GDP-fucose transporter 1-like

Overview
NameGDP-fucose transporter 1-like
Smed IDSMED30026116
Length (bp)2174
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GDP-fucose transporter 1-like (SMED30026116) t-SNE clustered cells

Violin plots show distribution of expression levels for GDP-fucose transporter 1-like (SMED30026116) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GDP-fucose transporter 1-like (SMED30026116) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GDP-fucose transporter 1-like (SMED30026116) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026116

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Category 4 cellSMED30026116SMESG000071232.1 dd_Smed_v4_13367_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026116SMESG000071232.1 dd_Smed_v4_13367_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026116SMESG000071232.1 dd_Smed_v4_13367_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GDP-fucose transporter 1-like vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 102.064 bits (253), Expect = 1.039e-22
Identity = 84/299 (28.09%), Postives = 150/299 (50.17%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVM-SIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSI---KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C +   +   L  +A      V +P+  L    + S L + + FIG++  NN  LK+ G+AF++V RS T +F ++LS L+ +       ++    I+     L V +E ++GTLS    V G L+SL  ++N + + +    +     R  +  N  A I   P++L   +       + L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  N+ +   + AYT V
Sbjct:   30 LVVSLYWVTSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIG-GFWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWV 327          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 101.293 bits (251), Expect = 1.753e-22
Identity = 86/304 (28.29%), Postives = 152/304 (50.00%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSIL-----LVVREESSQGTLSIKAVVCGFLSSLLTAINVM-SIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSI---KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C +   +   L  +A      V +P+  L    + S L + + FIG++  NN  LK+ G+AF++V RS T +F ++LS L+ +      +      +LT  I+     L V +E ++GTLS    V G L+SL  ++N + + +    +     R  +  N  A I   P++L   +       + L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  N+ +   + AYT V
Sbjct:   43 LVVSLYWVTSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLK------QTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWV 340          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Human
Match: SLC35C1 (solute carrier family 35 member C1 [Source:HGNC Symbol;Acc:HGNC:20197])

HSP 1 Score: 58.151 bits (139), Expect = 3.580e-9
Identity = 40/122 (32.79%), Postives = 67/122 (54.92%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYES 443
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C +   +   L  +A      V +P+  L    + S L + + FIG++  NN  LK+ G+AF++V RS T +F ++LS L+ + 
Sbjct:   30 LVVSLYWVTSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLKQ 151          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Celegans
Match: nstp-10 (GDP-fucose transporter [Source:UniProtKB/Swiss-Prot;Acc:Q968A5])

HSP 1 Score: 114.39 bits (285), Expect = 2.090e-27
Identity = 93/297 (31.31%), Postives = 142/297 (47.81%), Query Frame = 3
Query:  105 AISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFL-------GHIADLFYFTVHYPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLYNLKSIKVSILD---NTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            A+S YWV S+  VFLNK L  LS++  +  LF    Q  + +FL            LF F        +S   L + + F+ ++  NN  LK+ G++F++V RS T +F ++ + LI         I   A I+    LL V +E   GTLS   V+ G L+SL  A+N +  R       DCL R     N  A +   P++L+N +   V   D   +T +  L+ L GV GF++G     ++   +P++H IS + K+  QTV   + Y E K+  WW  N  +   +  YT V
Sbjct:   19 AVSAYWVFSIGLVFLNKYL--LSSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGLFKFPSMPIDAKISREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIGCCALII-FGFLLGVDQEGVTGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTYV 312          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Celegans
Match: nstp-10 (GDP-fucose transporter [Source:UniProtKB/Swiss-Prot;Acc:Q968A5])

HSP 1 Score: 113.62 bits (283), Expect = 4.875e-27
Identity = 93/297 (31.31%), Postives = 142/297 (47.81%), Query Frame = 3
Query:  105 AISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFL-------GHIADLFYFTVHYPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLYNLKSIKVSILD---NTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            A+S YWV S+  VFLNK L  LS++  +  LF    Q  + +FL            LF F        +S   L + + F+ ++  NN  LK+ G++F++V RS T +F ++ + LI         I   A I+    LL V +E   GTLS   V+ G L+SL  A+N +  R       DCL R     N  A +   P++L+N +   V   D   +T +  L+ L GV GF++G     ++   +P++H IS + K+  QTV   + Y E K+  WW  N  +   +  YT V
Sbjct:   33 AVSAYWVFSIGLVFLNKYL--LSSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGLFKFPSMPIDAKISREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIGCCALII-FGFLLGVDQEGVTGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTYV 326          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Celegans
Match: nstp-9 (Nucleotide Sugar TransPorter family [Source:UniProtKB/TrEMBL;Acc:G5EC08])

HSP 1 Score: 92.4337 bits (228), Expect = 3.005e-20
Identity = 76/289 (26.30%), Postives = 138/289 (47.75%), Query Frame = 3
Query:  123 VSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTVHYP--------TFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLYNLKSIKV-SILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTI 959
            V S+  VF+NK L+       +  LF  C Q  + I +  +     F   Y          F      L + + F+ ++  NN  L+  G+AF++V RS T +F +IL+ + +       K + ++ ++ L    +  ++ SQ  L+   V+ G  +SL  A+N +  ++      +C+ +  +  N  A +   P+++ N    K+ +     ++ +LL +SG+ GF++      ++   +P++H IS + KS  QTV    +Y E KS  WWF NL I L ++ YTI
Sbjct:   13 VCSIGLVFINKHLLSGIGAELDIPLFITCCQCLVTIGICLVLRWGSFKTKYLKTFSKLDINFETCIDVLPLSIVFVAMISFNNLCLRNVGVAFYYVGRSITTVFTVILTYVFFGDN--STKGVNVSCLVILIGFGIGSDQESQDPLTTSGVLYGMFASLAVALNALYTKSILPKVGNCIWQLTWYNNILAVLLFLPLIIINGDFGKIWNHFPTWSFWQLLFISGIFGFVMNYVTGWQIKATSPLTHNISATAKSASQTVIAVFLYSEVKSYLWWFSNLIILLGSMLYTI 299          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Fly
Match: nac (gene:FBgn0265351 transcript:FBtr0081863)

HSP 1 Score: 85.8853 bits (211), Expect = 1.011e-17
Identity = 81/308 (26.30%), Postives = 148/308 (48.05%), Query Frame = 3
Query:   99 FLAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTVHYPT-FTLSASELGMILSFIGILI----------SNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYE---SFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQK---IHRDCLRTAYLMNFGAFIFLFPVVLYN--LKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            F  +S YW +S++ VF+NK L+    +N    LF    Q  ++  +  +A     +  YP+ FT        I +F  IL           +NN +L +  +AF+++ RS T +F ++L+ +I     SF    K ++    + +   L V +ES     S +  + G LSSL  A+ + SI+ ++    ++++    +Y  N  + +   P+++ N  L+SI     L  + +   + LSG+ GF +G     E+   + ++H IS + K+  QTV  +  Y + +S  WW  N+ + + + AYT V
Sbjct:   19 FFVVSLYWCTSILTVFVNKHLLSSDTVNLGAPLFMSWFQCVVSTVICFVAS--RLSRKYPSVFTFPEGNPLDIDTFRKILPLSVLYTLMIGANNLSLSYVTVAFYYIGRSLTTVFSVVLTYVILRQRTSF----KCLLCCGAIVVGFWLGVDQESLTEVFSWRGTIFGVLSSL--ALAMFSIQTKKSLGYVNQEVWLLSYYNNLYSTLLFLPLIIINGELESIITYPHLWASWFWAAMTLSGLCGFAIGFVTALEIKVTSALTHNISGTAKACAQTVIATQYYHDVRSALWWTSNVVVLVASAAYTRV 318          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Zebrafish
Match: slc35c1 (solute carrier family 35 member C1 [Source:ZFIN;Acc:ZDB-GENE-041212-11])

