDASGHKYGPEDKENMSRVLKKIDDLI---GDLVQRLKMLGLWENLNVIITSDHGMTQCSQDRLINLDSCIDHS-YYTLIDLSPVAAILPK---INRTEVYNKLKNC--SPHMNVYLKEDIPNRFYYQHNDRIQP-IILVADEGWTIVLNESSQKLGD-------HGYDNSLPSMHPFLAAHGPAFHKGYKHSTINIVDIYPMMCHILGLKPHPNNGT 388          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Human
Match: ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1 [Source:HGNC Symbol;Acc:HGNC:3356])

HSP 1 Score: 123.25 bits (308), Expect = 1.101e-28
Identity = 105/387 (27.13%), Postives = 178/387 (45.99%), Query Frame = 1
Query:  187 LLLFLDGFRWDYIKKTD--LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILR-SEIERLINQGGYVSIWAKPGYLDSVEWR---LRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            LL  LDGFR +Y+      L   SKLK+ G Y + + PV+P    PN YSI TGLYP  HG++ N++Y  K+   F  S     +   +W   EP+WVT+K QG +S  +  P  +   + + P     Y+  S+  +E   +V + ++           +Y +  D   HS+GP S+ +    L ++D  +     L++G    +    ++L+++SDHGM Q +  + IYL + +     I+ +      +     P    S  +      L+  + + HFK Y    +P+  +      + P L    +P + ++ N    PS   Y  SG+HG       M +  + YGP  + G + D     +VY L+  +L + P  +NG+
Sbjct:  213 LLFSLDGFRAEYLHTWGGLLPVISKLKKCGTYTKNMRPVYPTKTFPNHYSIVTGLYPESHGIIDNKMYDPKMNASF--SLKSKEKFNPEWYKGEPIWVTAKYQGLKSGTFFWPGSDVEINGIFPDIYKMYN-GSVPFEERILAVLQWLQLPKDERPHFYTLYLEEPDSSGHSYGPVSSEVI-KALQRVDGMV---GMLMDGLKELNLHRCLNLILISDHGMEQGSCKKYIYLNKYLGDVKNIKVIYGPAARLRPSDVPDKYYSFNYEGIARNLSCREPNQHFKPYLKHFLPKRLHFAKSDRIEP-LTFYLDPQWQLALN----PSERKYCGSGFHGSDNVFSNMQALFVGYGPGFKHGIEADTFENIEVYNLMCDLLNLTPAPNNGT 587          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Celegans
Match: F13H10.5 (pep chromosome:WBcel235:IV:10990999:10994137:1 gene:WBGene00008776.1 transcript:F13H10.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F13H10.5)

HSP 1 Score: 98.9821 bits (245), Expect = 7.523e-22
Identity = 84/385 (21.82%), Postives = 169/385 (43.90%), Query Frame = 1
Query:  175 AQKLLLLFLDGFRWD-YIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDH--SNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYT--HGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNE--LEFPSGD-DYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEV 1305
            +QKL ++ +DG   + + K + LS F   +++G +  KV PVFP     N +S+ TG  PR HG++G+ + + K   +F +  ++S   RD   W   +P+++++        ++  P C+  +D ++P  CVP   D     +  S  K  +++  +    + ++Y+  + +     G                 +++   L            ++++V+S HG   + +     ++  +    IE  +  G    +  K G    V  +L   +   + H    T   G +P+H++ F   ++   L+L+A+PGY + + +   +FP        +   GY  E  ++    L YGP  + G +   I + DVY L+  +L +
Sbjct:   23 SQKLAVVVIDGLAANTFYKFSHLSVFRTFEEEGVWSTKVFPVFPTFSISNRHSLLTGTLPRRHGIIGDYINNWKDNLKFQNFTADSDFSRD---WWSIDPIYISALRSSASVAMFFFPECDVDWD-VAPQICVPPRTDGKTFAD-ESQAKRVIQA--TREHDLTLIYHPWIGEEIRRKGVHHTNEK-----HSKEVLRFAQSLERLTAQARERVDLNVIVVSTHGFIDVPRKNIRVMDEYVPMELIETTVGSGAIKQLQVKKGKTHQVYSQLHDHNPIPNVHVYYTTPKSGNLPDHYH-FKKSDIVADLVLLADPGYAVVTKDEKKQFPKPKLQEITAAIDGYNNELPDVLGVFLGYGPAFRVGFRKGPIQLFDVYSLMCSLLSI 394          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Celegans
Match: T03G6.3 (pep chromosome:WBcel235:X:2610826:2615726:-1 gene:WBGene00020195.1 transcript:T03G6.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T03G6.3)

HSP 1 Score: 94.7449 bits (234), Expect = 1.697e-20
Identity = 95/418 (22.73%), Postives = 169/418 (40.43%), Query Frame = 1
Query:  172 VAQKLLLLFLDGFRWDYIKKTDLS---GFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAE-PLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVP----------YHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILR-SEIERLINQGGYVSIWAKPGYLDSVEWRLRLASA--------DTDAHF-KLYTHGTMPE--HWNVFDGGNLSPQLLLVAEPGYFISSNEL-EFP-SGDDYYDSGW-HGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVP-QSHNGSST 1335
            + Q L+++  DG+    +  T      G   L  +G  V+ V P FP    P   S+ TGLY  +HG   + ++  K    F+     +  +   W DA+ PLW T+   G     Y    C  +F  +     VP          +  D++R  +    +   +         M ++    +       GP+S    D +  ++     ++  L             +LVV+SDHG   + K  Q ++E+ +   S +++++N    + ++  P    +V +   +           + D  F K Y    +P+  HW           ++L+ +PG  + + EL   P SGD   D+    G+ P H++M    +A GP  +   +   I + DVYQ+L +IL + P   HNG+ T
Sbjct:   20 IGQNLIVILADGYGATLLNNTKPDATFGIRHLATNGVQVDYVTPSFPTHTWPQWMSLSTGLYTENHGFTADYMWDRKTNFTFERGTGPNDTEDVWWDDAKAPLWYTAGKAGVDVHCYWFAHCHRAFYDMVVQ--VPEKRWANLDDQHQTDNLR--DIFPEIANRISKYQVYKQQMFLIRYANIGNAQKEHGPES----DEVEQEVARFDLYINELQQLLEDRGLFSSTNLVVMSDHGYTPLQKEEQFFMEQCLPDYSLVKKVVNSHSMIMVFTNPEDEGTVHYEFSVCEVWSPMGDYDENDTPFVKTYRMSELPDDLHWK---NSRFMSGVVLITKPGTSVVTKELPTVPHSGDPTIDAKQASGWEPYHDDMKGIFVARGPAFRENERFGPIEIVDVYQMLLNILSIEPAHPHNGTWT 426          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Celegans
Match: C27A7.1 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.1 [Source:UniProtKB/Swiss-Prot;Acc:P90754])

HSP 1 Score: 65.4698 bits (158), Expect = 6.922e-11
Identity = 33/107 (30.84%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLW-VTSKNQGKQS 501
            L++L LDGF  +Y+ +  +   + +   G   +KV P +P+   PN YSI TGL+P  HG+  N V+   +    +   S+      K+ + EP+W V  +  GK++
Sbjct:  182 LVILSLDGFAREYVDRNIVQTLNHIADCGVKADKVYPSYPSKTFPNHYSIVTGLWPESHGITDNSVFDPTISPVLE---SMKSTKYEKFFEGEPIWSVYKRKTGKKA 285          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Celegans
Match: C27A7.1 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.1 [Source:UniProtKB/Swiss-Prot;Acc:P90754])

HSP 1 Score: 65.4698 bits (158), Expect = 7.049e-11
Identity = 33/107 (30.84%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLW-VTSKNQGKQS 501
            L++L LDGF  +Y+ +  +   + +   G   +KV P +P+   PN YSI TGL+P  HG+  N V+   +    +   S+      K+ + EP+W V  +  GK++
Sbjct:  168 LVILSLDGFAREYVDRNIVQTLNHIADCGVKADKVYPSYPSKTFPNHYSIVTGLWPESHGITDNSVFDPTISPVLE---SMKSTKYEKFFEGEPIWSVYKRKTGKKA 271          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Celegans
Match: C27A7.1 (Ectonucleotide pyrophosphatase/phosphodiesterase C27A7.1 [Source:UniProtKB/Swiss-Prot;Acc:P90754])

HSP 1 Score: 65.4698 bits (158), Expect = 7.208e-11
Identity = 33/107 (30.84%), Postives = 56/107 (52.34%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLW-VTSKNQGKQS 501
            L++L LDGF  +Y+ +  +   + +   G   +KV P +P+   PN YSI TGL+P  HG+  N V+   +    +   S+      K+ + EP+W V  +  GK++
Sbjct:  177 LVILSLDGFAREYVDRNIVQTLNHIADCGVKADKVYPSYPSKTFPNHYSIVTGLWPESHGITDNSVFDPTISPVLE---SMKSTKYEKFFEGEPIWSVYKRKTGKKA 280          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Zebrafish
Match: enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:NCBI gene;Acc:791915])

HSP 1 Score: 179.489 bits (454), Expect = 1.051e-49
Identity = 119/407 (29.24%), Postives = 203/407 (49.88%), Query Frame = 1
Query:  133 HLMLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKT-DLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            + + +  +  +    +KLL+  +DGFR DY+    +L GF ++ ++G  V+ + P FP+  +PN YS+ TG +   H + GN ++ +  ++EF    +   R    W  +EPLWVT +  GK+ ++Y+ P CE +   + P+ C  Y V +        S++ A+ +L S  A MA +Y + +D   H FGP+S  +    +  +D   Q    L       +    I++V+ SDHGM Q+    + I L+  I  S I +++++G  VS+W K    + +     L++AD   +  +Y    +P+ ++ +  G     L LVAEPG+FI+ N+ + P         + +  GWHGY  E  +M    LA GP  +   +   I   DVY +L   L + P  +NGS
Sbjct:   30 YTLFILLLCRQCDANRKLLVFLIDGFRHDYMDDLHNLPGFREIVENGVKVDYLTPDFPSLSYPNYYSLMTGRHCEVHQMTGNYMWDTDTQKEFLIGTNPDSRLPMWWDGSEPLWVTMQKLGKKVYMYYWPGCEVTILGVRPTFCEEY-VYNPSEKNLTDSMENALNALKSSKADMAGIYYEKIDVEGHHFGPRSPEI-QRAIRSLDQAFQ---ILNQKIREKNMRDTINVVLFSDHGMTQLKWMEKIIELDNYIDMSHIIKMMDRGPVVSLWPKQDKFEEI--YQNLSTAD---NMNVYKKHDIPDRFH-YKNGQFVSTLTLVAEPGWFITENKAKLPFWNNGTEAAEGWQHGWHGYDNEFVDMRGFFLAQGPDFKSNYRAGPIRTVDVYNVLCKTLGMNPLPNNGS 425          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Zebrafish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:ZFIN;Acc:ZDB-GENE-041014-10])

HSP 1 Score: 133.265 bits (334), Expect = 3.747e-33
Identity = 109/389 (28.02%), Postives = 184/389 (47.30%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHK---WVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSG--AASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
             +LLL+  DGFRWDYI +     F  L  +G  VEKV   +    +PN Y++ TGL+   HGV+ N++Y     + F    SI   +V+    W +AEPLWVT++  G++S     P  + +     P+H + Y+   +    F + V++ +    SG  A +  V+Y +  D+  H+ GP+S  L D +L  ID  + +   L            ++L+V SDHGM Q++  + I L+  + R ++   I++   V I  K G L+ V   L+    + + +  +Y    +P+H++      + P ++ V E G+ +  N       +  +  G HGY      M    +A GP  +       +   D+Y L+  IL + P  +NGS
Sbjct:   30 NQLLLVSFDGFRWDYINRVPTPNFHALMDEGVLVEKVENTYITKTYPNHYTLVTGLHAESHGVVANEMYDPIHNRSF----SIEGPEVYDAWWWEEAEPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTHYLRYNASML----FETRVQKLI-DWFSGPEAINFGVLYWEEPDESGHNLGPESP-LMDVVLADIDEKLGF---LREKLKSAGLYDKVNLIVTSDHGMTQLSHDKIIELDTYVSR-DLYTWIDKSPVVGILPKEGKLEEVYGLLK----NANPNMVVYKKEEIPDHYHYRHNARIMPLIIEVKE-GWTVMQNR------NGSFMLGNHGYNNSLPNMHPVFVARGPAFRRDYTKTSMRSVDLYPLMCSILALKPLPNNGS 393          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Zebrafish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:ZFIN;Acc:ZDB-GENE-041014-10])

HSP 1 Score: 133.65 bits (335), Expect = 5.288e-33
Identity = 109/389 (28.02%), Postives = 184/389 (47.30%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHK---WVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSG--AASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
             +LLL+  DGFRWDYI +     F  L  +G  VEKV   +    +PN Y++ TGL+   HGV+ N++Y     + F    SI   +V+    W +AEPLWVT++  G++S     P  + +     P+H + Y+   +    F + V++ +    SG  A +  V+Y +  D+  H+ GP+S  L D +L  ID  + +   L            ++L+V SDHGM Q++  + I L+  + R ++   I++   V I  K G L+ V   L+    + + +  +Y    +P+H++      + P ++ V E G+ +  N       +  +  G HGY      M    +A GP  +       +   D+Y L+  IL + P  +NGS
Sbjct:   82 NQLLLVSFDGFRWDYINRVPTPNFHALMDEGVLVEKVENTYITKTYPNHYTLVTGLHAESHGVVANEMYDPIHNRSF----SIEGPEVYDAWWWEEAEPLWVTNQKAGRKSGAAMWPGSDVAIGGTFPTHYLRYNASML----FETRVQKLI-DWFSGPEAINFGVLYWEEPDESGHNLGPESP-LMDVVLADIDEKLGF---LREKLKSAGLYDKVNLIVTSDHGMTQLSHDKIIELDTYVSR-DLYTWIDKSPVVGILPKEGKLEEVYGLLK----NANPNMVVYKKEEIPDHYHYRHNARIMPLIIEVKE-GWTVMQNR------NGSFMLGNHGYNNSLPNMHPVFVARGPAFRRDYTKTSMRSVDLYPLMCSILALKPLPNNGS 445          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Zebrafish
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:550586])