HSP 1 Score: 105.531 bits (262), Expect = 3.702e-24
Identity = 83/297 (27.95%), Postives = 152/297 (51.18%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE-FMLFTVCIQNF-IAIFLGHIADLFYFTVHYPT--FTLSASE--LGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKI-HRDCLRTAYLMNFGAFIFLFP--VVLYNLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L ++ YW  S+  VFLN  L+    ++   F+ F  C+ +  + + +  ++ L   +V +P+  F L  S   L + + FI ++  NN  LK+ G+AF+ V RS + +F +ILS ++ +       ++    IL     L V +E+  G+LS   VV G ++SL  ++N +  +    +   +  + +Y  N  A +   P  ++L  +KS+ + S L + ++  ++ L GV GF +G     ++ + +P++H +S + KS  QTV   + +   KST WW  NL +   + AYT V
Sbjct:   25 LVVTLYWFISISMVFLNNYLLDSKELDAPVFITFFQCVVSVGLCLLMSFLSSLCPGSVDFPSLKFDLRVSREILPLTIVFISMITFNNLCLKYVGVAFYTVGRSLSTVFNVILSYVVLKQTTSLYAVLCCGVILG-GFWLGVDQEAVAGSLSWAGVVFGVIASLCVSLNAIFTKKVLPVVDGNIWKLSYYNNLNAIVLFLPLLIILGEVKSVFEFSRLTDLHFWGMMTLGGVFGFAIGYVTGLQIKFTSPLTHNVSGTAKSCAQTVLAVVYWASEKSTLWWTSNLMVLGGSFAYTWV 320          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Zebrafish
Match: slc35c1 (solute carrier family 35 member C1 [Source:ZFIN;Acc:ZDB-GENE-041212-11])

HSP 1 Score: 105.531 bits (262), Expect = 3.702e-24
Identity = 83/297 (27.95%), Postives = 152/297 (51.18%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE-FMLFTVCIQNF-IAIFLGHIADLFYFTVHYPT--FTLSASE--LGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKI-HRDCLRTAYLMNFGAFIFLFP--VVLYNLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L ++ YW  S+  VFLN  L+    ++   F+ F  C+ +  + + +  ++ L   +V +P+  F L  S   L + + FI ++  NN  LK+ G+AF+ V RS + +F +ILS ++ +       ++    IL     L V +E+  G+LS   VV G ++SL  ++N +  +    +   +  + +Y  N  A +   P  ++L  +KS+ + S L + ++  ++ L GV GF +G     ++ + +P++H +S + KS  QTV   + +   KST WW  NL +   + AYT V
Sbjct:   25 LVVTLYWFISISMVFLNNYLLDSKELDAPVFITFFQCVVSVGLCLLMSFLSSLCPGSVDFPSLKFDLRVSREILPLTIVFISMITFNNLCLKYVGVAFYTVGRSLSTVFNVILSYVVLKQTTSLYAVLCCGVILG-GFWLGVDQEAVAGSLSWAGVVFGVIASLCVSLNAIFTKKVLPVVDGNIWKLSYYNNLNAIVLFLPLLIILGEVKSVFEFSRLTDLHFWGMMTLGGVFGFAIGYVTGLQIKFTSPLTHNVSGTAKSCAQTVLAVVYWASEKSTLWWTSNLMVLGGSFAYTWV 320          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Xenopus
Match: eri1 (exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-974172])

HSP 1 Score: 90.1225 bits (222), Expect = 8.887e-19
Identity = 78/301 (25.91%), Postives = 138/301 (45.85%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTV-----HYPTFTLSASELGMILS----FIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKV----SILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L ++ YW  S+  VFLNK L+   ++  +  LF    Q  + + L     L    V      +P+       L  +L     FIG++  NN  LK+ G+AF+ V R  + +F ++LS ++ +       ++    IL     L + +E ++GTLS   +  G L+SL  ++N +  +     +     R  +  N  A  FLF  +L+    +        L   ++  ++ L G+ GF +G     ++ + +P++H IS + K+  QTV   + Y + KS  WW  NL +   + +YT V
Sbjct:   38 LVVTLYWFISITMVFLNKYLLDSPSLKLDAPLFVTFYQCVVTVVLCKGLSLLTHVVPSHILEFPSLRFDLKVLRTVLPLSIVFIGMITFNNLCLKYLGVAFYTVGRCLSTVFNVLLSYIMLKQTTSMYALMSCGVILG-GFWLGIDQEGAEGTLSWAGIFFGVLASLCVSLNAIYTKKVLPAVDGSIWRLTFYNNVNA-CFLFTPLLFIFGEVGTLFTFDKLFAFSFWGMMTLGGIFGFAIGYVTGLQIQFTSPLTHNISGTAKACAQTVLAVMYYHQIKSFLWWTSNLMVLGGSFSYTWV 336          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Xenopus
Match: eri1 (exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-974172])

HSP 1 Score: 89.7373 bits (221), Expect = 1.198e-18
Identity = 78/301 (25.91%), Postives = 138/301 (45.85%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTV-----HYPTFTLSASELGMILS----FIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKV----SILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L ++ YW  S+  VFLNK L+   ++  +  LF    Q  + + L     L    V      +P+       L  +L     FIG++  NN  LK+ G+AF+ V R  + +F ++LS ++ +       ++    IL     L + +E ++GTLS   +  G L+SL  ++N +  +     +     R  +  N  A  FLF  +L+    +        L   ++  ++ L G+ GF +G     ++ + +P++H IS + K+  QTV   + Y + KS  WW  NL +   + +YT V
Sbjct:   40 LVVTLYWFISITMVFLNKYLLDSPSLKLDAPLFVTFYQCVVTVVLCKGLSLLTHVVPSHILEFPSLRFDLKVLRTVLPLSIVFIGMITFNNLCLKYLGVAFYTVGRCLSTVFNVLLSYIMLKQTTSMYALMSCGVILG-GFWLGIDQEGAEGTLSWAGIFFGVLASLCVSLNAIYTKKVLPAVDGSIWRLTFYNNVNA-CFLFTPLLFIFGEVGTLFTFDKLFAFSFWGMMTLGGIFGFAIGYVTGLQIQFTSPLTHNISGTAKACAQTVLAVMYYHQIKSFLWWTSNLMVLGGSFSYTWV 338          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Mouse
Match: Slc35c1 (solute carrier family 35, member C1 [Source:MGI Symbol;Acc:MGI:2443301])

HSP 1 Score: 111.309 bits (277), Expect = 4.529e-26
Identity = 84/299 (28.09%), Postives = 153/299 (51.17%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFP--VVLYNLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C + + +   L  +A      V +PT  L    + S L + + FIG++  NN  LK+ G+ F++V RS T +F ++LS L+ +       ++    I+     L + +E ++GTLS+   + G L+SL  ++N +  +     +     R  +  N  A +   P  +VL  L+++   + L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  NL +   + AYT V
Sbjct:   29 LVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIG-GFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWV 326          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Mouse
Match: Slc35c1 (solute carrier family 35, member C1 [Source:MGI Symbol;Acc:MGI:2443301])

HSP 1 Score: 111.309 bits (277), Expect = 6.694e-26
Identity = 84/299 (28.09%), Postives = 153/299 (51.17%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFP--VVLYNLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C + + +   L  +A      V +PT  L    + S L + + FIG++  NN  LK+ G+ F++V RS T +F ++LS L+ +       ++    I+     L + +E ++GTLS+   + G L+SL  ++N +  +     +     R  +  N  A +   P  +VL  L+++   + L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  NL +   + AYT V
Sbjct:   42 LVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIG-GFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWV 339          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Mouse
Match: Slc35c1 (solute carrier family 35, member C1 [Source:MGI Symbol;Acc:MGI:2443301])