HSP 1 Score: 115.546 bits (288), Expect = 4.443e-27
Identity = 99/390 (25.38%), Postives = 169/390 (43.33%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAA-SMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSE--IERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S A  LLL+  DGFR DY+ K       K   DG  V ++  VF     PN YS+ TGLY   HG+L + +Y    K+ F   N     D   W +A P+WV+ +  G  +     P  + +      +H + Y         F   +    + + +  +   A +Y +  D   H++GP + T    +L ++D  + +   L+           I++++ SDHGMAQ ++ R I L+  +  S   +  L      + +  K    +++        +    H K Y    +P+  +  +   + P ++LVA+ G+ I  N      GD       HGY      M   L A+GP  + G K+   +  D+Y L+ H++ + P+++NGS
Sbjct:   29 SEAPPLLLVSFDGFRADYLNKYSFPNLEKFFSDGVLVHELTNVFTTKTFPNHYSLVTGLYAESHGMLASIMYDPVAKKHFSIKND---SDPFWWDEATPIWVSVEESGYHAASAMWPGSDVNIQ----NHTLKYTFKYDSRVSFKERLGNITQWMTTDKSLKFASLYWEEPDFSGHTYGPDNTTEMARVLKEVDGHVGY---LMEELDRMELWGKINVIITSDHGMAQCSEERIIRLDDCVSPSSYTLVDLTPVAAIIPLEDKTTVYNNL--------SSCHVHLKAYMKNDVPDRLHYKNNERIQP-IILVADEGWTIVKNGRLPRLGD-------HGYDNTLPSMHPFLAAHGPAFRKGYKMSSFNSVDLYPLMCHLIGIPPKANNGS 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Zebrafish
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:550586])

HSP 1 Score: 115.546 bits (288), Expect = 4.443e-27
Identity = 99/390 (25.38%), Postives = 169/390 (43.33%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAA-SMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSE--IERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S A  LLL+  DGFR DY+ K       K   DG  V ++  VF     PN YS+ TGLY   HG+L + +Y    K+ F   N     D   W +A P+WV+ +  G  +     P  + +      +H + Y         F   +    + + +  +   A +Y +  D   H++GP + T    +L ++D  + +   L+           I++++ SDHGMAQ ++ R I L+  +  S   +  L      + +  K    +++        +    H K Y    +P+  +  +   + P ++LVA+ G+ I  N      GD       HGY      M   L A+GP  + G K+   +  D+Y L+ H++ + P+++NGS
Sbjct:   29 SEAPPLLLVSFDGFRADYLNKYSFPNLEKFFSDGVLVHELTNVFTTKTFPNHYSLVTGLYAESHGMLASIMYDPVAKKHFSIKND---SDPFWWDEATPIWVSVEESGYHAASAMWPGSDVNIQ----NHTLKYTFKYDSRVSFKERLGNITQWMTTDKSLKFASLYWEEPDFSGHTYGPDNTTEMARVLKEVDGHVGY---LMEELDRMELWGKINVIITSDHGMAQCSEERIIRLDDCVSPSSYTLVDLTPVAAIIPLEDKTTVYNNL--------SSCHVHLKAYMKNDVPDRLHYKNNERIQP-IILVADEGWTIVKNGRLPRLGD-------HGYDNTLPSMHPFLAAHGPAFRKGYKMSSFNSVDLYPLMCHLIGIPPKANNGS 392          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Xenopus
Match: enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:NCBI gene;Acc:100422805])

HSP 1 Score: 175.637 bits (444), Expect = 2.313e-48
Identity = 128/403 (31.76%), Postives = 196/403 (48.64%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTD---LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQS---ATLT---DHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S  +KLLL  +DGFR+DYI   +   L GF +  + G  V+   P FP+  +PN YS+ TG +   H + GN ++  K    F+   +   R    W  AEPLWVT +   K+  +Y+ P CE     + P++C  Y   +    EF ++V +A+ SL S  A MA VY + +D   H  GP S    T+T   D +L  +   I+               + +++++ SDHGM  I    + I L+  I   +I ++ ++G  VS+W   G    V  +LR  S     H  +Y    +PE ++   G  ++P L LVAE G+FI   + + P      S +  +  GWHGY  E  +M    LAYGP  +   +   I  TD+Y LL ++L + P  +NGS
Sbjct:   19 SARRKLLLFLIDGFRFDYISDGEIQHLPGFRQFVESGVKVDYTTPDFPSLSYPNYYSLMTGRHCEVHHMTGNFMWDPKKNISFNIGENEDSRLPQWWNGAEPLWVTMEKAKKKVSMYYWPGCEVEILDVKPNYCREYFYYASEA-EFGTAVTDALHSLKSNNAEMAAVYYERIDVEGHHHGPWSEERKTVTRALDQVLWNLHQQIR----------EMELENELNVILFSDHGMTDIFWMDKVIELKNYINMQDIVQMKDRGPVVSLWPAEGKQSIVYEQLRNIS-----HMNVYQKEDIPERFHYKKGKFVAP-LTLVAELGWFIIERKEKLPFWNNGTSTNMAWQHGWHGYDNELMDMRGVFLAYGPDFKVNFRSAPIRATDIYNLLCNVLGIEPLPNNGS 404          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Xenopus
Match: arfip1 (ADP ribosylation factor interacting protein 1 [Source:Xenbase;Acc:XB-GENE-951005])

HSP 1 Score: 139.428 bits (350), Expect = 2.914e-35
Identity = 106/395 (26.84%), Postives = 178/395 (45.06%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASA--------DTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S   +L++L  DGFR DY+ +  +    +  ++G  VE+V  VF     PN YS+ TGLY   HG++ N +Y +  +Q F  ++S    +   W +A P+WVT++ QG +S     P C      ++ +  + Y+ +    +  N+      R   +   + A +Y +  D   H FGP        +L ++D  + +   L++          +++++ SDHGMAQ +K R I         ++   I  G Y  +   P     V   L L+          +   H K+Y    +PE W+      + P LLLVA+ G+ I+ N      GD  YD+  H   P        L A+GP  + G ++  I+  D+Y L+ HIL +    +NG+
Sbjct:   25 SSTPRLIILSFDGFRADYLTRFPMPNLDEFMKEGVQVEEVKNVFITKTFPNHYSLVTGLYAESHGIVANHMYDNDTRQVFHMNDS----NSKWWDEATPIWVTNQKQGHKSGCAMWPGCNVPMHNVTLNASLNYNPNVTFTERVNNVTMWLTRP--NDPINFATIYWEEPDASGHRFGPDDHDNMAKVLKEVDEHVGY---LMSELKKAKLWDTVNVIITSDHGMAQCSKDRII---------KLNDCIGPGNYTLVDDNP-----VAAILPLSDTQLVYDLLRNCHPHMKVYRKEEIPERWHYKHNSRIQP-LLLVADEGWMITQNHSISMLGDHGYDNDLHSMHPF-------LAAHGPAFRKGYRMRTINSVDIYPLMCHILGITGLPNNGT 388          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Xenopus
Match: ENSXETT00000030581.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:36543347:36556401:1 gene:ENSXETG00000003476.1 transcript:ENSXETT00000030581.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 2.673e-25
Identity = 99/428 (23.13%), Postives = 194/428 (45.33%), Query Frame = 1
Query:  118 MRFIWHLMLMFFIFFKLSVAQ-----------KLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAE--PLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCV---PYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKH---RQIYLERLILRSEIER--LINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPG---TKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            M  IW ++++  +F ++++++           KLL++  DGFRW+Y +         L + G   + + P F     P+ ++  TG +   HGV+ N +++ +  ++     +   + + +W D    PLW+T++NQG ++  +H P   + +   +    +   P H DS    E+  ++   ++           +Y    DK  H  GP++    + ++ QID TI +   LL+    N+    +++++ SDHGM  + K     +I L   I   ++ +  +++ GG+  +  K G  + +  +L+ A      H  +Y     PEH++      + P +LL  + GY ++   +       Y + G HG+     +M     A+GP  +        D IH   +Y L+  +L V+P+ HNGS
Sbjct:    1 MDRIWSVLVLLPVFMQIAISKPLSVYRKETTNKLLVISFDGFRWNYDEDVYTPNLDYLTEIGVKAKYISPPFVTMTSPSHFTTITGRWIEDHGVIHNLMFNPETLEKLSFKKT---QTMSEWWDNGVLPLWITAQNQGLKTGSFHYPGGGAKYGEQAVFKSLVEEPDHPDSNET-EWRENIDIVMKWFNEENLDFVTLYYGEPDKTGHLIGPETEKRKE-IIQQIDRTIGY---LLDAIQKNNLKDQLNVIITSDHGMTNVKKQPDVTEIKLADYINFKDLVKFDILDYGGFGMVLPKEGKEEEIYQKLKNAH----PHLNVYKKEEFPEHFHFSKFKRVLP-ILLYGDLGYSVNGRLIL------YVNKGDHGFDNNEMDMKMIFRAFGPDFKKNYISNPFDSIH---IYPLMCKLLGVIPEPHNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Xenopus
Match: ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1 [Source:NCBI gene;Acc:100422807])

HSP 1 Score: 107.457 bits (267), Expect = 9.553e-24
Identity = 97/384 (25.26%), Postives = 169/384 (44.01%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTD--LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            LLL  LDGFR +Y+      L   SKL++ G Y   + PV+P+   PN YSI TGLYP  HG++ N++Y  K    F   N+   +    W   EP+W+T+ NQG ++  +  P  +       P+    Y+  ++  +E   S+   +R           +Y +  D   H  GP S+ +   L+  +D  +     L++G         I+L++ SDHGM +       +L   +  S+   +I           PG           A  + + HFK Y    +P+ ++ F   +    L    +P + ++       S       G+HG     E M +  + +GP  +  T++++    ++Y L+  +LE+VP ++NG+
Sbjct:   75 LLLFSLDGFRSEYLHTWGELLPVISKLQKCGTYTPNLRPVYPSKTFPNHYSIVTGLYPESHGLVDNKMYDPKRNALFTLRNT--EKFHPSWYQGEPVWITAMNQGLKAATFFWPGSDVRIKGTYPNIYKIYN-STVPFEERVMSILRWLRLPEQERPHFYTLYLEEPDHSGHGHGPVSSAVIKALM-GVDRIV---GMLMDGLKQMQLDKCINLILASDHGMEEARCENVAFLSSYLEPSDSYLVI-----------PG----------PACREPNQHFKAYFKQNLPKRFH-FAKNDRIELLNFYTDPKWQVAKTR----SDAKTCVGGFHGSDNRFESMQALFIGFGPGFKFKTEVELFENIEIYNLMCDLLEIVPANNNGT 425          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Xenopus
Match: ENPP1 (ectonucleotide pyrophosphatase/phosphodiesterase 1 [Source:NCBI gene;Acc:100422807])

HSP 1 Score: 105.145 bits (261), Expect = 5.492e-23
Identity = 98/385 (25.45%), Postives = 171/385 (44.42%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTD--LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVH-KWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            LLL  LDGFR +Y+      L   SKL++ G Y   + PV+P+   PN YSI TGLYP  HG++ N++Y  K    F   N+      H  W   EP+W+T+ NQG ++  +  P  +       P+    Y+  ++  +E   S+   +R           +Y +  D   H  GP S+ +   L+  +D  +     L++G         I+L++ SDHGM + A+   +                   ++S + +P   DS   R      + + HFK Y    +P+ ++ F   +    L    +P + ++       S       G+HG     E M +  + +GP  +  T++++    ++Y L+  +LE+VP ++NG+
Sbjct:  143 LLLFSLDGFRSEYLHTWGELLPVISKLQKCGTYTPNLRPVYPSKTFPNHYSIVTGLYPESHGLVDNKMYDPKRNALFTLRNT---EKFHPSWYQGEPVWITAMNQGLKAATFFWPGSDVRIKGTYPNIYKIYN-STVPFEERVMSILRWLRLPEQERPHFYTLYLEEPDHSGHGHGPVSSAVIKALM-GVDRIV---GMLMDGLKQMQLDKCINLILASDHGMEE-ARCENV------------------AFLSSYLEPS--DSYLCR------EPNQHFKAYFKQNLPKRFH-FAKNDRIELLNFYTDPKWQVAKTR----SDAKTCVGGFHGSDNRFESMQALFIGFGPGFKFKTEVELFENIEIYNLMCDLLEIVPANNNGT 487          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Mouse
Match: Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:MGI Symbol;Acc:MGI:2445171])

HSP 1 Score: 175.637 bits (444), Expect = 1.923e-48
Identity = 121/417 (29.02%), Postives = 201/417 (48.20%), Query Frame = 1
Query:  127 IWHLMLMFFI--FFKLSVAQKLLLLFLDGFRWDYIKK---TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDAT----IQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            +W  +L F +   +  S  +KLL+L LDGFR DYI +     L GF ++   G  V+ + P FP+  +PN Y++ TG +   H ++GN ++  +  + FD   +        W  +EPLW+T     ++ ++Y+ P CE     + P++C+ Y      ++ F ++V +A+ SL SG A +A +Y++ +D   H +GP S    D L   +D      IQW+         N        ++ SDHGM  I    + I L   I   +++++ ++G  VS+W  PG    +  +LR     T  H  +Y   ++P  +    G  +SP L LVA+ G+FI+ +    P         + +  GWHGY  E  +M    LA GP  +   +   I   DVY ++ H+  + P  +NGS
Sbjct:    5 LWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYISEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFDIGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKTVPTDIN-FANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALR-AVDTVLKYMIQWIQDRGLQQDLNV-------ILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVVSLWPVPGKHSEIYHKLR-----TVEHMTVYEKESIPNRFYYKKGKFVSP-LTLVADEGWFIAESREMLPFWMNSTGKREGWQRGWHGYDNELMDMRGIFLAIGPDFKSNFRAAPIRSVDVYNIMCHVAGITPLPNNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Mouse
Match: Enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:MGI Symbol;Acc:MGI:2445171])

HSP 1 Score: 156.762 bits (395), Expect = 4.545e-42
Identity = 111/385 (28.83%), Postives = 186/385 (48.31%), Query Frame = 1
Query:  127 IWHLMLMFFI--FFKLSVAQKLLLLFLDGFRWDYIKK---TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLP---QIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQ 1236
            +W  +L F +   +  S  +KLL+L LDGFR DYI +     L GF ++   G  V+ + P FP+  +PN Y++ TG +   H ++GN ++  +  + FD   +        W  +EPLW+T     ++ ++Y+ P CE     + P++C+ Y      ++ F ++V +A+ SL SG A +A +Y++ +D   H +GP S    D L      +   IQW                +++++ SDHGM  I    + I L   I   +++++ ++G  VS+W  PG    +  +LR     T  H  +Y   ++P  +    G  +SP L LVA+ G+FI+ +    P         + +  GWHGY  E  +M    LA GP  Q
Sbjct:    5 LWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYISEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFDIGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKTVPTDIN-FANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALRAVDTVLKYMIQW-------IQDRGLQQDLNVILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVVSLWPVPGKHSEIYHKLR-----TVEHMTVYEKESIPNRFYYKKGKFVSP-LTLVADEGWFIAESREMLPFWMNSTGKREGWQRGWHGYDNELMDMRGIFLAIGPGRQ 375          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Mouse
Match: Enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:2682634])

HSP 1 Score: 144.821 bits (364), Expect = 3.253e-37
Identity = 118/396 (29.80%), Postives = 184/396 (46.46%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYH-VDSMRLDEFNSSV--KEAVRSLMSGAAS------MAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S A +LLL+  DGFR DY+K  DL       ++G  VE V  VF     PN YSI TGLY   HG++ N +Y S  K+ F  SN    +D   W  AEP+WVT++ Q  +          SS   + P   VP H + +     ++SSV  KE + ++ +  +S       A +Y +  D   H +GP+       +L ++D  I     ++           +++++ SDHGMAQ +K+R I L+  I RS    +I+     +I  K    +  +   R      + H  +Y    +P  +       + P ++LVAE G+ I+ N+  F  GD       HGY      M   L A+GP  + G +   I+  D+Y ++ HIL + P  +NG+
Sbjct:   26 SSAPRLLLVSFDGFRADYLKSYDLPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDSVTKKHFSESND---KDPFWWNGAEPIWVTNQLQENR----------SSAAAMWPGTDVPIHNITASYFMNYSSSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGPEDKENMRRVLKEVDDLIG---DIVLKLKVLGLWDSLNVIITSDHGMAQCSKNRLIDLDSCIDRSNYS-VIDLTPVAAILPKINVTEVYDKLKR-----CNPHMNVYLKEAIPNRFYYQHSSRIQP-IILVAEEGWTITLNKSSFKLGD-------HGYDNSLPSMHPFLAAHGPAFRKGYRQSTINTVDIYPMMCHILGLKPHPNNGT 391          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Mouse
Match: Enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:MGI Symbol;Acc:MGI:2682634])

HSP 1 Score: 144.821 bits (364), Expect = 3.253e-37
Identity = 118/396 (29.80%), Postives = 184/396 (46.46%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYH-VDSMRLDEFNSSV--KEAVRSLMSGAAS------MAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S A +LLL+  DGFR DY+K  DL       ++G  VE V  VF     PN YSI TGLY   HG++ N +Y S  K+ F  SN    +D   W  AEP+WVT++ Q  +          SS   + P   VP H + +     ++SSV  KE + ++ +  +S       A +Y +  D   H +GP+       +L ++D  I     ++           +++++ SDHGMAQ +K+R I L+  I RS    +I+     +I  K    +  +   R      + H  +Y    +P  +       + P ++LVAE G+ I+ N+  F  GD       HGY      M   L A+GP  + G +   I+  D+Y ++ HIL + P  +NG+
Sbjct:   26 SSAPRLLLVSFDGFRADYLKSYDLPHLQNFIKEGVLVEHVKNVFITKTFPNHYSIVTGLYEESHGIVANSMYDSVTKKHFSESND---KDPFWWNGAEPIWVTNQLQENR----------SSAAAMWPGTDVPIHNITASYFMNYSSSVSFKERLGNVTTWLSSSNPPVTFAALYWEEPDVSGHKYGPEDKENMRRVLKEVDDLIG---DIVLKLKVLGLWDSLNVIITSDHGMAQCSKNRLIDLDSCIDRSNYS-VIDLTPVAAILPKINVTEVYDKLKR-----CNPHMNVYLKEAIPNRFYYQHSSRIQP-IILVAEEGWTITLNKSSFKLGD-------HGYDNSLPSMHPFLAAHGPAFRKGYRQSTINTVDIYPMMCHILGLKPHPNNGT 391          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Mouse
Match: Enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase 5 [Source:MGI Symbol;Acc:MGI:1933830])

HSP 1 Score: 143.665 bits (361), Expect = 1.061e-36
Identity = 109/387 (28.17%), Postives = 186/387 (48.06%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHK---WVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            QK+L++  DGFRWDY+ K     F  + ++G +V +V  VF    +PN Y++ TGL+  +HG++ N ++   L + F    S+   D++    W +A P+W+T++  G  S     P  +       P++ +PY+ +S+  ++  + + E   +      ++  +Y +  D   H  GP S  L   ++  +D  + +   L+         + ++L+V SDHGM Q +K R I L+R  L  E   LI+     +I  K G  D V      A A    +  +Y    +PE W+      + P ++ VA+ G++I  N+      DD+   G HGY     EM    LA+GP  +     + ++ TD+Y LL H+L +    HNGS
Sbjct:   28 QKVLVVSFDGFRWDYLYKVPTPHFHYIMKNGVHVNQVTNVFITKTYPNHYTLVTGLFAENHGIVANDMFDPILNKSF----SLEHMDIYDSKFWEEATPIWITNQRAGHASGAAMWPGADVKIHDSFPTYYLPYN-ESVSFEDRVAKIIEWFTA--KDPINLGFLYWEEPDDTGHDVGPDSP-LMGSVISDVDHKLGY---LIKMLKRAKLWNNVNLIVTSDHGMTQCSKQRVIELDRY-LDKEHYTLIDHSPVAAILPKEGKFDEV----YDALAGAHPNLTVYKKEEIPERWHYKHNDRVQP-IVAVADEGWYILQNK-----SDDFL-LGNHGYDNALAEMHPIFLAHGPAFRKNFTKEAMNSTDLYSLLCHLLNLTALPHNGS 391          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. UniProt/SwissProt
Match: sp|Q5BKW7|ENPP6_DANRE (Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Danio rerio OX=7955 GN=enpp6 PE=2 SV=1)

HSP 1 Score: 179.489 bits (454), Expect = 3.907e-49
Identity = 119/407 (29.24%), Postives = 205/407 (50.37%), Query Frame = 1
Query:  133 HLMLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKT-DLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDS------GWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            + + +  +  +    +KLL+  +DGFR DY+    +L GF ++ ++G  V+ + P FP+  +PN YS+ TG +   H + GN ++ +  ++EF    +   R    W  +EPLWVT +  GK+ ++Y+ P CE +   + P+ C  Y V +        S++ A+ +L S  A MA +Y + +D   H FGP+S  +    +  +D   Q    L       +    I++V+ SDHGM Q+    + I L+  I  S I +++++G  VS+W K    + +     L++AD   +  +Y    +P+ ++ +  G     L LVAEPG+FI+ N+ + P  ++  ++      GWHGY  E  +M    LA GP  +   +   I   DVY +L   L + P  +NGS
Sbjct:    9 YTLFILLLCRQRDANRKLLVFLIDGFRHDYMDDLHNLPGFREIVENGVKVDYLTPDFPSLSYPNYYSLMTGRHCEVHQMTGNYMWDTDTQKEFLIGTNPDSRLPMWWDGSEPLWVTMQKLGKKVYMYYWPGCEVTILGVRPTFCEEY-VYNPSEKNLTDSMENALNALKSSKADMAGIYYEKIDVEGHHFGPRSPEI-QRAIRSLDQAFQ---ILNQKIREKNMRDTINVVLFSDHGMTQLKWMEKIIELDNYINMSHIIKMMDRGPVVSLWPKQDKFEEI--YQNLSTAD---NMNVYKKHEIPDRFH-YKNGQFVSTLTLVAEPGWFITENKAKLPFWNNGTEAAGGWQHGWHGYDNEFVDMRGSFLAQGPDFKSNYRAGPIRTVDVYNVLCKTLGMNPLPNNGS 404          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. UniProt/SwissProt
Match: sp|Q6DDP3|ENPP6_XENLA (Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Xenopus laevis OX=8355 GN=enpp6 PE=2 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 9.050e-48
Identity = 125/393 (31.81%), Postives = 191/393 (48.60%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYIKKTDLS---GFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            KLLL  +DGFR+DYI   +L    GF  + + G  V+ + P FP+  +PN Y++ TG +   H + GN ++  K    FD   +   R    W  AEPLWVT +   ++  +Y+ P CE     + P++C  Y        EF  SV +A++SL  G A MA VY + +D   H  GP S     ++  ++D  I W   L            +++++ SDHGM  +    + I L+  I   +I ++ ++G  VS+W   G L  V   LR        H  +Y    +PE ++   G  +SP L LVAE G+FI   + + P      S +  +  GWHGY  E  +M    LAYGP  +   +   I  TDVY ++ ++L + P  +NGS
Sbjct:   25 KLLLFLIDGFRFDYISDGELQHLPGFRHMVERGVKVDYMTPAFPSLSYPNYYTLMTGRHCETHHMTGNFMWDPKKNISFDIGANEDSRLPQWWDGAEPLWVTMEKAKRKVSMYYWPGCEVEIRAIKPNYCREYFYYPSEA-EFGKSVTDALQSLTRGNAEMAAVYYERIDVEGHHHGPWSEE-RKNVTRELD-QILW--HLHQQIREMGLESELNVILFSDHGMTDVFWMDKVIELKNYIDMQDIIQMKDRGPVVSLWPAEGKLSKVYEELRAVQ-----HMNVYQKEDIPERFHYKKGTFVSP-LTLVAELGWFIIERKEKLPFWNNGTSINIAWQHGWHGYDNELMDMRGVFLAYGPDFKVNFRSAPIRSTDVYNIMCNVLGIEPLPNNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. UniProt/SwissProt
Match: sp|Q8BGN3|ENPP6_MOUSE (Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Mus musculus OX=10090 GN=Enpp6 PE=1 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 1.345e-47
Identity = 121/417 (29.02%), Postives = 201/417 (48.20%), Query Frame = 1
Query:  127 IWHLMLMFFI--FFKLSVAQKLLLLFLDGFRWDYIKK---TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDAT----IQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            +W  +L F +   +  S  +KLL+L LDGFR DYI +     L GF ++   G  V+ + P FP+  +PN Y++ TG +   H ++GN ++  +  + FD   +        W  +EPLW+T     ++ ++Y+ P CE     + P++C+ Y      ++ F ++V +A+ SL SG A +A +Y++ +D   H +GP S    D L   +D      IQW+         N        ++ SDHGM  I    + I L   I   +++++ ++G  VS+W  PG    +  +LR     T  H  +Y   ++P  +    G  +SP L LVA+ G+FI+ +    P         + +  GWHGY  E  +M    LA GP  +   +   I   DVY ++ H+  + P  +NGS
Sbjct:    5 LWTFLLGFGLSWVWPASAHRKLLVLLLDGFRSDYISEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFDIGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKTVPTDIN-FANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDALR-AVDTVLKYMIQWIQDRGLQQDLNV-------ILFSDHGMTDIFWMDKVIELSNYISLDDLQQVKDRGPVVSLWPVPGKHSEIYHKLR-----TVEHMTVYEKESIPNRFYYKKGKFVSP-LTLVADEGWFIAESREMLPFWMNSTGKREGWQRGWHGYDNELMDMRGIFLAIGPDFKSNFRAAPIRSVDVYNIMCHVAGITPLPNNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. UniProt/SwissProt
Match: sp|B0BND0|ENPP6_RAT (Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Rattus norvegicus OX=10116 GN=Enpp6 PE=1 SV=1)

HSP 1 Score: 174.866 bits (442), Expect = 2.658e-47
Identity = 116/413 (28.09%), Postives = 205/413 (49.64%), Query Frame = 1
Query:  127 IWHLMLMFFI--FFKLSVAQKLLLLFLDGFRWDYIKK---TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            +W  +L+F     +  S  +KLL+L LDGFR DYI +     L GF ++   G  V+ + P FP+  +PN Y++ TG +   H ++GN ++  +  + FD   +        W  +EPLW+T     ++ ++Y+ P CE     + P++C+ Y      ++ F ++V +A+ SL SG A +A +Y++ +D   H +GP S    D L   +D  ++++ + +      +  +    ++ SDHGM  I    + I L + I   +++++ +QG  VS+W  P     +  +LR     T  H  +Y    +P  +    G  +SP L LVA+ G+FI+ +    P         + +  GWHGY  E  +M    LA+GP  +   +   I   DVY ++ +++ + P  +NGS
Sbjct:    5 LWTFLLLFGFSWVWPASAHRKLLVLLLDGFRSDYISEDALASLPGFREIVNRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPRTNKSFDIGVNRDSLMPLWWNGSEPLWITLMKARRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDIN-FANAVSDALDSLKSGRADLAAIYHERIDVEGHHYGPSSPQRKDAL-KAVDTVLKYMTQWIQERGLQNDLNV---ILFSDHGMTDIFWMDKVIELSKYISLDDLQQVKDQGPVVSLWPVPEKHSEIYHKLR-----TVEHMTVYEKEAIPNRFYYKKGKFVSP-LTLVADEGWFIAESREALPFWMNSTGKREGWQHGWHGYDNELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNIMCNVVGITPLPNNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. UniProt/SwissProt
Match: sp|Q6UWR7|ENPP6_HUMAN (Glycerophosphocholine cholinephosphodiesterase ENPP6 OS=Homo sapiens OX=9606 GN=ENPP6 PE=1 SV=2)