HSP 1 Score: 57.3806 bits (137), Expect = 3.686e-9
Identity = 40/122 (32.79%), Postives = 67/122 (54.92%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYES 443
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C + + +   L  +A      V +PT  L    + S L + + FIG++  NN  LK+ G+ F++V RS T +F ++LS L+ + 
Sbjct:   29 LVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQ 150          
BLAST of GDP-fucose transporter 1-like vs. UniProt/SwissProt
Match: sp|Q968A5|FUC10_CAEEL (GDP-fucose transporter OS=Caenorhabditis elegans OX=6239 GN=nstp-10 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 6.201e-26
Identity = 93/297 (31.31%), Postives = 142/297 (47.81%), Query Frame = 3
Query:  105 AISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFL-------GHIADLFYFTVHYPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLYNLKSIKVSILD---NTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            A+S YWV S+  VFLNK L  LS++  +  LF    Q  + +FL            LF F        +S   L + + F+ ++  NN  LK+ G++F++V RS T +F ++ + LI         I   A I+    LL V +E   GTLS   V+ G L+SL  A+N +  R       DCL R     N  A +   P++L+N +   V   D   +T +  L+ L GV GF++G     ++   +P++H IS + K+  QTV   + Y E K+  WW  N  +   +  YT V
Sbjct:   33 AVSAYWVFSIGLVFLNKYL--LSSVQLDAPLFITWYQCLVTVFLCLFLSKTSKAYGLFKFPSMPIDAKISREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIGCCALII-FGFLLGVDQEGVTGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFDKLFDTTFWILMTLGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTLLWWTSNFVVLFGSGMYTYV 326          
BLAST of GDP-fucose transporter 1-like vs. UniProt/SwissProt
Match: sp|Q8BLX4|FUCT1_MOUSE (GDP-fucose transporter 1 OS=Mus musculus OX=10090 GN=Slc35c1 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 4.682e-25
Identity = 84/299 (28.09%), Postives = 153/299 (51.17%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFP--VVLYNLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C + + +   L  +A      V +PT  L    + S L + + FIG++  NN  LK+ G+ F++V RS T +F ++LS L+ +       ++    I+     L + +E ++GTLS+   + G L+SL  ++N +  +     +     R  +  N  A +   P  +VL  L+++   + L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  NL +   + AYT V
Sbjct:   42 LVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGMVDFPTLNLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVPFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGVIIG-GFWLGIDQEGAEGTLSLTGTIFGVLASLCVSLNAIYTKKVLPAVDHSIWRLTFYNNVNACVLFLPLMIVLGELRALLAFTHLSSAHFWLMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEIKSFLWWTSNLMVLGGSSAYTWV 339          
BLAST of GDP-fucose transporter 1-like vs. UniProt/SwissProt
Match: sp|A6QM03|FUCT1_BOVIN (GDP-fucose transporter 1 OS=Bos taurus OX=9913 GN=SLC35C1 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 2.638e-22
Identity = 84/304 (27.63%), Postives = 151/304 (49.67%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFL----GHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSIL-----LVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKS---IKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +  +F    Q  + + L      +A     TV +P   L    + S L + + FIG++  NN  LK+ G+AF++V RS T +F ++LS L+ +      +      +LT S++     L V +E ++GTLS    + G L+SL  ++N +  +     +     R  +  N  A +   P++L   +    +    L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  N+ +   + AYT V
Sbjct:   43 LVVSLYWVTSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTVLLCKGLSSLATCCPGTVDFPALHLDLKVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLK------QTTSFYALLTCSVIIGGFWLGVDQEGAEGTLSWTGTLFGVLASLCVSLNAIYTKKVLPAVDGSIWRLTFYNNANACVLFLPLLLALGELRALLAFPQLGSAHFWAMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEEAKSFLWWTSNMMVLGGSSAYTWV 340          
BLAST of GDP-fucose transporter 1-like vs. UniProt/SwissProt
Match: sp|Q96A29|FUCT1_HUMAN (GDP-fucose transporter 1 OS=Homo sapiens OX=9606 GN=SLC35C1 PE=1 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 8.418e-22
Identity = 86/304 (28.29%), Postives = 152/304 (50.00%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSIL-----LVVREESSQGTLSIKAVVCGFLSSLLTAINVM-SIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSI---KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L +S YWV+S+  VFLNK L+   ++  +   F+ F  C +   +   L  +A      V +P+  L    + S L + + FIG++  NN  LK+ G+AF++V RS T +F ++LS L+ +      +      +LT  I+     L V +E ++GTLS    V G L+SL  ++N + + +    +     R  +  N  A I   P++L   +       + L + ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  N+ +   + AYT V
Sbjct:   43 LVVSLYWVTSISMVFLNKYLLDSPSLRLDTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLK------QTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVSLNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWV 340          
BLAST of GDP-fucose transporter 1-like vs. UniProt/SwissProt
Match: sp|A9UUB8|FUCT1_MONBE (GDP-fucose transporter 1 OS=Monosiga brevicollis OX=81824 GN=slc35c1 PE=3 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.780e-21
Identity = 74/298 (24.83%), Postives = 150/298 (50.34%), Query Frame = 3
Query:  108 ISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAI----FLGHIADLFYFTVHYPTFT----LSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSK-LIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQK-IHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKVSILDNT---NYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            ++ YWV S+  VFLNK L  LS ++ +  +F    Q  +A+     LG +         +P F     ++   L + L F+G++  NN  LKF G+AF++V RS T +F ++LS  ++ +   +P   +++  ++     + V +E  Q  L++  ++ G L+SL  A+N + I+     +  D  +     N  A     PV+ +  +   ++  ++    NY  L+ ++G++G  +G+    ++   +P++H IS + K+  QT+    +  E+++ +WW  N+ +   ++ Y +V
Sbjct:   20 VALYWVVSISMVFLNKYL--LSEVSLDAPMFVTWFQCVVAVVTCFILGELRSYHPALEMFPRFAFDTHVAMKVLPLSLVFVGMIAFNNLALKFVGVAFYNVGRSLTTIFNVLLSFFMLQQRTSMP--ALLMCGVIVAGFFVGVNKEQEQADLTMAGIMYGVLASLCVALNAIYIKKVMPFVDNDMWKLTAYNNMNAIFLFLPVITFMGEIPDIAASEDVYSGNYWFLMTVAGLLGIAIGLVSMLQINVTSPLTHNISGTSKACAQTILALQLNDESRTATWWLGNVFVLGGSLGYVLV 313          
BLAST of GDP-fucose transporter 1-like vs. TrEMBL
Match: A0A0H3YF99 (Slc35c-1 OS=Schmidtea mediterranea OX=79327 GN=slc35c-1 PE=2 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.159e-27
Identity = 92/309 (29.77%), Postives = 158/309 (51.13%), Query Frame = 3
Query:   81 SAILYSFLAISFYWVSSLVYVFLNKSLIG-----LSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTVHYPTFTLSASELG-------MILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAI-NVMSIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVL--YNLKSIKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            S  L  F  + FYW++S+   F NK L+G     +S     F+ +T C    + +++ +  + +       T     S +        MILSF  +L  NN  LKF GI+FF ++RS T++F +I +K+        N II+   ++ +  ++ + +E   G LSI  V+CG +SS+  A+  +   R   +I  +     Y MN G+ +   P +L     + +    L++  +I  LLL+GV+GF++ +A N E+ + +P +HQIS + KSV+QT+   +++ E K   WW  NL +    V YT++
Sbjct:    5 SKYLQIFFVVLFYWITSISMTFANKYLVGNKFHDISEDITMFVAWTQCAVTVVIVYIIYFFNRWILMKKDTTLPPLKSSILFDINMIIMILSFSLMLFLNNLTLKFVGISFFQIARSLTLVFTVIFTKICLHKSQSVN-IILCCAVVVIGFVMGIDQEKLTGNLSIAGVLCGVVSSVFVALTGIFMKRVLTRIENNSYSLVYYMNIGSTVLYLPFLLGFSQFQIVYYKKLEDNLFIVALLLTGVLGFLINLASNMEINFTSPTTHQISNNAKSVLQTILAVLIFAELKPLFWWCSNLLVVTGAVGYTVI 312          
BLAST of GDP-fucose transporter 1-like vs. TrEMBL
Match: A0A1S3IE84 (GDP-fucose transporter 1-like OS=Lingula unguis OX=7574 GN=LOC106163489 PE=4 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.222e-27
Identity = 90/315 (28.57%), Postives = 165/315 (52.38%), Query Frame = 3
Query:   66 DSSRNSAILYSFLAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAI----FLGHIADLFYFTVH----YPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKI-HRDCLRTAYLMNFGAFIFLFPVVLYN--LKSIKVSILDNTNYIKL-LLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIVIIQK 974
            +    ++ L  FL +  YW  S+  VF NK L+G    + +  LF    Q  I++    F      + Y  +H     P+  LS + + +   F+G+L  NN  LK  G+AFF ++RS T++F ++ S +I + +    K I    I+    +L V +E   GTLS++ V+ G  +S+  A+  ++I+    I  +D  R  +  NF A +   P+VL +  L++  +S   +  Y  + +++SG++GF++  A   ++ Y +P++H +S + KSVVQT+    +Y+E+K   WW  N+ +    +AY +V +++
Sbjct:    2 EKQERASYLKIFLVVMNYWTMSISMVFANKYLVGSRFSSLDLSLFVAFFQCIISVVFVLFYTRAGKMCYPDIHPISYSPSIGLSRNMVVLSGLFVGMLSFNNLCLKHVGVAFFQIARSMTLIFTVMFSAIILKKYS-SWKAICCCLIVVGGFILGVDQEKVAGTLSVRGVMYGVTTSVFVALVGITIKKALDIVDKDSARVTFYNNFNAAMLFTPLVLASGELEAFWLSDKASDVYFWMAMVVSGILGFLIAWASALQIHYTSPVTHHVSNNAKSVVQTIMAVTIYQESKPWLWWVSNIMVMTGALAYALVKMKE 315          
BLAST of GDP-fucose transporter 1-like vs. TrEMBL
Match: A0A1S3J1P3 (GDP-fucose transporter 1 OS=Lingula unguis OX=7574 GN=LOC106169443 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 5.178e-27
Identity = 88/315 (27.94%), Postives = 165/315 (52.38%), Query Frame = 3
Query:   66 DSSRNSAILYSFLAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAI----FLGHIADLFYFTVH----YPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKI-HRDCLRTAYLMNFGAFIFLFPVVLYN--LKSIKVSILDNTNYIKL-LLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIVIIQK 974
            +    ++ L  FL +  YW  S+  VF NK L+G    + +  LF    Q  I++    F      + Y  +H     P+  LS + + +   F+G+L  NN  LK  G+AFF ++RS T++F ++ S +I + +    K I    ++    +L V +E   GTLS++ V+ G  +S+  A+  ++I+    I  +D  R  +  NF A +   P+V+ +  L++  +S   +  Y  + +++SG++GF++  A   ++ Y +P++H +S + KSVVQT+    +Y+E+K   WW  N+ +    +AY +V +++
Sbjct:    2 EKQERASYLKIFLVVMNYWTMSISMVFANKYLVGSRFSSLDLSLFVAFFQCIISVVFVLFYTRAGKMCYPDIHPISYSPSIGLSRNMVVLSGLFVGMLSFNNLCLKHVGVAFFQIARSMTLIFTVMFSAIILKKYS-SWKAICCCLVVVGGFILGVDQEKVAGTLSVRGVMYGVTTSVFVALVGITIKKALDIVDKDSARVTFYNNFNAAMLFTPLVIASGELEAFWLSDKASDVYFWMAMVVSGILGFLIAWASALQIHYTSPVTHHVSNNAKSVVQTIMAVTIYQESKPWLWWVSNIMVMTGALAYALVKMKE 315          
BLAST of GDP-fucose transporter 1-like vs. TrEMBL
Match: A0A1A6HQX8 (TPT domain-containing protein OS=Neotoma lepida OX=56216 GN=A6R68_21140 PE=4 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 7.799e-26
Identity = 93/324 (28.70%), Postives = 165/324 (50.93%), Query Frame = 3
Query:   51 EEINFDSSRNSAILYSF---LAISFYWVSSLVYVFLNKSLIGLSNMNFE---FMLFTVC-IQNFIAIFLGHIADLFYFTVHYPTFTL----SASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSIL-----LVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNE-QKIHRDCLRTAYLMNFGAFIFLFP--VVLYNLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            EE + DS     +L +    L +S YWV+S+  VFLNK L+   ++  +   F+ F  C + + +   L  +A     TV +PT  L    + S L + + FIG++  NN  LK+ G+AF++V RS T +F ++LS L+ +      +      +LT  I+     L + +E ++GTLS+   + G L+SL  ++N +  +     +     R  +  N  A +   P  V+L  L+++   + LD+ ++  ++ L G+ GF +G     ++ + +P++H +S + K+  QTV   + Y+E KS  WW  N  +   + AYT V
Sbjct:   24 EEADADSRNKPFLLRALQIALVVSLYWVTSISMVFLNKYLLDSPSLQLDTPIFVTFYQCLVTSLLCKGLSTLATCCPGTVDFPTLKLDLKVARSVLPLSVVFIGMISFNNLCLKYVGVAFYNVGRSLTTVFNVLLSYLLLK------QTTSFYALLTXGIIIGGFWLGIDQEGAEGTLSLVGTIFGVLASLCVSLNAIYTKKVLPAVDNSIWRLTFYNNVNACVLFLPLMVLLGELRALLDFAHLDSAHFWVMMTLGGLFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNXMVLGGSSAYTWV 341          
BLAST of GDP-fucose transporter 1-like vs. TrEMBL
Match: A0A1I7U7T4 (TPT domain-containing protein OS=Caenorhabditis tropicalis OX=1561998 PE=4 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.670e-25
Identity = 95/299 (31.77%), Postives = 147/299 (49.16%), Query Frame = 3
Query:  105 AISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFL----GHIADLFYFTVHYPTFTLSA----SELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLYNLKSIKV----SILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            A+S YWV S+  VFLNK L  LSN+  +  LF    Q  + +FL     HI+   Y    +P+  + A      L + + F+ ++  NN  LK+ G++F++V RS T +F ++ + LI         I   A I+    LL V +E + GTLS   V+ G L+SL  A+N +  R       DCL R     N  A +   P++L+N +   V     + D T +I L+   GV GF++G     ++   +P++H IS + K+  QTV   + Y E K+  WW  N  +   +  YT V
Sbjct:   19 AVSAYWVFSIGLVFLNKYL--LSNVQLDAPLFITWYQCLVTVFLCLLLSHISK-NYGVFKFPSMPIDAKISREVLPLSVVFVAMISFNNLCLKYVGVSFYYVGRSLTTVFNVVCTYLILGQKTSGQAIACCALII-FGFLLGVDQEGATGTLSYTGVIFGVLASLSVALNAIYTRKVLSSVGDCLWRLTMYNNLNALVLFLPLMLFNGEFGAVFYFEKLFDTTFWI-LMTFGGVFGFMMGYVTGWQIQATSPLTHNISGTAKAAAQTVMAVVWYSELKTMLWWTSNFVVLFGSAMYTYV 312          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Cavefish
Match: slc35c1 (solute carrier family 35 member C1 [Source:NCBI gene;Acc:103034845])