HSP 1 Score: 171.785 bits (434), Expect = 3.365e-46
Identity = 112/397 (28.21%), Postives = 194/397 (48.87%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYIKKT---DLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP------SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            S  +KLL+  LDGFR DYI       L GF ++   G  V+ + P FP+  +PN Y++ TG +   H ++GN ++     + FD   +        W  +EPLWVT     ++ ++Y+ P CE     + P++C+ Y      ++ F ++V +A+ S  SG A +A +Y++ +D   H +GP S    D  L  +D  ++++ + +         +    ++ SDHGM  I    + I L + I  ++++++ ++G  VS+W  PG    +  +L      T  H  +Y    +P  +    G  +SP L LVA+ G+FI+ N    P         + +  GWHGY  E  +M    LA+GP  +   +   I   DVY ++ +++ + P  +NGS
Sbjct:   21 SARRKLLVFLLDGFRSDYISDEALESLPGFKEIVSRGVKVDYLTPDFPSLSYPNYYTLMTGRHCEVHQMIGNYMWDPTTNKSFDIGVNKDSLMPLWWNGSEPLWVTLTKAKRKVYMYYWPGCEVEILGVRPTYCLEYKNVPTDIN-FANAVSDALDSFKSGRADLAAIYHERIDVEGHHYGPASPQRKD-ALKAVDTVLKYMTKWIQERGLQDRLNV---IIFSDHGMTDIFWMDKVIELNKYISLNDLQQVKDRGPVVSLWPAPGKHSEIYNKL-----STVEHMTVYEKEAIPSRFYYKKGKFVSP-LTLVADEGWFITENREMLPFWMNSTGRREGWQRGWHGYDNELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGS 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. TrEMBL
Match: A0A1S3H8N6 (ectonucleotide pyrophosphatase/phosphodiesterase family member 6-like OS=Lingula unguis OX=7574 GN=LOC106153109 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 4.900e-58
Identity = 125/393 (31.81%), Postives = 200/393 (50.89%), Query Frame = 1
Query:  166 LSVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIY-LERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFI---SSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQS-HNGS 1329
            + + QKLL+  LDGFRWDY     L GF ++K+ GA    + PVFP+  +PN  S+ TGLY   HG+LGN VY  K  + F       + +   W   EP+W+T++ QG+ S+LY  P CE S   L P+ C+PY      L + + ++KE++R   + +A    +Y +L DK  H FGP +  + + L+ Q+DA   +   L            ++++++SDHGM  ++    +  +   +   ++ER +  G    +W        V     L +   + H+  Y    +P+ W+ +     +P +LLVA+PGY+I   SS  +   S     + GWHGY     +M     AYGP  +PG +  V+   D+YQL+  +L+V P   HNG+
Sbjct:   29 VKIRQKLLVFLLDGFRWDYDDLPGLRGFPRIKEKGASATYLRPVFPSSSYPNYQSLVTGLYVESHGLLGNYVYDPKYAEYFRMGRYPAQYESLWWEGGEPVWITAEKQGRSSYLYFWPGCEVSVGGLRPTFCLPY-TTMPHLGDLDVAIKESLRLFQNESADFIGIYVELPDKFGHKFGPDTQEVQE-LVYQLDARFDY---LHQELEDRFMSDDVNIMLMSDHGMTSVSVPEHVLDIRHHVSYFDLERTVGAGAVTGVWPAQNKTLQV-----LHALSIEEHWSAYLREEIPDRWH-YKHHYRAPPILLVADPGYYILTFSSRSVGVYSDTGLPEQGWHGYDNFDIDMQGIFAAYGPAFRPGAQTTVVEAVDMYQLMCKVLDVTPSPHHNGT 410          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. TrEMBL
Match: C1LJM9 (Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.441e-57
Identity = 131/395 (33.16%), Postives = 205/395 (51.90%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYI-----KKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGN----LSPQLLLVAEPGYFISSNELEFPSGDDYYD----SGWHGYAPEHEEMASPLLAYGPRLQPGTKIDV------IHVTDVYQLLAHI 1296
            S   +LL+L +DG RWD I       T   GF +L++ GAY+E+V PVFPA+C+PNIYS+FTG +P  HGV+        L   F+   +++ + +     AE +W T   Q K   LYHLP C +  D  S  +C PY+   M   + N ++++AV  L +G+A++AVVY D LD++ H +GP S  L    L  +D  + +        +       +++++ SDHGM+ ++   + + +R +  +E+ R++N+G  + IW KP Y  +V    RL S  + + F +Y   T+P HW +    N    L P +LL+A P Y   S    +P    +Y+     G HGY PE  +M  PL  YGP    G +++       IH+  +   LA I
Sbjct:   33 STTSRLLVLLIDGLRWDVIASHLENNTSEFGFKRLQKHGAYLERVTPVFPAECYPNIYSLFTGRHPIDHGVI--------LPTTFNGLTTVNNKPIRS--RAESIWETGVKQNKGVHLYHLPICSAETDSESSWYCEPYNQKFMNPIDLNFTIQKAVTGLQNGSANLAVVYYDELDRIGHRYGPLSDQLIHKHLVYLDHVVNY------MLNIVESIPNLNILLTSDHGMSTVS--HEAHADRYLKGTELSRVLNRGSTLWIWPKPEYEANV--YNRLLSQQSRSPFTVYNVSTIPSHWEIATTNNNSISLFPPILLIASPDYIFEST--VWPLNMSHYNLIKPKGMHGYDPELSDMQIPLFIYGPNSNRGIRLNFTKNIRPIHIHSLIAYLASI 405          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. TrEMBL
Match: A0A1S3I488 (ectonucleotide pyrophosphatase/phosphodiesterase family member 6-like OS=Lingula unguis OX=7574 GN=LOC106160859 PE=4 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.475e-57
Identity = 124/393 (31.55%), Postives = 200/393 (50.89%), Query Frame = 1
Query:  166 LSVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIY-LERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFI---SSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQS-HNGS 1329
            + + QKLL+  LDGFRWDY     L GF ++K+ GA    + PVFP+  +PN  S+ TGLY   HG+LGN VY  K  + F       + +   W   EP+W+T++ QG+ S+LY  P CE S   L P+ C+PY      L + + +++E++R   + +A    +Y +L DK  H FGP +  + + L+ Q+DA   +   L            ++++++SDHGM  ++    +  +   +   ++ER +  G    +W        V     L +   + H+  Y    +P+ W+ +     +P +LLVA+PGY+I   SS  +   S     + GWHGY     +M     AYGP  +PG +  V+   D+YQL+  +L+V P   HNG+
Sbjct:   29 VKIRQKLLVFLLDGFRWDYDDLPGLRGFPRIKEKGASATYLRPVFPSSSYPNYQSLVTGLYVESHGLLGNYVYDPKYAEYFRMGRYPAQYESLWWEGGEPVWITAEKQGRSSYLYFWPGCEVSVGGLRPTFCLPY-TTMPHLGDLDVAIEESLRLFQNESADFIGIYVELPDKFGHKFGPDTQEVQE-LIYQLDARFDY---LHQELEDRFMSDDVNIMLMSDHGMTSVSVPEHVLDIRHHVSYFDLERTVGAGAVTGVWPAQNKTLQV-----LHALSIEEHWSAYLREEIPDRWH-YKHHYRAPPILLVADPGYYILTFSSRSVGVYSDTGLPEQGWHGYDNFDIDMQGIFAAYGPAFRPGAQTTVVEAVDMYQLMCKVLDVTPSPHHNGT 410          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. TrEMBL
Match: A0A4Z2D6H0 (Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 OS=Schistosoma japonicum OX=6182 GN=EWB00_004114 PE=4 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.615e-57
Identity = 131/395 (33.16%), Postives = 205/395 (51.90%), Query Frame = 1
Query:  169 SVAQKLLLLFLDGFRWDYI-----KKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGN----LSPQLLLVAEPGYFISSNELEFPSGDDYYD----SGWHGYAPEHEEMASPLLAYGPRLQPGTKIDV------IHVTDVYQLLAHI 1296
            S   +LL+L +DG RWD I       T   GF +L++ GAY+E+V PVFPA+C+PNIYS+FTG +P  HGV+        L   F+   +++ + +     AE +W T   Q K   LYHLP C +  D  S  +C PY+   M   + N ++++AV  L +G+A++AVVY D LD++ H +GP S  L    L  +D  + +        +       +++++ SDHGM+ ++   + + +R +  +E+ R++N+G  + IW KP Y  +V    RL S  + + F +Y   T+P HW +    N    L P +LL+A P Y   S    +P    +Y+     G HGY PE  +M  PL  YGP    G +++       IH+  +   LA I
Sbjct:   33 STTSRLLVLLIDGLRWDVIASHLENNTSEFGFKRLQKHGAYLERVTPVFPAECYPNIYSLFTGRHPIDHGVI--------LPTTFNGLTTVNNKPIRS--RAESIWETGVKQNKGVHLYHLPICSAETDSESSWYCEPYNQKFMNPIDLNFTIQKAVTGLQNGSANLAVVYYDELDRIGHRYGPLSDQLIHKHLVYLDHVVNY------MLNIVESIPNLNVLLTSDHGMSTVS--HEAHADRYLKGTELSRVLNRGSTLWIWPKPEYEANV--YNRLLSQQSRSPFTVYNVSTIPSHWEIATTNNNSISLFPPILLIASPDYIFEST--VWPLNMSHYNLIKPKGMHGYDPELSDMQIPLFIYGPNSNRGIRLNFTKNIRPIHIHSLIAYLASI 405          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. TrEMBL
Match: A0A267GNW5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033181g2 PE=4 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 7.408e-55
Identity = 134/387 (34.63%), Postives = 203/387 (52.45%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTM-----PEHWNVFDGGNLS---PQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPG-------TKIDVIHVTDVYQLLAHIL 1299
            L +L LDG RWDY   ++L+GFS+L+Q GA V  + PV+P+ C PNIYS+FTG+YP HHG++GN+ Y   L   F+ S+      +H  +  E LW +    G++S LY+LP C  S +   PS C   +     L+E  S++ E  +S+ +G A + V+Y DLLD   H FGP+SAT    LL QID  ++ L      +       G HL+V+ DHGM+ + K  +  L+     S++ R+++ G  V +W  PG   S+ W++         H ++ T   +     P   N  +   +S   P + L+AEPG F+ +    +PS       GWHGY P  ++M + +L  GP +QPG          D +   DVY L+  +L
Sbjct:   42 LFVLLLDGLRWDYPLDSNLTGFSRLRQRGASVLPLRPVYPSLCLPNIYSMFTGVYPHHHGLVGNENYDPSLDAIFNKSSPGLMSLLHTELGVETLWDSLSRVGRRSLLYYLPGCAYSGN-YGPSVCARPYRTMAPLEEVQSALLEGAKSMRNGYADLVVLYVDLLDWGGHRFGPESATNRRRLLRQIDVLVR-LATKQIVDSDWGASAGAHLLVIGDHGMSGVVKADRADLQNFAKHSDVLRVVHVGAAVGVWPVPGKNQSL-WQMMQLMQSQHPHVEVLTDAQLISRFYPRVANQPEQPAVSARLPPISLLAEPGIFVETFHRHYPSYSSGPARGWHGYDPVAKDMHTAVLVAGPLVQPGKFLSNATIGFDAVESLDVYPLMRRLL 425          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Cavefish
Match: enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:NCBI gene;Acc:103026202])

HSP 1 Score: 181.03 bits (458), Expect = 1.389e-50
Identity = 120/392 (30.61%), Postives = 200/392 (51.02%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKK-TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP-----SGD-DYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            +KLL+  +DGFR+DYI +   L GF ++ Q+G  V+ + P FP+  +PN YS+ TG     H ++GN ++     +EF    +   R    W  +EPLW+T +  GK  ++Y+ P CE     + PS C  Y V +        S++ A+  L S  A MA VY + +D   H +GP S  +    +  +D  +Q    L       +  + +++++ SDHGM  I    + I LE  I  S+I +++++G  VS+W K    + +   L++       +  +Y    +P+ ++   G  +SP L LVAEPG+FI+ ++ + P     +G+ D +  GWHGY  E+ +M    LA GP  +   +   I   DVY ++ + L + P  +NGS
Sbjct:   25 RKLLVFLIDGFRYDYIHELQSLPGFREIVQNGVKVDYMTPDFPSLSYPNYYSLMTGRNCEVHQMIGNYMWDKDSLKEFVIGTNPDSRLPMWWNGSEPLWITMQKLGKNVYMYYWPGCEVEILGVRPSFCEEY-VYNPSEKNLTDSIENALNVLKSNKADMAAVYYERIDVEGHHYGPGSQQV-QRAVHGLDVAVQ---TLNRKIKEKNMQNELNVIMFSDHGMTDIKWMEKVIELEAYINMSDIIKMMDRGPVVSVWPKQARFEEIYRALQVVE-----NMNVYRTYEIPDRYHYKAGRFVSP-LTLVAEPGWFIAESKAKLPFWQNGTGEADAWQHGWHGYDNEYVDMRGFFLAQGPDFKRNFQAGPIRAVDVYNIMCNTLGIKPLPNNGS 405          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Cavefish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5-like [Source:NCBI gene;Acc:103037326])

HSP 1 Score: 139.813 bits (351), Expect = 2.391e-35
Identity = 110/387 (28.42%), Postives = 185/387 (47.80%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVD---SMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELE-FPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            KLLL+  DGFRWDY+ +     F  L ++G  VEKV   +     PN Y++ TGL+   HGV+ N++Y   L + F         D   W +A PLWVT++  G++S     P  + +   + P+H VPY+      MR+++  S        L + A    V+Y +  D+  H+ GP+S  L D ++  ID  + +   L      +     I+L+V SDHGM Q+++++ I L+  +   ++   I++   V I  K G  + V   L     + + +  +Y    +P++++      + P +++ A+ G+ I  N  E F  G+  YD+  H   P         +A GP  + G     +   D+Y L+ +IL V P  +NGS
Sbjct:   31 KLLLVSFDGFRWDYVDRVPTPNFHALMEEGVQVEKVENTYITKTLPNHYTLVTGLHAESHGVVANEMYDPVLNRSFSMEGP-EVYDSRWWEEAVPLWVTTQKAGRRSGAAMWPGSDVAIRGVYPTHYVPYNASMPFEMRVEKLISWF------LGTEAIDFGVLYWEEPDETGHNVGPESP-LMDVVIEDIDRKLGF---LREKLKISGLYDKINLIVTSDHGMTQLSRNKIIELDAYV-SQDLYTWIDKSPVVGILPKEGKFEEVYNSLE----NANPNMVVYKKEDIPDYFHYKHNARIMP-IIIEAKEGWTIVKNRTEPFMMGNHGYDNHLHSMHPV-------FVARGPSFRTGYTKTAMRSVDLYPLMCYILGVQPLPNNGS 393          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Cavefish
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5-like [Source:NCBI gene;Acc:111189957])

HSP 1 Score: 139.428 bits (350), Expect = 2.404e-35
Identity = 109/386 (28.24%), Postives = 183/386 (47.41%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVD---SMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            KLLL+  DGFRWDY+ +     F  L ++G  VEKV   +     PN Y++ TGL+   HGV+ N++Y   L + F         D   W +A PLWVT++  G++S     P  + +   + P+H VPY+      MR+++  S        L + A    V+Y +  D+  H+ GP+S  L D ++  ID  + +   L      +     I+L+V SDHGM Q+++++ I L+  +   ++   I++   V I  K G  + V   L     + + +  +Y    +P++++      + P +++ A+ G+ I  N  E       +  G HGY      M    +A GP  + G     +   D+Y L+ +IL V P  +NGS
Sbjct:   31 KLLLVSFDGFRWDYVDRVPTPNFHALMEEGVQVEKVENTYITKTLPNHYTLVTGLHAESHGVVANEMYDPVLNRSFSMEGP-EVYDSRWWEEAVPLWVTTQKAGRRSGAAMWPGSDVAIRGVYPTHYVPYNASMPFEMRVEKLISWF------LGTEAIDFGVLYWEEPDETGHNVGPESP-LMDVVIEDIDRKLGF---LREKLKISGLYDKINLIVTSDHGMTQLSRNKIIELDAYV-SQDLYTWIDKSPVVGILPKEGKFEEVYNSLE----NANPNMVVYKKEDIPDYFHYKHNARIMP-IIIEAKEGWTIVKNRTE------PFMLGNHGYDNHLRSMHPVFVARGPSFRTGYNKTAMRSVDLYPLMCYILGVQPLPNNGS 393          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Cavefish
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:103041977])

HSP 1 Score: 115.931 bits (289), Expect = 2.231e-27
Identity = 101/387 (26.10%), Postives = 170/387 (43.93%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVD---SMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSE--IERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            LLL+  DGFR DY+KK       K    G  ++ +  VF     PN YS+ TGLY   HG+L + ++    K++F   +     D   W +A P+WV+ +  G +S     P  +      + ++ + Y        RL    + + E        +   A +Y +  D   H FGP++ T     L ++D  + +   ++   + +     I++++ SDHGM Q +K R I L++ I RS   +  L      V I       D+ +    L++     H K Y    +P+  +  +   + P ++LVA+ G+ I  N      GD       HGY      M   L A GP  + G +++ I+  D+Y L+ H+L +    +NGS
Sbjct:   33 LLLISFDGFRADYLKKYSFPNLQKFFSAGVLIDHLTNVFVTKTFPNHYSLATGLYAESHGILASHMFDPVTKKKFSLEDDT---DPFWWNEATPIWVSVQKWGYKSAAAMWPGTDVMIQNHTSTNFMKYDSKVSFRERLGNITTWMTE------DNSVKFAALYWEEPDHTGHIFGPENTTEMTRALKEVDDDVGF---MMEHLNNSGLWGKINVIITSDHGMVQCSKDRLIKLDQCISRSSYTLVDLTPVAALVPI------NDATDLYKNLSNC--HPHMKAYLKDAVPDKLHYRNNERIQP-IILVADEGWTIVQNGSLPRLGD-------HGYDNSLSSMHPFLAANGPAFRKGYRMETINSVDLYPLMCHLLGIPEMPNNGS 391          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Cavefish
Match: ENPP7 (ectonucleotide pyrophosphatase/phosphodiesterase family member 7-like [Source:NCBI gene;Acc:103023145])

HSP 1 Score: 104.76 bits (260), Expect = 1.437e-23
Identity = 91/393 (23.16%), Postives = 177/393 (45.04%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVD--AEPLWVTSKNQGKQSFLYHLPTCESSFDPLSP--SHCVPYHVDSMRLDEFNSSVKEAVRS-LMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKH---RQIYLERLI---LRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNG 1326
            K+LL+  DGFRWDY +  D      + +DG     V P F     P  ++I TG Y  +HGV+ N  +++   ++  +  +   + V+ W D    P+W++++ QG  +   H P   S++   S   S   P   +      + ++V + +             +Y    D   H +GP S    + ++ Q+D T+ +   L +    N   + +++++ +DHGM  I ++    +I L ++     +  +  L++ G    +  K G L+ V   L+ A      H  +Y    MP   +  +   + P ++L ++PGY I+     FP      + G HG+  E+ +M     A GP  +   +++     ++Y L+ H+L++ P+ ++G
Sbjct:   32 KVLLVSFDGFRWDYDRDVDTPHLDAMARDGVKAPYVTPAFFTMTSPTHFTILTGKYIENHGVIHNMWFNTITSEKKPYYQT---QFVNDWWDNGTVPIWISAQRQGLTTGSLHFPGTASTYQGESAEVSEVEPRFYNYSNETAWRNNVDKVMGDWFREKDLDFVSLYFGEPDSTGHKYGPDSPQRRE-MVKQVDRTVGY---LRSSAERNGLTNHLNIIITADHGMTTIFRNGLVEEITLSKIKGFSFQDLVFHLVDYGPTGMLLPKEGRLEKVYNALKGAH----PHLHVYKKEEMPSRLHFKNNDRILP-IILWSDPGYVING---YFPV---QVNKGEHGFDNENMDMKPFFRAVGPAFRKNLEVEPFETVNIYPLMCHLLDITPEPNDG 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Sea Lamprey
Match: zgc:153896 (zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119])

HSP 1 Score: 121.709 bits (304), Expect = 2.729e-30
Identity = 98/394 (24.87%), Postives = 175/394 (44.42%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSM--RLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKH---RQIYLERLILRSEIER--LINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTF 1338
            QKLLL+  DGFRWDY +  D      L+  G     ++P F     P+ +++ TG +P  HGV+ N +++ +  ++ +   +  R +   W    P+W+T++NQG ++   H P    ++   +P   V    D     + E+  ++   +   ++       +Y    D   H  GP++      ++ Q+D TI +   L++          +++++ SDHGM    K     +I L + I   E  +  L++ G    +  K G  + V   L+ A      H  +Y     PE ++  +   + P +L+  +PGY ++          D ++ G HGY  E   M +   A+GPR + G   +      VY L+  +L V P+ HNGS  F
Sbjct:   29 QKLLLVSFDGFRWDYDEDVDTPNLDHLRTVGVAARYMVPPFVTITSPSHFTLVTGRHPESHGVIHNMLFNPETGEKANFQKTTLRSEW--WNQTLPIWITAQNQGLKTGSLHFPGGAVNYSGQTPFKSVAEETDHQYNNVTEWRINIGVVMDWFVNDDLEFVALYYGEPDLTGHLSGPETEE-RRAMVRQVDETIGF---LVDAIEKRGLKDTLNVIITSDHGMITTRKAPDIDEIVLSKFIDFKEDLKFDLVDYGPSGMLLPKEGKEEEVYQALKGAH----PHLHVYKKEEFPERFHYRNHERILP-ILVYGDPGYVVNGG-----YASDKFNKGDHGYDNEVPGMRTIFRAFGPRFRRGYAAEPFASVHVYALMCELLGVQPEPHNGSLAF 406          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Sea Lamprey
Match: zgc:153896 (zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119])

HSP 1 Score: 121.324 bits (303), Expect = 4.737e-30
Identity = 101/393 (25.70%), Postives = 181/393 (46.06%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPY-HVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKH---RQIYLERLI-LRSEIE-RLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTF 1338
            QKLLL+  DGFRWDY +  D      L+  GA    ++P F     P+ +++ TG +   HGV+ N +++    ++     +  R +   W    PLW+T++NQG ++     P   +S+   S    V   H +S + D F  +++  +            +Y+   D   H FGP++      ++ Q+D TI +   L++          +++++ SDHGM    K     +I L + I  + +++  L++ G +  +  K G  + V   L+ A      H K+Y     PE++++ D   L P +++  + GY ++   L F      ++ G HG+     +M +   A+GPR + G   +      VY L+  +L V P+ HNGS  F
Sbjct:   25 QKLLLVSFDGFRWDYDEDVDTPNLDHLRTVGATARYMVPPFVTMTSPSHFTLVTGKHVESHGVVHNMLFNPDTGEKQGFQETQLRSEW--WNGTIPLWITAQNQGLKTGSIRFPGGAASYFNQSVYKTVGRDHPNSNKEDWFR-NIQLVMDWFTKDDLDFVTMYHSEPDSTGHKFGPETEE-RRAMVRQVDETIGF---LVDAIEKRGLKDTLNVIITSDHGMTTTRKAPDINEIVLSKFIDFKEDLKFELVDYGAFGMLLPKEGKEEQVYNALKSAH----PHLKVYKREEFPEYFHLRDQSRLLP-IMMYGDLGYLVNG-RLIF-----QFNKGEHGFDNAEPDMWTIFRAFGPRFRRGYAAEPFASVHVYALMCELLGVQPEPHNGSLAF 399          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Sea Lamprey
Match: enpp7.1 (ectonucleotide pyrophosphatase/phosphodiesterase 7, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-040724-13])

HSP 1 Score: 107.071 bits (266), Expect = 4.355e-25
Identity = 95/396 (23.99%), Postives = 174/396 (43.94%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHV--DSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKH---RQIYLERLILRSEIERL--INQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKL--YTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTF 1338
            QKLLL+  DGFRWDY +  D      L+  G   + ++P F     P+ +++ TG +   HG + NQ+Y+    ++  +  +  R +   W +  P+W++++NQG ++   H P   +++   +    +      +     E+  +V   +   +        +Y    D   H FGP S    + +  Q+D T+ +   LL           +++++ SDHGM    K     +I L + I  ++  +L  ++ G +  I  K G  ++V   L+       AH KL  Y     PE +   +   L P +++  + GY ++   +        ++ G HG+     +M +   A+GPR + G   +      VY L+  +L V P+ HNGS  F
Sbjct:   31 QKLLLVSFDGFRWDYDEDVDTPNLDHLRTIGVAAQHMVPPFITITSPSHFTLVTGKHIESHGAVHNQLYNVDPWEKQSYHAAQKRSEW--WNETLPIWISAQNQGLKTGSLHFPGGAATYQGQTVYRSLLEKATYNYSNETEWRLNVDTVMDWFVMDKLDFVALYFGEPDVTGHKFGPHSEERQEKVR-QVDRTVGY---LLRSMEERGLTGNMNVIITSDHGMTPTQKAPAVEEIVLSKFINFTKDVKLAIVDYGPFAMIQPKQGREEAVYRALK------GAHPKLNVYRKEEFPERFRYREHRRLLP-IMMYGDLGYVVNGRMIF------QFNKGEHGFDNAEADMRTIFRAFGPRFRRGYVAEPFASVHVYALMCELLGVQPEPHNGSLAF 407          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Sea Lamprey
Match: ENPP3 (ectonucleotide pyrophosphatase/phosphodiesterase 3 [Source:HGNC Symbol;Acc:HGNC:3358])

HSP 1 Score: 107.842 bits (268), Expect = 1.033e-24
Identity = 96/394 (24.37%), Postives = 169/394 (42.89%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIKKTD--LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSL---MSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKP-----GYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            Q L+L  LDGFR +Y++     +    KL+  G +   +  ++P    PN Y+I TG+YP  HG++ N +Y       F   N        KW   +P+W T   QG +S  Y  P  + + +   P +   Y+ +    D + + +K   + L            +Y D  D   H+FGP S  + +  L  +D  I     L++G         +++++++DHGM +I+  R   L   +  + I   + +G Y  I A+        LD+      L       HFK Y    +P+  +  D   +   + L  E  + ++       S     + G HG+  E   M +  + YGP+ +  T+++     ++Y L+  ILE+ P  +NG+
Sbjct:  135 QPLILFSLDGFRAEYLQTWSALVPNLQKLRSCGTHAPYMRAMYPTKTFPNHYTITTGMYPESHGIVDNNIYDVIFNANFSLGN--EESATSKWWGGQPIWNTVTYQGLKSGTYFWPGSDVAINNTYPDYWAKYNTN----DPYENRIKVVFKWLDLPEDQRPDFYTLYLDQPDGQGHNFGPVSGQVIE-ALQDVDRII---GMLMDGLKQRALHQCVNIMIVADHGMDKISCDRVELLNEYMSLNNI--YVYEGPYGRIRARNIPQDYHKLDNEGIVRNLTCKKEGQHFKPYLKWHLPKRLHYGDSHRIE-TIHLFMERQWQVARQY----SATGRCNGGNHGFDNEFISMQAIFIGYGPKFKNQTEVEAFENIELYNLMCDILEITPSKNNGT 511          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Yeast
Match: NPP1 (Nucleotide pyrophosphatase/phosphodiesterase; mediates extracellular nucleotide phosphate hydrolysis along with Npp2p and Pho5p; activity and expression enhanced during conditions of phosphate starvation; involved in spore wall assembly; NPP1 has a paralog, NPP2, that arose from the whole genome duplication, and an npp1 npp2 double mutant exhibits reduced dityrosine fluorescence relative to the single mutants [Source:SGD;Acc:S000000621])