HSP 1 Score: 93.5893 bits (231), Expect = 3.534e-20
Identity = 84/301 (27.91%), Postives = 143/301 (47.51%), Query Frame = 3
Query:  102 LAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIAD----LFYFTVHYPTF--TLSASELGMILS--FIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLY-----NLKSIKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L ++ YW  S+  VFLN  L  L + + +  LF    Q  +++ L  + +    ++   V +P+    L  S   M LS  FI ++  NN  LK  G+AF+ V RS + +F ++LS +I +       ++    IL     L V +E   G+LS   V  G L+S   ++N +  +    +    + + +Y  N  A     P+++       L S   S L N N+  ++++ GV GF +G     ++ Y +P++H +S + K+  QTV   + Y  +KS  WW  NL +   + AYT V
Sbjct:   26 LVVALYWFVSITMVFLNNYL--LDSKDLDAPLFVTFFQCMVSVCLCGVMNVLSIMYPSCVDFPSIKVDLKVSREIMPLSVVFISMITFNNLCLKNVGVAFYTVGRSLSTVFNVLLSYVILKQTTSMYAMLCCGVILG-GFWLGVDQEGEAGSLSWSGVFFGVLASACVSLNAIYTKKVMPVVDGSIWKLSYYNNLNACALFLPLMIVFGEFGRLASF--SQLLNMNFWGMMVVGGVFGFAIGYVTGLQIKYTSPLTHNVSGTAKACAQTVLAVMYYHTSKSGLWWTSNLMVLGGSSAYTWV 321          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Sea Lamprey
Match: slc35c1 (solute carrier family 35 member C1 [Source:ZFIN;Acc:ZDB-GENE-041212-11])

HSP 1 Score: 77.0258 bits (188), Expect = 6.042e-16
Identity = 64/224 (28.57%), Postives = 114/224 (50.89%), Query Frame = 3
Query:  303 LGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCL-RTAYLMNFGAFIFLFPVVLYNLKSIKVSILDN---TNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            L + L F G++  NN  LKF GI+F++V RS T +F +++S +I         ++    I+     L V +E   GTLS+  VV G ++SL  ++N +  +    +    L R AY  N  A +   P++L   ++ K+   ++    ++  ++ L GV+GF +G     ++   +P++H +S + K+ VQTV     + E K+  WW  N+ +   +  YT V
Sbjct:   12 LPLSLVFTGMITFNNLCLKFVGISFYNVGRSLTTVFNVLMSYMILGQGTSLPALLCCGMIIG-GFWLGVDQEDMSGTLSVAGVVFGVVASLCVSLNAIYTKKVLPLVGGSLWRLAYYNNINACLLFMPIILLVGEAPKLLAFEHVFSPHFWMIMTLGGVLGFGIGYVTGLQIQVTSPLTHNVSGTAKACVQTVVAVSYFGEFKTVLWWASNVLVLTGSFFYTWV 234          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Yeast
Match: SUR1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Csh1p; SUR1 has a paralog, CSH1, that arose from the whole genome duplication [Source:SGD;Acc:S000005978])

HSP 1 Score: 63.1586 bits (152), Expect = 5.733e-11
Identity = 38/135 (28.15%), Postives = 65/135 (48.15%), Query Frame = -1
Query: 1446 IPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEF--------GKKLPIPTED-VKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQF 1823
            IPKI+H  YK++ +P    E  + C+ ++   K++ WT+  AY FI +E+          K PI   D ++YFILS  GG+ +D +  C +    ++   + +  R+   +           SN+ M  +P H F
Sbjct:   55 IPKIIHQTYKTEDIPEHWKEGRQKCLDLHPDYKYILWTDEMAYEFIKEEYPWFLDTFENYKYPIERADAIRYFILSHYGGVYIDLDDGCERKLDPLLAFPAFL--RKTSPLG---------VSNDVMGSVPRHPF 178          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Yeast
Match: CSH1 (Mannosylinositol phosphorylceramide (MIPC) synthase catalytic subunit; forms a complex with regulatory subunit Csg2p; function in sphingolipid biosynthesis is overlapping with that of Sur1p; CSH1 has a paralog, SUR1, that arose from the whole genome duplication [Source:SGD;Acc:S000000365])

HSP 1 Score: 56.6102 bits (135), Expect = 5.302e-9
Identity = 37/140 (26.43%), Postives = 68/140 (48.57%), Query Frame = -1
Query: 1431 IPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEF--------GKKLPIPTED-VKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMI 1823
            IPKI+H  YK+  +P + ++  + CI ++    ++ WT+  +  FI +E+          + PI   D ++YFILS  GGI +D +  C +    ++ +    L + +   +G+        SN+ M  +P H F   +I
Sbjct:   62 IPKIIHQTYKTNDIPEQWVKGRQKCIDLHPDYTYILWTDEMSDTFIKQEYPWFLDTFRSYEYPIERADAIRYFILSHYGGIYIDLDDGCERRLDPLL-KVPAFLRKTSP--TGV--------SNDVMGSVPRHPFFLKVI 190          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Nematostella
Match: SLC35C1 (GDP-fucose transporter 1 [Source:UniProtKB/Swiss-Prot;Acc:A7S1L6])