HSP 1 Score: 85.8853 bits (211), Expect = 4.613e-18
Identity = 107/438 (24.43%), Postives = 179/438 (40.87%), Query Frame = 1
Query:  157 FFKLSVAQKLLLLFLDGFRWDYIKKTD---LSGFSKLKQDGAY----VEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPT----------CESSFDPLSPSHCVPYHVDS--MRLDEFN---------SSVKEAVR-SLMSGAASMAVVYNDLLDKVTHSFG--PQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIY-----LERLILRSEIERLINQGGYVSIWAK-PGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLS-PQLLLVAEPGYFISSNEL---------EFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            FF L++     ++ LDGF    I K +   L    +LK DG         ++P FP +  PN +++ TG YP HHG++ N  +   L +EF H   +  R +    D EP+W T ++       +   T           + + + L P H  P   +      DEFN         S + E V  S ++    + + Y   +D   H  G   +S    +     +     +L +L+      +     +LV++SDHGM+ I     +      L+  + +  +     +G  ++I  K  G ++ V   L+  S D D  + +Y +G  P+ WN  DG N     + +V EPGY +   E          +  + D+ +  G HGY     +M S  +  GP   P   I+    T++Y LL  I  V  +  N +
Sbjct:  166 FFPLTI-----VISLDGFHPSLISKRNTPFLHDLYELKYDGGMNITSTPFMVPSFPTETFPNHWTLVTGQYPIHHGIVSNVFWDPDLNEEF-HPGVLDPR-IWNNNDTEPIWQTVQSAFDGDIPFKAATHMWPGSDVNYTKYNEEKLQPEHKNPIARERTPFYFDEFNAKEPLSQKLSKIIEYVDMSTLNERPQLILGYVPNVDAFGHKHGYPSESEYYYEDFTETLGEVDTFLKQLVESLQERNLTSFTNLVIVSDHGMSDIVVPSNVIIWEDLLDEKLRKDYVSHAYLEGPMMAISLKDSGNINEVYHNLK-TSIDEDK-YTVYVNGNFPKEWNFNDGKNHHMASIWIVPEPGYAVMKKEQLKKVAKGDHKDKNEDNVFTIGSHGYDNNAIDMRSVFIGMGPYF-PQGYIEPFQNTEIYNLLCDICGVAEKDRNSN 593          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Yeast
Match: NPP2 (Nucleotide pyrophosphatase/phosphodiesterase; mediates extracellular nucleotide phosphate hydrolysis along with Npp1p and Pho5p; activity and expression enhanced during conditions of phosphate starvation; involved in spore wall assembly; SWAT-GFP and mCherry fusion proteins localize to the endoplasmic reticulum; NPP2 has a paralog, NPP1, that arose from the whole genome duplication; npp1 npp2 double mutant exhibits reduced dityrosine fluorescence relative to single mutants [Source:SGD;Acc:S000000742])

HSP 1 Score: 48.1358 bits (113), Expect = 2.483e-6
Identity = 77/347 (22.19%), Postives = 142/347 (40.92%), Query Frame = 1
Query:  286 VIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVD-AEPLW--VTSKNQGKQSFLYHL-PTCESSFDPLS--PSHCVPYHVDSM-RLDEFNSSVKEAVRSL----MSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQ-WXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKH---RQIYLERLI----LRSEIERLINQGGYVSIWAKPG-----YLDSVEWRLRLASAD-TDAHFKLYTHGTMPEHWNVFDGGNLSPQ-------LLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEH-EEMASPLLAYGP 1227
            +IP FP    PN +S+ TG YP  HG++ N  + +    EF  +N     D   W + A+P+W  + +++QG+     H+ P  E  ++     P   +P++     + ++    + +  R +    +     + + Y   +D   HSFG     L D  L ++   +  + L L+ G    +     +++++SDHGM+ +  +     +  ER+     + + I  L N+G  + +  K         D +E +L  A  D     F +         W  F   N   +       + ++A+  Y I     + P G      G HGY   +  +MAS  +  GP
Sbjct:  119 MIPSFPTQTFPNHWSMVTGKYPIEHGIVSNIFWDNFTSSEFRPNN----LDARIWSNTADPIWQLLQTESQGEYKVATHMWPGSEVVYEDHGDVPRERMPFYFGKFNQWEKLQDKLAQIFRYIDMPQLKDRPELVISYIPNVDSYGHSFG---YDLRDKRLQKLIGEVDGFFLDLIEGLQKRNLLKISNVMIVSDHGMSNVNANDGEHVVVWERVFPADAMSAFISHLYNEGPMMMVCLKNPRDKQWICDLIEAQLEKAYGDEISRKFHVILKEDFDPSWKYFQYDNRKHRYDDRVGDIWILADEYYAIVKEMGDVPIG----IMGTHGYNFNNCSDMASIFIGMGP 454          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Nematostella
Match: EDO43842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXG6])

HSP 1 Score: 131.724 bits (330), Expect = 1.058e-33
Identity = 114/404 (28.22%), Postives = 180/404 (44.55%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKK--TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCE-------SSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSL--MSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGY-----------LDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            +LL+ LDGFR+DY++K    +     L   G  VE V  V+P    PN YSI TGLYP  HG++ N +Y     + F+ S +    D   W DAEP+WVT++ QG  S + + P  +       + + PL+ S   P+  D   L  +   V   V  L       S   +Y +  D+V H +G   A  T   L ++D TI +L+  L         +    ++ SDHGM     +  I          I+  +N   YV +W+  G            LD +    +     T    K+Y    +P+  +  +   ++  L    + GY+I+++     +  D    G HGY P + EM   L+A+GP  +   K   I + D+Y L+ HI+ + P+ +NGS
Sbjct:    3 VLLVSLDGFRYDYMEKHKDSVPNLRHLASQGTQVEYVKNVYPTVTFPNHYSIVTGLYPESHGIVDNNMYDPVFDEHFNMSTT----DPKWWEDAEPIWVTNQKQGYPSGMCYWPGYDVKIKGYLAHYRPLNASFNKPFVTDENVL-PWPDRVDMVVGWLNQTKDIPSFVTLYFEEPDEVGHRYG-ADAIETAKKLQEVDKTIGYLMEQLKKLTIYPQVNI---IITSDHGMMNYYANTVI---------NIDDYVNPDKYV-MWSSAGTEFQFTNSSLSTLDELYKDFKKMEKGTKGKIKIYKKSEIPDRLHFRNNRRIA-DLAGFVQGGYYINASGYTNFTMRDNETRGTHGYDPINAEMHPFLIAFGPAFKQHYKSGPIDMLDIYSLMCHIIGIHPRPNNGS 386          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Nematostella
Match: EDO48960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI34])

HSP 1 Score: 127.102 bits (318), Expect = 1.270e-31
Identity = 98/398 (24.62%), Postives = 185/398 (46.48%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDE---FNSSVKEAVRSL-MSGAASMAVVYNDLLDKVTHSFGPQSA----------TLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIE--RLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            ++LL  DGFRWDY++KT       + + G   + V  +FP    PN ++I TGLY   HG++ N +Y  +LK  F  +N+    +   W   EP+WVT+++QG  S +   P  E+    + P++        M+ DE   + S V   +++L +   A+    Y +  D   H +GP+S           T+T +L+ Q+                 H    +++++ SDHGM+ I+  + ++LE  I     +   ++  G +  I    G+ +    ++ L   D D H  +Y   ++P+ ++ +        ++++A+ G+ +  N        D+   G HGY+ +++ M +  +A GP  +       ++  D+Y L+  IL++    +NGS
Sbjct:   34 VILLSFDGFRWDYMEKTATPNLDFIAKTGVRAKYVKSIFPTQTFPNHFTIVTGLYAESHGIVANTMYDPELKSWFFMNNT----ETKWWDGGEPVWVTNQHQGGTSAVVFWPGSETVIRGVQPTYF-------MKYDERVTYQSRVDRLMKALDIRKPATFLAAYFEEPDHSGHMYGPESEEVVIAIRKVDTITGYLVKQLQK--------------RHLLEKVNIIITSDHGMSSISSKKLVFLEDYIPPQSYKWINVLQWGAFAQILPMKGWSN----QILLVLKDVD-HLNVYKKSSIPKQYH-YTKNRRIAPIIIIADEGWSVVKNRTV-----DFKGMGNHGYSNKYQSMGAFFVARGPYFKRNYISKPLNNVDIYPLVCDILQIKAAPNNGS 395          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Nematostella
Match: EDO35535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL99])

HSP 1 Score: 122.094 bits (305), Expect = 2.398e-30
Identity = 101/397 (25.44%), Postives = 177/397 (44.58%), Query Frame = 1
Query:  172 VAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVD--AEPLWVTSKNQGKQSFLYHLPTCESSF-------DPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLM-SGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSG-DDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            + Q +LL+ LDGFRWDY+ K        L + G+  + +  VFP   +PN +S+ TGLYP +HG++ N +Y    +  F+    I   +   W +  A+P+W +++ QG +S + + P     F       D L+PS  +     + R+  F+  V+  V+        +   +Y +  D+  H FGP S  + D +  ++D  I    +L+           I+++V +DHGM   +  + I L   +   E + + +    + I  + G L  +        A    H  +Y    +P + + F      P+L L+ E G+ +      +P G       G HGY  ++ +M   L+A GP  + G  +       +Y LL  +L + P+  NGS
Sbjct:   11 LKQTVLLISLDGFRWDYMSKASTPNLDFLVKTGSKAKFIRSVFPTTTYPNHFSLVTGLYPENHGIVANYMYDPVYRGRFN----ISVTNTTWWSEFGAKPIWTSNEEQGGKSGVLYWPGYNVKFGGRYPTLDVLTPSGNIDIGNQTGRVMSFDKRVQTVVKWFSDERPPNFVALYFEEPDETGHKFGPDSEEVRDEIA-RLDGIIG---KLITKLSSKELLDKINIIVTTDHGMTNTSTDKLINLNDYLDPDEYD-IWDASTNIMISPRKGKLQEL-----YTKAKKIPHSTIYKKKDIPPYLH-FGHNRRIPELFLLIEEGWTVK----RWPIGIKPKVPRGNHGYDTQYRDMGGFLVARGPVFRTGHTVGGFDNVHLYPLLCSVLGIQPRPSNGS 388          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Nematostella
Match: EDO49840 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RES2])

HSP 1 Score: 121.709 bits (304), Expect = 3.025e-30
Identity = 102/386 (26.42%), Postives = 183/386 (47.41%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKK--TDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSG-AASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPG-TKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            ++L+   G  W ++    T    F  + Q G   + ++PV P    P   +  TGLYP  HG++ N  +    ++ F HS+     D   + ++EP+W+T + QG+++  Y  P    S+      HC     D    D F++ V + +  + S     +A++Y D  D   H++GP S      ++  ID  +  + RLL+G +     + ++++++SDH + + +  RQI L   I  ++     N+G    +W KPG ++ V   L   S   ++H K+Y     P++W+  +   + P L L  E G+ + ++     +G+  +  G H ++P  +  A    A GP  +   +    +   D+Y LL HIL V P+SHNGS
Sbjct:    1 VILVSFAGLGWQFVGSDLTHTPNFDFIVQSGVKAKNMVPVHPTRTAPIHTTFLTGLYPESHGIVDNMFWDPIYEERFIHSDDCSNFDPKFYNESEPIWLTMQKQGEKTASYFWPGS-YSYKEKPTVHCT---FDWS--DPFSNRVDKVLEWVSSNEPPKLALLYIDEPDWKGHAYGPHSPQYR-QMIEMIDRDV--VGRLLDGLYTAKLLNKVNIILVSDHSLIETSNKRQIRLNDYITSNDYYE--NRGTTEQLWPKPGQMEKV---LNALSTANNSHLKIYKKRDFPDNWHWKNNRRIPP-LYLDVEEGWLMRTDYDA--AGEGEWIEGSHVWSPS-QNSAGIFYARGPFFKANYSSPRSLRAVDLYPLLCHILGVKPRSHNGS 368          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Nematostella
Match: EDO43633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY45])

HSP 1 Score: 123.25 bits (308), Expect = 3.110e-30
Identity = 106/419 (25.30%), Postives = 178/419 (42.48%), Query Frame = 1
Query:  136 LMLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVL-GNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDE-FNSSVK--------EAVRSLMSG--AASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQG-GYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYD--------SGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            L+ +  I   +  +  ++LL  DGFRWD+  K        +   G     V PVFP +  PN YS+ TGLYP  HG+L G  +Y   +K+ F++ N+    D   W   EP+WVT++ QG+ S + + P     FD     H   Y   +M  ++ F +S          + V   ++G    S   +Y +  D  +H FGP S    D ++ QI         L+         + ++LV+  DHG       + + LE        +  I  G   + IW +P    S  +             +++    MPE ++ +     +P ++ + E  +  ++ +       +Y++         G H Y+P    M    LA GP  + G   + + + D+Y LL +IL+V P  +NGS
Sbjct:   18 LLTVILISEAVKNSNTVILLSFDGFRWDFASKAYTPNLDFIAMTGVRAPYVEPVFPVETFPNHYSMVTGLYPESHGILSGCYMYDPVMKESFENMNN---SDSRWWDGGEPVWVTNQKQGRSSGVCNFP----GFDVKIRGHFPTYSTSNMGFNKPFLTSTNIMTFKQQIDVVMDWLTGLDPPSFVAIYFNQPDMTSHGFGPNS----DQVIEQIKRCDNITGYLIMRLLEKRLFNSVNLVLTGDHGQTDYNTTKFLNLENYF---SAQYYIKYGVNTLHIWPRPNVTKSFVYENFKRIEYETKLLRVFKTEEMPEAYH-YKNNRRAPPIIAIMEEHWVANTTKFW-----EYWNRQHRNERLRGDHNYSPFIPSMRPFFLARGPNFKEGFVSEPLKMVDIYPLLCNILDVAPAPNNGS 416          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Medaka
Match: enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:NCBI gene;Acc:101154765])

HSP 1 Score: 187.193 bits (474), Expect = 1.221e-52
Identity = 121/393 (30.79%), Postives = 195/393 (49.62%), Query Frame = 1
Query:  172 VAQKLLLLFLDGFRWDYIKKTD-LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP-----SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
             A+ LL+  +DGFR+DY+     L GF  L + G  V+ + P FP+  +PN Y++ TG +   H + GN ++    ++EF    +   R    W  +EPLWVT +  GK+ F+Y+ P CE     + P+ C  Y  +    +  + S+ +A+  L SG A MA VY + +D   H FGP S  +    + Q+D  +Q            +    +++++ SDHGM +I    + I L++ I   +I +++++G  VS+W K      V      A+     + ++Y    +PE ++ + GG     L LVA+PG+FIS N+ + P     S    + +GWHGY  E  +M    LA GP  +   +   I   DVY L+   L V P  +NGS
Sbjct:   42 AARPLLVFLIDGFRYDYLDDLQALPGFRALVERGVKVDYMTPDFPSLSYPNYYTLMTGRHCNSHQMTGNYMWDQSSQKEFLIGTNDDSRLPLWWDGSEPLWVTLQKLGKKVFMYYWPGCEVEILGVRPAFCKEYIYNPTE-ENLSESITQALDVLRSGRADMAAVYYEKVDVEGHHFGPDSQQIRS-TVQQLDVVMQ---MFNRKMKELNMEEQLNVLLFSDHGMTKIQWMEKVIELDKFIAMEDILKMMDRGAVVSLWPKNSKYQEVH-----AALSRVPNMRVYGQQEVPERFH-YRGGRFVSPLTLVADPGWFISENKAKLPFWKNGSESSGWQNGWHGYDNELVDMRGFFLAAGPDFKQHVQAAPIRAVDVYNLMCWTLGVKPLPNNGS 423          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Medaka
Match: enpp6 (ectonucleotide pyrophosphatase/phosphodiesterase 6 [Source:NCBI gene;Acc:101154765])

HSP 1 Score: 186.808 bits (473), Expect = 1.320e-52
Identity = 121/393 (30.79%), Postives = 195/393 (49.62%), Query Frame = 1
Query:  172 VAQKLLLLFLDGFRWDYIKKTD-LSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIA-KHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFP-----SGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
             A+ LL+  +DGFR+DY+     L GF  L + G  V+ + P FP+  +PN Y++ TG +   H + GN ++    ++EF    +   R    W  +EPLWVT +  GK+ F+Y+ P CE     + P+ C  Y  +    +  + S+ +A+  L SG A MA VY + +D   H FGP S  +    + Q+D  +Q            +    +++++ SDHGM +I    + I L++ I   +I +++++G  VS+W K      V      A+     + ++Y    +PE ++ + GG     L LVA+PG+FIS N+ + P     S    + +GWHGY  E  +M    LA GP  +   +   I   DVY L+   L V P  +NGS
Sbjct:   23 AARPLLVFLIDGFRYDYLDDLQALPGFRALVERGVKVDYMTPDFPSLSYPNYYTLMTGRHCNSHQMTGNYMWDQSSQKEFLIGTNDDSRLPLWWDGSEPLWVTLQKLGKKVFMYYWPGCEVEILGVRPAFCKEYIYNPTE-ENLSESITQALDVLRSGRADMAAVYYEKVDVEGHHFGPDSQQIRS-TVQQLDVVMQ---MFNRKMKELNMEEQLNVLLFSDHGMTKIQWMEKVIELDKFIAMEDILKMMDRGAVVSLWPKNSKYQEVH-----AALSRVPNMRVYGQQEVPERFH-YRGGRFVSPLTLVADPGWFISENKAKLPFWKNGSESSGWQNGWHGYDNELVDMRGFFLAAGPDFKQHVQAAPIRAVDVYNLMCWTLGVKPLPNNGS 404          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Medaka
Match: enpp5 (ectonucleotide pyrophosphatase/phosphodiesterase family member 5 [Source:NCBI gene;Acc:101174878])

HSP 1 Score: 132.109 bits (331), Expect = 1.090e-32
Identity = 113/384 (29.43%), Postives = 175/384 (45.57%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFD-HSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            KLLL+  DGFRWDYI +     F  +  +G  VE V  ++     PN  ++ TGLY   HG++ N++Y   L Q F   ++SI+  D   W  A PLWV+ +  G +S     P  +       PS  + Y+  S+  +     + E   +    A    V+Y +  D+  H+ GPQS  L D ++  ID  + +   LLN    +     ++L+V SDHGMAQ+   + I L+  + R +    +++   V I  K G L+ V   L     D + +   Y    +PE  +      + P +LL A+ G+ I  N  E      ++  G HGY      M    +A GP  Q       +   D+Y L+ HIL + P  +NGS
Sbjct:   40 KLLLVSFDGFRWDYIDRVPTPNFRSIMDEGVKVENVENIYITKTLPNHLTLVTGLYAETHGIVANEMYDPILNQSFSMETDSIY--DSRWWEQAVPLWVSVQKAGGRSGAAMWPGSDVKIHGTYPSQYLEYN-SSVSFETRVQKIIEWFSAPEEEAVDFGVLYWEEPDESGHTLGPQSP-LMDAVIAGIDEKLGF---LLNELKRSGLDEKVNLIVTSDHGMAQLYPEKIIELDEYVER-DTYSWVDKSPVVGILPKEGKLEEVYSLL----VDANPNMVAYRKEHIPERLHYQHNVRIMP-ILLEAKEGWTIMQNRTE------HFMLGNHGYDNTLRNMQPIFVARGPGFQQNYVKSSMRSVDLYPLMCHILSIRPLPNNGS 404          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Medaka
Match: ENSORLT00000000921.2 (venom phosphodiesterase 1-like [Source:NCBI gene;Acc:101171013])

HSP 1 Score: 129.028 bits (323), Expect = 7.666e-31
Identity = 106/388 (27.32%), Postives = 186/388 (47.94%), Query Frame = 1
Query:  178 QKLLLLFLDGFRWDYIK--KTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAK--PGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            Q LLL+ LDG R +Y++   T +   +K++  G     + P FP+   PN Y+I TGLYP  +G++ N +Y       F  SNS   ++   W   +P+W T+KNQG +S  +  P  +   +   P+   PY  D +  +E   +V + ++   +       +Y +  DK  HSFGP S  +   L   +D  I    +L+NG         +++V+L+DHGM +I+  R+  ++ L + + +  ++ +G +  I AK     LDS      ++    D     Y    +P+ ++  D   +    +LV EP +    N    P    +   G HGY  + + M +  L+YGP+ Q  T+++     ++Y L+  +LE+ P  +NG+
Sbjct:  155 QPLLLVSLDGLRAEYMQTWNTVMPVLNKIRTCGTSASYMQPAFPSKTFPNHYTIVTGLYPESNGLIDNTMYDPVFNATFSLSNS--EKNNPDWYLGQPVWHTAKNQGLKSGTFFWPGSDVEINGSFPNIYKPYDGD-VPFEERVLTVLKWLQLPDNERPDFYTLYLEEPDKSGHSFGPVSGGIIISLQ-GVDKII---GQLMNGLKQIGLDRCLNIVILADHGMEEISCDRKEAMQDLGVDTSL-YVVTEGPFGRIRAKNVDTVLDSAALVASMSCKKPDQKITPYLKAHLPKRFHYADSRRIEDVNVLV-EPKWLFERN----PGSLTFCFGGNHGYDNDADSMHALFLSYGPKFQFRTEVEPFSSIELYNLMCDVLEITPSENNGT 529          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Medaka
Match: enpp4 (ectonucleotide pyrophosphatase/phosphodiesterase 4 [Source:NCBI gene;Acc:101168684])

HSP 1 Score: 120.168 bits (300), Expect = 1.768e-28
Identity = 100/391 (25.58%), Postives = 168/391 (42.97%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLE--------RLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPS-GDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGS 1329
            LLL+  DGFR DY+ +  +     L  +G  VE++  VF     PN YS+ TGL+   HG+L + ++     + F+  N     D   W +AEPLW+T+ + G ++     P  +      + +H  PY+ D    +   +     + +          +Y +  D+  H FGP + T    +L ++D  I     L++          ++L++ SDHGMAQ +  R I L+         L+  + +  LI  G   +++      D ++            H   Y    +P+  +  +   + P LLL+A+ G+ I     + P  GD  YD+  H   P        L A GP    G ++  +   DVY L+  +L V P  +NGS
Sbjct:   90 LLLVSFDGFRADYLNRFPMQNLKLLYSEGVLVEELTNVFITKTFPNHYSLVTGLFAESHGILASNMFDPISHKHFNIKNDT---DPAWWSEAEPLWLTALDSGYKTAAVMWPGSDVLIGNRTATHFFPYNSDITFQERLGNVTSWMLGNGTEPGVMFTALYWEEPDRSGHFFGPDNTTAMAKVLKEVDDNIG---LLVSELKRTGLWGHVNLIITSDHGMAQCSNDRLIRLDDCLHPDNYTLVDLTPVAALIPNGDPEAVF------DLLK--------KCHPHMTAYLKKAIPDRLHYRNNERIQP-LLLIADEGWTIVQRGNKLPRMGDHGYDNSLHSMHPF-------LAAVGPSFHKGVQMKSLQSVDVYPLMCSLLSVPPGPNNGS 452          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Planmine SMEST
Match: SMESG000040292.1 (SMESG000040292.1)

HSP 1 Score: 815.453 bits (2105), Expect = 0.000e+0
Identity = 429/431 (99.54%), Postives = 429/431 (99.54%), Query Frame = 1
Query:  139 MLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTFXXXXXXXXXXXXXRQGLEPLNMATSKNRYEQ 1431
            MLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDL GFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWLLRLLNGNHGNHG HGIHLVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTFLSSLMLLQQPSPSRQGLEPLNMATSKNRYEQ
Sbjct:    1 MLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDLIGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWLLRLLNGNHGNHGSHGIHLVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTFLSSLMLLQQPSPSRQGLEPLNMATSKNRYEQ 431          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Planmine SMEST
Match: SMESG000040292.1 (SMESG000040292.1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 427/429 (99.53%), Postives = 427/429 (99.53%), Query Frame = 1
Query:  145 MFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTFXXXXXXXXXXXXXRQGLEPLNMATSKNRYEQ 1431
            MFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDL GFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWLLRLLNGNHGNHG HGIHLVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTFLSSLMLLQQPSPSRQGLEPLNMATSKNRYEQ
Sbjct:    1 MFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDLIGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVPYHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWLLRLLNGNHGNHGSHGIHLVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTFLSSLMLLQQPSPSRQGLEPLNMATSKNRYEQ 429          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Planmine SMEST
Match: SMESG000023331.1 (SMESG000023331.1)

HSP 1 Score: 106.301 bits (264), Expect = 3.677e-24
Identity = 93/404 (23.02%), Postives = 185/404 (45.79%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYI-----KKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDA--EPLWVTS-KNQGKQSFLYHLPTCESSFDPLSPSHCVPYHV---DSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKP-GYL---DSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYY---DSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTF 1338
            +++L+ LD FR DY+     +  +L+    ++++GA V+K+ PVFP+   PN  ++ TGL+  +HG+  N    S    +     +    +  +W     +P+WVT  K++  +S     P  ++  +   P   V  +    +   +  ++  V E +  +        ++Y D  D  +H +GP      ++ L +I     W+ RLL G         + ++V +DHGM  + + R I         +I+++++   Y S ++ P G +   +  E ++     +   + +++    +P+ +N     N    ++ + + G+ ++S+         YY     G HGY+   ++M +  LAYGP  +    ID ++  DVY L+ H+L + P  +NGSS  
Sbjct:   41 RMILVVLDAFRHDYLEIAESRGINLTALKTIEKNGARVKKMTPVFPSVTMPNHQTLVTGLFSSYHGITYNTFNDSSFNYDRFAMQNQTSLNEERWYKGYPDPIWVTCEKHKFCKSGSMLWPNTDAIVNGYRPFRKVDQYYALNEKPYIYPYDRRVDEVLEWVKQDLVDFTLLYFDEPDATSHKYGPTH----ENTLNKIGEMDTWINRLLKGIENLGLKSHVDVIVTADHGMTDLNQSRVI---------DIDKVVDPKLYKSTYSYPIGIIYPNEGEEEKVYQLYKNASKNIEVFWRNEIPDQYNYKGNPNRISPIVTIVKNGWVVNSSH--------YYVKMKGGNHGYSQFEDDMKAMFLAYGPSFK-HVSIDSVNNVDVYPLMMHLLGMKPNPNNGSSNL 422          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Planmine SMEST
Match: SMESG000023331.1 (SMESG000023331.1)