HSP 1 Score: 95.5153 bits (236), Expect = 2.185e-21
Identity = 79/297 (26.60%), Postives = 141/297 (47.47%), Query Frame = 3
Query:  108 ISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAI----FLGHIADLFYFTVHYPTFTLSASELGMILS----FIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRN-EQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKVSILDN--TNYIKLLL-LSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            ++ YW  S+  VFLNK L+   ++  +  LF    Q  + +    FL  + D + +   +P F +  S    +L     F+G++  NN  LK  G++F++V RS T +F +I + +I         +I  A I+    L+ V +E S G +S   V+ G L+SL  ++N +  +     +  +  R     NF A     P++    +  +V+   N  + Y  L++ + GV G  +G     ++   +P++H IS + K+ VQT+     + E K+  WW  N  +   ++AYT V
Sbjct:   16 VAAYWTISISLVFLNKYLLSSPDIKLDAPLFVTWYQCVVTVICLFFLSLLGDRYPWIDTFPAFHIKLSVAKQVLPLSAVFVGMITFNNLCLKNLGVSFYNVGRSLTTVFNVICTYVILGQSTSYKAVICCAVIIG-GFLMGVDQEGSSGKISYSGVLFGVLASLCVSLNAIYTKKFIPAVDNNIWRLQLYNNFNACFLFLPLMALLGEIGEVAHFPNLSSAYFWLMMTIGGVFGIAIGYITGLQIKVTSPLTHNISGTAKACVQTIMSVSYFHETKTALWWLSNAMVLGGSMAYTRV 311          
BLAST of GDP-fucose transporter 1-like vs. Ensembl Medaka
Match: slc35c1 (solute carrier family 35 member C1 [Source:NCBI gene;Acc:101159977])

HSP 1 Score: 87.0409 bits (214), Expect = 7.661e-18
Identity = 78/297 (26.26%), Postives = 138/297 (46.46%), Query Frame = 3
Query:  108 ISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLF------YFTVHYPTFTLSASELGMILS--FIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRN-EQKIHRDCLRTAYLMNFGAFIFLFPVVLY--NLKSI-KVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIV 962
            ++ YW  S+  VFLN  L  L N +    LF    Q  +++ L  +  L       +  V    F L  S   + LS  FIG++  NN  LK+ G+AF+ + RS + +F ++LS +I +       ++    IL     L V +E   G+LS   V  G L+S   ++N +  +     +     + +Y  N  A +   P++L    L  + + + L +  +  ++ + GV GF +G     ++ + +P++H +S + K+  QTV   +    +KS  WW  N+ +   + AYT V
Sbjct:   63 VALYWFISITMVFLNSYL--LDNKDLNAPLFVTFYQCLVSVGLCGLMQLLSMIKPDFVNVPAVNFQLKTSREVLPLSIVFIGMITFNNLCLKYVGVAFYTIGRSLSTVFNVLLSFIILKQSTSLQALVCCGIILG-GFWLGVDQEGLAGSLSWSGVFFGVLASACVSLNAIYTKKVMPAVDGSIWKLSYYNNINACLLFIPLILVFGELGQLSRFNRLTDLKFWGMMTVGGVFGFAIGYVTGLQIKFTSPLTHNVSGTAKACAQTVIAVVYNSSSKSFLWWTSNMMVLGGSSAYTWV 356          
BLAST of GDP-fucose transporter 1-like vs. Planmine SMEST
Match: SMESG000071232.1 (SMESG000071232.1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 333/333 (100.00%), Postives = 333/333 (100.00%), Query Frame = -1
Query: 1068 MKTSRIRWHKIFNIIKFASFLLIILMFFHWLKTKEEKVKFSXXXXXXXXXXXXXXXXKQYCTFQNLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEFGKKLPIPTEDVKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINRTWSFVTDPPKPDPLMLTYSFHNFTSDHTLIDSNNRLKSVQLNDLKILSFYPVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQYPIQSKIKTFNYISKLCYSGYKIYLP 2066
            MKTSRIRWHKIFNIIKFASFLLIILMFFHWLKTKEEKVKFSNNLILNKNPPKKTKANKQYCTFQNLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEFGKKLPIPTEDVKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINRTWSFVTDPPKPDPLMLTYSFHNFTSDHTLIDSNNRLKSVQLNDLKILSFYPVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQYPIQSKIKTFNYISKLCYSGYKIYLP
Sbjct:    1 MKTSRIRWHKIFNIIKFASFLLIILMFFHWLKTKEEKVKFSNNLILNKNPPKKTKANKQYCTFQNLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEFGKKLPIPTEDVKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINRTWSFVTDPPKPDPLMLTYSFHNFTSDHTLIDSNNRLKSVQLNDLKILSFYPVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQYPIQSKIKTFNYISKLCYSGYKIYLP 333          
BLAST of GDP-fucose transporter 1-like vs. Planmine SMEST
Match: SMESG000066579.1 (SMESG000066579.1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 309/309 (100.00%), Postives = 309/309 (100.00%), Query Frame = 3
Query:   48 MEEINFDSSRNSAILYSFLAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTVHYPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIVIIQK 974
            MEEINFDSSRNSAILYSFLAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTVHYPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIVIIQK
Sbjct:    1 MEEINFDSSRNSAILYSFLAISFYWVSSLVYVFLNKSLIGLSNMNFEFMLFTVCIQNFIAIFLGHIADLFYFTVHYPTFTLSASELGMILSFIGILISNNYNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSILLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCLRTAYLMNFGAFIFLFPVVLYNLKSIKVSILDNTNYIKLLLLSGVVGFILGVALNNEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTVAYTIVIIQK 309          
BLAST of GDP-fucose transporter 1-like vs. Planmine SMEST
Match: SMESG000052805.1 (SMESG000052805.1)

HSP 1 Score: 171.785 bits (434), Expect = 1.950e-47
Identity = 96/293 (32.76%), Postives = 159/293 (54.27%), Query Frame = -1
Query: 1074 YCTFQNLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEFGKKLPI-------------PTEDVKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINRTWSFVTDPP----KPDPLMLTYSFHNFTSDHTLIDSNNRLKSVQLNDLKILSFYPVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQYPIQSKIKT----FNYISKLCYSGYKIY 1889
            +C+      L E+G   Q+ NRIPKI+HY YK+  +PN+ +  M+ C+ IN  VKFVFW++  AY F++  F + L +              ++ ++YFIL K GGI MD +TKC KPF  V    SC+L +E +  + IL++V ++A N+ MAC+ +HQF QY+++R    ++D      +  P+MLT +F ++      + + N  + + L +  + S Y V +LE+ CN  L  +WK   C  L      +K+KM E  ++   +    K      N ++ +C+  Y+I+
Sbjct:   51 FCSIITSDNLIEHGNLFQFPNRIPKIIHYVYKTSFIPNQYVALMKTCMEINYDVKFVFWSDLMAYRFMMNHFPEYLNVYSSYFSNFTDILKISDVIRYFILLKFGGIYMDFDTKCQKPFRLVFVNDSCILSKEVEEQTQILWNVPFLAMNSLMACVSNHQFFQYLVSRLN--ISDQSSSVHQTGPIMLTGTFKSYKKSTRQLKNKNISQKISLANSYLFSPYSVGNLESLCNYDLNHQWKIYGCLNLKAHREIQKRKMTEAVVLHLFLHLGYKDSKQKINNVTNICFIKYQIF 341          
BLAST of GDP-fucose transporter 1-like vs. Planmine SMEST
Match: SMESG000005599.1 (SMESG000005599.1)

HSP 1 Score: 161.77 bits (408), Expect = 4.240e-44
Identity = 107/314 (34.08%), Postives = 157/314 (50.00%), Query Frame = -1
Query: 1146 KIFNIIKFASFLLIILMFFHWLKTKEEKVKFSXXXXXXXXXXXXXXXXKQYCTFQNLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEFGKKLPI-------------PTEDVKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINRTWSFVTDP--PKPDPLMLTYSFHNFTSDHTLIDSNNRLK-SVQLNDLKILSFYPVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQ 2039
            K F I   ASFL +I      +K K E V                     +C   ++K L E+GR++QY+N IPKI+HY YK+  +P +    ++NC +IN   KFVFWT+F+AY FII  F   + +              ++ ++YFIL K GGI MD +T+C KPF   M   SC+L +E    + IL++  Y+A N+FMA +P H F +Y+I +     + P   +  P MLT +  ++     LI    + K SV L +  + S     +LE  C  +   KWK+K C+ L      +K KMKE   I 
Sbjct:    3 KFFEIFAIASFLPVICWTDRNIKNKLEFV-------------------CGHCDVISMKGLLEFGRRHQYANGIPKIIHYVYKTAYIPTQYSSHIKNCKAINKDAKFVFWTDFTAYRFIINNFLDYVKLYSSYFSKSTHSLKISDVIRYFILYKFGGIYMDLDTRCQKPFDMAMLNGSCILSQEVHEQTRILWNRPYLAMNSFMAVIPDHDFFKYLIEKLTMADSSPILSQTGPFMLTNTLESYIK---LISHQTKPKNSVSLANPYLYSPLTEHYLERLCKFQYT-KWKRKGCTHLNNHRQQQKVKMKEAVAIH 293          
BLAST of GDP-fucose transporter 1-like vs. Planmine SMEST
Match: SMESG000065880.1 (SMESG000065880.1)

HSP 1 Score: 157.532 bits (397), Expect = 1.531e-42
Identity = 84/264 (31.82%), Postives = 142/264 (53.79%), Query Frame = -1
Query: 1146 CTFQNLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVKFVFWTEFSAYMFIIKEFGKKLPI-------------PTEDVKYFILSKIGGISMDPNTKCVKPFSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINRTWSFVTDPP----KPDPLMLTYSFHNFTSDHTLIDSNNRLKSVQLNDLKILSFYPVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQ 1886
            C   +  ++  YG+  QY+N +PKI+HY YK+  +P++    ++NC+ IN  VKF+FW++F+ Y F++K F +   +              ++ ++YFIL K GGI MD +T+C KP    M   SC+L +E +  + IL++  Y+A N+FMA +P H+F QY+I +    V D      +  P  +T +  ++  +  + +  ++ K V L D  + S +   +LE +C    VG WK K C  L E    +K + K+  +I 
Sbjct:   29 CQTMSTSDILSYGKVQQYANGVPKIIHYVYKTAYIPSQYSPHVKNCLEINKGVKFIFWSDFTTYGFVLKHFQQNAKLFSSYFSKSVESLKISDVIRYFILFKFGGIYMDLDTQCQKPLEEAMKNGSCILSQEINEQTRILWNAPYLAMNSFMATIPDHEFFQYLIGKLT--VADSAHILYQTGPFFMTNALESY--NKLVRNVTDQSKLVILADSYLYSPFTERYLEGHCGGNPVGVWKVKGCKTLAEHRKQQKIRTKDAFVIH 288          
The following BLAST results are available for this feature:
BLAST of GDP-fucose transporter 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SLC35C11.039e-2228.09solute carrier family 35 member C1 [Source:HGNC Sy... [more]
SLC35C11.753e-2228.29solute carrier family 35 member C1 [Source:HGNC Sy... [more]
SLC35C13.580e-932.79solute carrier family 35 member C1 [Source:HGNC Sy... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nstp-102.090e-2731.31GDP-fucose transporter [Source:UniProtKB/Swiss-Pr... [more]
nstp-104.875e-2731.31GDP-fucose transporter [Source:UniProtKB/Swiss-Pr... [more]
nstp-93.005e-2026.30Nucleotide Sugar TransPorter family [Source:UniPr... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nac1.011e-1726.30gene:FBgn0265351 transcript:FBtr0081863[more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc35c13.702e-2427.95solute carrier family 35 member C1 [Source:ZFIN;Ac... [more]
slc35c13.702e-2427.95solute carrier family 35 member C1 [Source:ZFIN;Ac... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eri18.887e-1925.91exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-9741... [more]
eri11.198e-1825.91exoribonuclease 1 [Source:Xenbase;Acc:XB-GENE-9741... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Slc35c14.529e-2628.09solute carrier family 35, member C1 [Source:MGI Sy... [more]
Slc35c16.694e-2628.09solute carrier family 35, member C1 [Source:MGI Sy... [more]
Slc35c13.686e-932.79solute carrier family 35, member C1 [Source:MGI Sy... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q968A5|FUC10_CAEEL6.201e-2631.31GDP-fucose transporter OS=Caenorhabditis elegans O... [more]
sp|Q8BLX4|FUCT1_MOUSE4.682e-2528.09GDP-fucose transporter 1 OS=Mus musculus OX=10090 ... [more]
sp|A6QM03|FUCT1_BOVIN2.638e-2227.63GDP-fucose transporter 1 OS=Bos taurus OX=9913 GN=... [more]
sp|Q96A29|FUCT1_HUMAN8.418e-2228.29GDP-fucose transporter 1 OS=Homo sapiens OX=9606 G... [more]
sp|A9UUB8|FUCT1_MONBE1.780e-2124.83GDP-fucose transporter 1 OS=Monosiga brevicollis O... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF991.159e-2729.77Slc35c-1 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A1S3IE841.222e-2728.57GDP-fucose transporter 1-like OS=Lingula unguis OX... [more]
A0A1S3J1P35.178e-2727.94GDP-fucose transporter 1 OS=Lingula unguis OX=7574... [more]
A0A1A6HQX87.799e-2628.70TPT domain-containing protein OS=Neotoma lepida OX... [more]
A0A1I7U7T41.670e-2531.77TPT domain-containing protein OS=Caenorhabditis tr... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35c13.534e-2027.91solute carrier family 35 member C1 [Source:NCBI ge... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35c16.042e-1628.57solute carrier family 35 member C1 [Source:ZFIN;Ac... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SUR15.733e-1128.15Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
CSH15.302e-926.43Mannosylinositol phosphorylceramide (MIPC) synthas... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
SLC35C12.185e-2126.60GDP-fucose transporter 1 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc35c17.661e-1826.26solute carrier family 35 member C1 [Source:NCBI ge... [more]
back to top
BLAST of GDP-fucose transporter 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071232.10.000e+0100.00SMESG000071232.1[more]
SMESG000066579.10.000e+0100.00SMESG000066579.1[more]
SMESG000052805.11.950e-4732.76SMESG000052805.1[more]
SMESG000005599.14.240e-4434.08SMESG000005599.1[more]
SMESG000065880.11.531e-4231.82SMESG000065880.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026116 ID=SMED30026116|Name=GDP-fucose transporter 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2174bp
TTTTTTTTTAGAATTGATTTCATTTGTATCATATTAAAATTATATAAATG
GAAGAAATTAATTTTGATTCTTCAAGAAATTCCGCCATATTGTATTCATT
TTTAGCAATATCATTTTATTGGGTTTCATCTTTGGTTTATGTTTTTCTCA
ACAAATCCTTAATTGGATTATCGAATATGAATTTTGAATTTATGTTATTC
ACAGTGTGCATTCAAAATTTTATAGCCATATTTCTTGGTCATATTGCGGA
TTTATTTTATTTTACTGTTCATTATCCAACATTTACCTTATCTGCAAGTG
AATTAGGAATGATTCTAAGTTTCATTGGAATTCTAATTTCAAATAACTAT
AATTTGAAATTCGGCGGAATAGCTTTCTTTCACGTGTCAAGATCCTGGAC
GATTTTATTCATGTTAATATTGTCAAAATTAATTTACGAAAGTTTTATAA
TTCCAAATAAAATAATTGTTATTGCAACTATCTTGACTCTGTCAATTCTT
TTGGTAGTGCGAGAAGAGAGTTCTCAAGGAACATTATCAATAAAGGCGGT
CGTTTGCGGATTTCTGTCAAGTTTGCTTACGGCAATTAATGTTATGTCGA
TAAGAAATGAACAGAAAATACATAGAGATTGTTTGCGAACAGCTTATTTA
ATGAATTTTGGGGCATTTATATTTCTGTTTCCAGTAGTATTATATAATTT
AAAATCAATAAAAGTTTCAATATTAGATAATACTAATTATATAAAATTGC
TATTATTATCCGGAGTGGTAGGATTTATTCTGGGCGTAGCACTCAACAAT
GAAATGACTTACATAAATCCAATTAGTCATCAGATTAGTACAAGTATGAA
GTCAGTAGTACAGACGGTTTTTGGGTCCATTGTTTACAAAGAAAACAAAA
GTACTTCGTGGTGGTTTTACAATTTAGCAATTTTTCTATGCACAGTCGCC
TATACAATCGTGATAATTCAGAAATAATTACTAAATTATTGATTTTAAAT
TTAATTTCCTTGTAAACTGAAATTTTATTTTTAAACTTTATTTTCTATTT
TTTAATGATTATAGAATAGGTAGATATATTTTATATCCTGAATAACACAA
TTTACTTATGTAATTAAATGTTTTAATTTTTGATTGTATCGGGTATTGAA
TGATCGCAATTTCTTTCATTTTCTGTTTCCTATAACTGAAAATTTCCCAA
AGTTTTGAGCAACTCTTTTTTTTCCATTTACCAACCAACTTTCTGTTGCA
ATAATTTTCCAAATGTTCTACAGGATAAAAAGATAAGATTTTCAAATCAT
TCAATTGAACCGATTTGAGTCGATTATTCGAATCTATCAAAGTATGATCC
GAGGTGAAATTGTGGAAAGAATAAGTAAGCATTAATGGGTCAGGTTTTGG
GGGGTCAGTAACAAATGACCATGTTCTATTAATCATATATTGTAAGAATT
GATGGCTTGGCAAACAGGCCATAAAATTATTCGATGCCATATATTTAACA
TCATATAAAATCCCTGACATTATATCATTTTCTCTGTGCAAAACGCAACT
GCTTTCCGTCATGACTGTACTAAATGGTTTCACGCATTTCGTGTTGGGAT
CCATTGAAATGCCCCCGATTTTTGATAAAATAAAATATTTGACATCTTCA
GTAGGGATGGGCAATTTTTTCCCAAATTCTTTGATAATAAACATATAAGC
AGAAAATTCTGTCCAAAACACAAATTTCACTTTGGAATTGATTGAAATGC
AATTTCTCATAAATTCGATAATTTCATTTGGCAGAACTTGTGATTTGTAG
AAATAATGGACAATTTTTGGAATTCGATTGGAGTACTGATTTTGCCGTCC
GTATTCGGACAATTCTTTCAAATTTTGAAATGTGCAATATTGTTTATTTG
CTTTTGTTTTTTTCGGTGGATTTTTGTTTAAAATGAGATTATTTGAGAAT
TTCACTTTTTCTTCTTTCGTTTTCAACCAGTGAAAAAACATCAAAATAAT
CAATAAAAAGCTTGCAAATTTTATTATGTTAAATATTTTATGCCAGCGAA
TCCTTGATGTTTTCATCTTACTTTTGGTGCTGGAATACAAAAATACGATT
TGATTCAAAAGTTTAAGTGAGTTTAATTTTTGGTAGCTAAACTGACATAA
AATGGCCTTGTCAGCAGTCTTTAT
back to top