HSP 1 Score: 106.301 bits (264), Expect = 4.345e-24
Identity = 93/404 (23.02%), Postives = 185/404 (45.79%), Query Frame = 1
Query:  181 KLLLLFLDGFRWDYI-----KKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDA--EPLWVTS-KNQGKQSFLYHLPTCESSFDPLSPSHCVPYHV---DSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKP-GYL---DSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYY---DSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTF 1338
            +++L+ LD FR DY+     +  +L+    ++++GA V+K+ PVFP+   PN  ++ TGL+  +HG+  N    S    +     +    +  +W     +P+WVT  K++  +S     P  ++  +   P   V  +    +   +  ++  V E +  +        ++Y D  D  +H +GP      ++ L +I     W+ RLL G         + ++V +DHGM  + + R I         +I+++++   Y S ++ P G +   +  E ++     +   + +++    +P+ +N     N    ++ + + G+ ++S+         YY     G HGY+   ++M +  LAYGP  +    ID ++  DVY L+ H+L + P  +NGSS  
Sbjct:   41 RMILVVLDAFRHDYLEIAESRGINLTALKTIEKNGARVKKMTPVFPSVTMPNHQTLVTGLFSSYHGITYNTFNDSSFNYDRFAMQNQTSLNEERWYKGYPDPIWVTCEKHKFCKSGSMLWPNTDAIVNGYRPFRKVDQYYALNEKPYIYPYDRRVDEVLEWVKQDLVDFTLLYFDEPDATSHKYGPTH----ENTLNKIGEMDTWINRLLKGIENLGLKSHVDVIVTADHGMTDLNQSRVI---------DIDKVVDPKLYKSTYSYPIGIIYPNEGEEEKVYQLYKNASKNIEVFWRNEIPDQYNYKGNPNRISPIVTIVKNGWVVNSSH--------YYVKMKGGNHGYSQFEDDMKAMFLAYGPSFK-HVSIDSVNNVDVYPLMMHLLGMKPNPNNGSSNL 422          
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Planmine SMEST
Match: SMESG000023331.1 (SMESG000023331.1)

HSP 1 Score: 105.531 bits (262), Expect = 5.814e-24
Identity = 93/403 (23.08%), Postives = 184/403 (45.66%), Query Frame = 1
Query:  184 LLLLFLDGFRWDYI-----KKTDLSGFSKLKQDGAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHSNSIHRRDVHKWVDA--EPLWVTS-KNQGKQSFLYHLPTCESSFDPLSPSHCVPYHV---DSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSATLTDHLLPQIDATIQWXXXXXXXXXXXXXXXXXXXVVLSDHGMAQIAKHRQIYLERLILRSEIERLINQGGYVSIWAKP-GYL---DSVEWRLRLASADTDAHFKLYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYY---DSGWHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQSHNGSSTF 1338
            ++L+ LD FR DY+     +  +L+    ++++GA V+K+ PVFP+   PN  ++ TGL+  +HG+  N    S    +     +    +  +W     +P+WVT  K++  +S     P  ++  +   P   V  +    +   +  ++  V E +  +        ++Y D  D  +H +GP      ++ L +I     W+ RLL G         + ++V +DHGM  + + R I         +I+++++   Y S ++ P G +   +  E ++     +   + +++    +P+ +N     N    ++ + + G+ ++S+         YY     G HGY+   ++M +  LAYGP  +    ID ++  DVY L+ H+L + P  +NGSS  
Sbjct:    1 MILVVLDAFRHDYLEIAESRGINLTALKTIEKNGARVKKMTPVFPSVTMPNHQTLVTGLFSSYHGITYNTFNDSSFNYDRFAMQNQTSLNEERWYKGYPDPIWVTCEKHKFCKSGSMLWPNTDAIVNGYRPFRKVDQYYALNEKPYIYPYDRRVDEVLEWVKQDLVDFTLLYFDEPDATSHKYGPTH----ENTLNKIGEMDTWINRLLKGIENLGLKSHVDVIVTADHGMTDLNQSRVI---------DIDKVVDPKLYKSTYSYPIGIIYPNEGEEEKVYQLYKNASKNIEVFWRNEIPDQYNYKGNPNRISPIVTIVKNGWVVNSSH--------YYVKMKGGNHGYSQFEDDMKAMFLAYGPSFK-HVSIDSVNNVDVYPLMMHLLGMKPNPNNGSSNL 381          
The following BLAST results are available for this feature:
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENPP67.007e-4728.21ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
ENPP54.053e-3628.47ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP54.053e-3628.47ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENPP44.221e-3229.04ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
ENPP11.101e-2827.13ectonucleotide pyrophosphatase/phosphodiesterase 1... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F13H10.57.523e-2221.82pep chromosome:WBcel235:IV:10990999:10994137:1 gen... [more]
T03G6.31.697e-2022.73pep chromosome:WBcel235:X:2610826:2615726:-1 gene:... [more]
C27A7.16.922e-1130.84Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
C27A7.17.049e-1130.84Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
C27A7.17.208e-1130.84Ectonucleotide pyrophosphatase/phosphodiesterase C... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp61.051e-4929.24ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
enpp53.747e-3328.02ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
enpp55.288e-3328.02ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
enpp44.443e-2725.38ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
enpp44.443e-2725.38ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp62.313e-4831.76ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
arfip12.914e-3526.84ADP ribosylation factor interacting protein 1 [Sou... [more]
ENSXETT00000030581.12.673e-2523.13pep primary_assembly:Xenopus_tropicalis_v9.1:9:365... [more]
ENPP19.553e-2425.26ectonucleotide pyrophosphatase/phosphodiesterase 1... [more]
ENPP15.492e-2325.45ectonucleotide pyrophosphatase/phosphodiesterase 1... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Enpp61.923e-4829.02ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
Enpp64.545e-4228.83ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
Enpp43.253e-3729.80ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
Enpp43.253e-3729.80ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
Enpp51.061e-3628.17ectonucleotide pyrophosphatase/phosphodiesterase 5... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5BKW7|ENPP6_DANRE3.907e-4929.24Glycerophosphocholine cholinephosphodiesterase ENP... [more]
sp|Q6DDP3|ENPP6_XENLA9.050e-4831.81Glycerophosphocholine cholinephosphodiesterase ENP... [more]
sp|Q8BGN3|ENPP6_MOUSE1.345e-4729.02Glycerophosphocholine cholinephosphodiesterase ENP... [more]
sp|B0BND0|ENPP6_RAT2.658e-4728.09Glycerophosphocholine cholinephosphodiesterase ENP... [more]
sp|Q6UWR7|ENPP6_HUMAN3.365e-4628.21Glycerophosphocholine cholinephosphodiesterase ENP... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3H8N64.900e-5831.81ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
C1LJM91.441e-5733.16Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
A0A1S3I4881.475e-5731.55ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
A0A4Z2D6H01.615e-5733.16Ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
A0A267GNW57.408e-5534.63Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp61.389e-5030.61ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
enpp52.391e-3528.42ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
enpp52.404e-3528.24ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
enpp42.231e-2726.10ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
ENPP71.437e-2323.16ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zgc:1538962.729e-3024.87zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119][more]
zgc:1538964.737e-3025.70zgc:153896 [Source:ZFIN;Acc:ZDB-GENE-060825-119][more]
enpp7.14.355e-2523.99ectonucleotide pyrophosphatase/phosphodiesterase 7... [more]
ENPP31.033e-2424.37ectonucleotide pyrophosphatase/phosphodiesterase 3... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NPP14.613e-1824.43Nucleotide pyrophosphatase/phosphodiesterase; medi... [more]
NPP22.483e-622.19Nucleotide pyrophosphatase/phosphodiesterase; medi... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438421.058e-3328.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489601.270e-3124.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355352.398e-3025.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498403.025e-3026.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436333.110e-3025.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
enpp61.221e-5230.79ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
enpp61.320e-5230.79ectonucleotide pyrophosphatase/phosphodiesterase 6... [more]
enpp51.090e-3229.43ectonucleotide pyrophosphatase/phosphodiesterase f... [more]
ENSORLT00000000921.27.666e-3127.32venom phosphodiesterase 1-like [Source:NCBI gene;A... [more]
enpp41.768e-2825.58ectonucleotide pyrophosphatase/phosphodiesterase 4... [more]
back to top
BLAST of Ectonucleotide pyrophosphatase/phosphodiesterase family member 6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000040292.10.000e+099.54SMESG000040292.1[more]
SMESG000040292.10.000e+099.53SMESG000040292.1[more]
SMESG000023331.13.677e-2423.02SMESG000023331.1[more]
SMESG000023331.14.345e-2423.02SMESG000023331.1[more]
SMESG000023331.15.814e-2423.08SMESG000023331.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026121 ID=SMED30026121|Name=Ectonucleotide pyrophosphatase/phosphodiesterase family member 6|organism=Schmidtea mediterranea sexual|type=transcript|length=1718bp
CTTGACAACAATTTCTGCAACAAATTTCTTTAAGTGCATCAAACAACAAA
ATCCTTTACAGATTATTTTGAAAATTAGTTTTTGCACGCACAAAGATTTC
AAATTTACTGGAAGAACATGAGATTTATTTGGCATTTAATGTTGATGTTT
TTTATTTTTTTTAAATTATCGGTTGCTCAAAAACTTTTACTATTATTTTT
GGATGGTTTCCGATGGGATTATATTAAAAAAACAGATCTGAGTGGATTTT
CCAAATTAAAGCAAGATGGCGCATATGTTGAGAAAGTGATCCCGGTCTTT
CCAGCAGATTGCCATCCAAATATCTATTCTATATTCACAGGTCTGTATCC
TCGGCACCACGGGGTGTTGGGCAATCAGGTTTATTCCAGTAAATTGAAAC
AGGAATTCGATCACTCGAATTCAATTCATCGTCGTGACGTGCATAAATGG
GTAGATGCAGAACCGCTGTGGGTTACGTCAAAAAATCAAGGCAAACAATC
GTTTCTTTATCATTTGCCGACTTGCGAATCAAGTTTCGATCCGTTGTCTC
CGTCACATTGTGTTCCGTATCATGTCGATTCGATGAGACTCGATGAGTTC
AATTCATCAGTGAAGGAGGCAGTGCGGTCATTGATGTCGGGTGCAGCTAG
CATGGCAGTGGTCTACAACGATCTATTGGACAAGGTGACCCACTCGTTCG
GACCGCAATCGGCCACCCTCACCGACCATTTGCTGCCTCAGATCGATGCA
ACCATCCAATGGCTGCTGAGGCTCCTCAATGGCAACCATGGCAACCACGG
TGGCCATGGCATCCATCTAGTGGTTCTGTCTGATCACGGAATGGCACAGA
TTGCCAAGCACCGACAGATATATCTCGAGCGTCTCATCCTGCGCAGTGAG
ATTGAGCGTCTCATTAATCAAGGCGGCTACGTGAGCATCTGGGCCAAGCC
CGGATATCTGGATAGCGTCGAATGGCGGCTCCGACTGGCTAGTGCAGATA
CCGATGCTCACTTCAAGCTGTACACTCACGGAACGATGCCGGAACATTGG
AACGTGTTTGATGGTGGTAATTTGTCCCCGCAGCTGCTTTTGGTCGCTGA
GCCTGGCTATTTTATCTCCTCTAATGAATTGGAGTTTCCCAGCGGCGATG
ATTACTACGACAGCGGGTGGCACGGATACGCACCGGAACATGAAGAAATG
GCGAGCCCATTGTTGGCGTACGGGCCGCGCTTGCAACCGGGCACTAAAAT
CGATGTCATTCACGTTACGGATGTTTATCAATTGCTCGCTCACATCCTCG
AGGTCGTTCCACAATCTCACAACGGCTCCTCGACATTCCTGTCGTCACTT
ATGCTGCTCCAGCAGCCGTCACCATCGCGACAAGGGTTGGAACCGCTGAA
CATGGCAACCAGCAAAAATCGATATGAGCAGCTGCTGCTGATGGTGCTGT
TGCCAGTTTCACTCGTGACATCCCCGATGTTGTGATATCTCATGACCTCT
AGGCATGGAATTGTCTTTCTCTCCACCGATTGGTTGCTAAGCGCAGTGCG
GGTGAATGCACGTTACCTATTGTTATTATTATTATTGATTATTGATTATA
GCTATATTGATTAGGAGTAGTGCTGTCATTCGTTGGCTTGTTTGCTGTGC
ATTTATTGATTACGAGTCCGGCTTTGATAGGATTAATAAATTTCACTGTT
TGTCTTGTTCAAAAAAAA
back to top

protein sequence of SMED30026121-orf-1

>SMED30026121-orf-1 ID=SMED30026121-orf-1|Name=SMED30026121-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=456bp
MRFIWHLMLMFFIFFKLSVAQKLLLLFLDGFRWDYIKKTDLSGFSKLKQD
GAYVEKVIPVFPADCHPNIYSIFTGLYPRHHGVLGNQVYSSKLKQEFDHS
NSIHRRDVHKWVDAEPLWVTSKNQGKQSFLYHLPTCESSFDPLSPSHCVP
YHVDSMRLDEFNSSVKEAVRSLMSGAASMAVVYNDLLDKVTHSFGPQSAT
LTDHLLPQIDATIQWLLRLLNGNHGNHGGHGIHLVVLSDHGMAQIAKHRQ
IYLERLILRSEIERLINQGGYVSIWAKPGYLDSVEWRLRLASADTDAHFK
LYTHGTMPEHWNVFDGGNLSPQLLLVAEPGYFISSNELEFPSGDDYYDSG
WHGYAPEHEEMASPLLAYGPRLQPGTKIDVIHVTDVYQLLAHILEVVPQS
HNGSSTFLSSLMLLQQPSPSRQGLEPLNMATSKNRYEQLLLMVLLPVSLV
TSPML*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR017849Alkaline_Pase-like_a/b/a
IPR002591Phosphodiest/P_Trfase
IPR017850Alkaline_phosphatase_core_sf
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
GO:0016787hydrolase activity
GO:0047390glycerophosphocholine cholinephosphodiesterase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002591Type I phosphodiesterase/nucleotide pyrophosphatase/phosphate transferasePFAMPF01663Phosphodiestcoord: 23..354
e-value: 8.9E-49
score: 167.0
NoneNo IPR availableGENE3DG3DSA:3.30.1360.180coord: 243..352
e-value: 1.2E-87
score: 296.2
NoneNo IPR availablePANTHERPTHR10151ECTONUCLEOTIDE PYROPHOSPHATASE/PHOSPHODIESTERASEcoord: 20..427
NoneNo IPR availableCDDcd16018Enppcoord: 21..394
e-value: 6.64568E-45
score: 155.821
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..20
score: 0.564
IPR017850Alkaline-phosphatase-like, core domain superfamilyGENE3DG3DSA:3.40.720.10coord: 24..404
e-value: 1.2E-87
score: 296.2
IPR017850Alkaline-phosphatase-like, core domain superfamilySUPERFAMILYSSF53649Alkaline phosphatase-likecoord: 20..394