protein sequence of SMED30026116-orf-1

>SMED30026116-orf-1 ID=SMED30026116-orf-1|Name=SMED30026116-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=372bp
IKTADKAILCQFSYQKLNSLKLLNQIVFLYSSTKSKMKTSRIRWHKIFNI
IKFASFLLIILMFFHWLKTKEEKVKFSNNLILNKNPPKKTKANKQYCTFQ
NLKELSEYGRQNQYSNRIPKIVHYFYKSQVLPNEIIEFMRNCISINSKVK
FVFWTEFSAYMFIIKEFGKKLPIPTEDVKYFILSKIGGISMDPNTKCVKP
FSTVMTESSCVLHRENDIMSGILYDVKYMASNNFMACLPSHQFLQYMINR
TWSFVTDPPKPDPLMLTYSFHNFTSDHTLIDSNNRLKSVQLNDLKILSFY
PVEHLENYCNRKLVGKWKKKSCSKLWEIFSYRKQKMKEIAIIQYPIQSKI
KTFNYISKLCYSGYKIYLPIL*
back to top

protein sequence of SMED30026116-orf-2

>SMED30026116-orf-2 ID=SMED30026116-orf-2|Name=SMED30026116-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=310bp
MEEINFDSSRNSAILYSFLAISFYWVSSLVYVFLNKSLIGLSNMNFEFML
FTVCIQNFIAIFLGHIADLFYFTVHYPTFTLSASELGMILSFIGILISNN
YNLKFGGIAFFHVSRSWTILFMLILSKLIYESFIIPNKIIVIATILTLSI
LLVVREESSQGTLSIKAVVCGFLSSLLTAINVMSIRNEQKIHRDCLRTAY
LMNFGAFIFLFPVVLYNLKSIKVSILDNTNYIKLLLLSGVVGFILGVALN
NEMTYINPISHQISTSMKSVVQTVFGSIVYKENKSTSWWFYNLAIFLCTV
AYTIVIIQK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005457GDP-fucose transmembrane transporter activity
Vocabulary: biological process
TermDefinition
GO:0036085GDP-fucose import into Golgi lumen
GO:0006810transport
GO:0008643carbohydrate transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR32385FAMILY NOT NAMEDcoord: 33..265
NoneNo IPR availableTMHMMTMhelixcoord: 47..66
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 66..253