Hydin_ADK domain-containing protein

Overview
NameHydin_ADK domain-containing protein
Smed IDSMED30026109
Uniprot Best hitHydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3 (E=0)
Length (bp)15435
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Hydin_ADK domain-containing protein (SMED30026109) t-SNE clustered cells

Violin plots show distribution of expression levels for Hydin_ADK domain-containing protein (SMED30026109) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Hydin_ADK domain-containing protein (SMED30026109) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Hydin_ADK domain-containing protein (SMED30026109) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026109

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026109SMESG000016228.1 SmedASXL_018458SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026109SMESG000016228.1 dd_Smed_v6_7302_1_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30026109SMESG000016228.1 dd_Smed_v4_7302_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 1751.49 bits (4535), Expect = 0.000e+0
Identity = 1005/2773 (36.24%), Postives = 1553/2773 (56.00%), Query Frame = 3
Query: 7215 ISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAH----PPIKPNQVPVEQHGENVNEENSTNPLK-RVGR----------TTVFNKRSKDHGANSGQVPPHTPVHDEN--PEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKI-IQQKLETE-LPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHY----------------------NFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNI------------KSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNA-----TEPGP-VTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFT------PRSSRPNTARQGKYETIKKXXXXXXDLN----NPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEP-QQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            + ++ ++S  +  KDP K+    L  KFKT++   K +  I+  WDR      PP    + P E       ++    PL  R GR               +R +   A   ++     + + +       E      E+  GVP + I+       D E +  +Q LE++ LPK +++L+ LGLG  GPPIPPPA FSIV YP++R    +++ L    H+                      +F+ T      ++      +  + K  EKI +   IQ    K  R       V         S    ++L NF  + S              +   ++   RWI+  + E+ L++ F SDE G FDQ FNFEIL T  +YQ++CRGIC +P I ++P++VFP RK + + NE++ KKY++  E + FGPLL  K + +  +  +P NME + I N+S M+ E +F F +D     + L+P +M L+P E Q LN+WA+P     FED+I+CC+ +NPEP I+++SC G+ P +EL+ + +HF+R+LLHR++ + V LRN T LPV WRIT LE LGD+F+ +   GTI   +E+ L+ YF+  KP   N KK IRLE+ D E L G++Q E + + AEAYD+ALD++FPKGA  GLD G ++V +E KQ + LKNRG YEI + F +D       N++++ ++ P +G ++P EK   VQ+ + AK+EV I+ + +L+C +IEPNI++ GE+IA IPI+ SA + YSKY ITP + INFG++   TRK+    IEN G  DF+F +            K+    ++       S  +TG   +     + Q E    G  Q+R   G FT++P  G +P+    ++ VDC++D  GKC+E + IDI+ R+P + P G+LY L  EA +P+  + N + IFEEH+IC T   ++  L  + SGG++ + EN+F+F NVLVG + +A+F++ N   + CD+++ ++P+         +  A + DIFEVEP++  I      + +V F+P  MQ Y  IF+  ++GLPS +L +S+ L F++ GEG LPRV V +P L N+    L LFK+ LLG  +   + L N+G LP ++H+D+ D    F +      A      E  P V +K+ H   L +  G    FDV+F  +  G+    I ++V+NNQYE+T I ++GEGYED IT +N   I   + P +         T+ +     E+++ A   + + FGDC+I    + SF++ NHS+   +RF WP   S+T        + FSP +GHLHPG A  ++ T++S  P       I+CKL RI M  L +   P +WDD   T+KW+DVP +  +      K+KVIET+ EP  + + E  + L L I+AN+++  Y C+  ++ F++T++++TR++   V N G++++++ W +  D S   +        S++ +   QG   T    +   +        PFS+ P  G++   + Q+F+V F+PL++  +++ + C+I NL P    P +   GRS  P CHF+L DSDY+   +R+P +R       G  ++PNTRVIE   +G+  ++++ F ++NPT + + + WI E+ E  +N     CL   G +   KK +  FQFT   +G+TES W F IPE  I VPFL+VG+ TEP ++ +KSH  F +LLIG E+ ETV+IIN + Q ++F+FQD SR++ G SNSL + PM G IP   +  I I FT      +NFNL C V+KK +P+++NVKAEGY+++  +  +D TG    LTP          N IN   +E+ E        +N G+F + F   +       L   L  +PI  TV +G+ +   L     +   L  +  ++ I +G +++ NI+     P + FSF+ ++FG CF+Y+ GM      LVITN++     + P+S++CL  +      N    V+ PG++  I ITF PR+   YQ+ + FEING+S+  V++ G   ++K+  +D  N  + LG V  G+ V +TV+I N +   +T       T  ELQ+  V  + P    I + P +     ++++F P +R+  F+EEV  E +G+  P+F+++G CQA +I  D E I FG V   +  T+++ M+N GD+GARFKW+   F+P FSI+P  GYI+ GME+ FE+++ P +   +    N+ C I+G   LSL L+GVC     VKE++NF   VR +  +++ + N TN TW L P+ EGEHW G E   +E  QQ K YE+T++P TM  + +KHQG++F  +PDG+G LY L G +E PKA++ I REVP + P++ELL + NWL +PQRF+VI E+LKPEK + S+ +KG +Y+DV  G  K YKL   + KEG    KV F NE T EF +Y +  +         I++ TPVRQ    S+ LEN     + +      P+I   +QF V + S+  F+FEF PL+  E+  +L + + D     Y+L L  TP+ PE+P+ F T +GS Q +L  F N+ + ++++ C+ D T FH +K I  AP      EA +EV FEP+ LGE+KG+L +S+   GE+I PL G+A PPKPQGPF I+ G S+ I F+NVF     F   +D+  F I +  E+++  K + + ++F+G+  G   P+  KL V+CP  E     ++WVYYL+G
Sbjct: 2434 LVQDQEDSEGDNSKDPDKQ----LAPKFKTYELTLKDVQNILMYWDRKQGVQLPPAGMEEAPHEP------DDQRQVPLGGRRGRKDRERERLEKERTEKERLEREKAERERLEKLRALEERSDWEGEGEEDHEGKKEKDLGVPFLDIQTP-----DFEGLSWKQALESDKLPKGEQILDILGLGASGPPIPPPALFSIVSYPVKRPPLTMTDDLE---HFVFVIPPSEDISLDEKKEMEIESDFLATTNTTKAQEEQTSSSKGGKQKMKEKIDQVFEIQ----KDKRHMALNRKVLSGEPAGTISQLSDTDLDNFNGQHS-------------QEKFTRLNHFRWIVPANGEVTLQVHFSSDEFGNFDQTFNFEILGTCCQYQLYCRGICTYPYICQDPKVVFPQRKMDMKTNEVIFKKYVMSTETYYFGPLLCGKSRDKYKSSLFPGNMETLTILNTSLMVVEASFYFQNDVKANTYFLEPNTMVLKPNEKQILNVWAYPTSVGVFEDSIVCCINDNPEPAIFQLSCQGIRPELELEPRQLHFDRLLLHRQESRVVLLRNVTLLPVAWRITSLEHLGDDFTVSLMQGTIPPEAEYGLHLYFQPTKP--VNIKKAIRLEVLDAENLLGVVQIENIMVFAEAYDIALDITFPKGAEGGLDFGIVRVTEEAKQPLQLKNRGKYEIAFSFSVDSVGISTPNINSMISVQPKKGSLTPTEKPTNVQVFFHAKKEVKIEHQPVLRCQIIEPNISEGGEIIASIPIKFSANAVYSKYNITPSSVINFGALICGTRKSTTFTIENQGVTDFKFALYKLTGESPIHQKKAASHVRHARSRESESFYKTGSSRAAKFSDTIQKEVTTTG--QARFAHGMFTVYPGFGSIPSGGQQVINVDCVADAMGKCEEFIAIDISGRDPAVHPAGILYTLLAEACLPAFVTENNALIFEEHQIC-TSANLHHILQTIESGGLFVEDENKFIFCNVLVGRQAKARFKISNVGKITCDVNIVVRPI-------SNKPFARIVDIFEVEPSKMCIASHSHAFATVSFTPQIMQNYQCIFEATLDGLPS-TLAKSRGLVFDIAGEGNLPRVTVVRPVLHNQYGNPLLLFKRLLLGHSEKLPLILKNNGVLPAQLHVDLQDELGVFSLKGRPTTAYIYITEENKPHVKAKKAHTASLVVSPGDTAEFDVVFHSQKVGRMRGIIHLSVINNQYEETSIHMVGEGYEDDITLDN---IHGLVAPTSQEDISISEFTEIIEDNDMEDLVAAALVDHIQFGDCHIGHSYNASFTVTNHSQVNLIRFEWPV--SAT--------IAFSPQMGHLHPGCAKDIVVTMKSDVPINLKNMRIRCKLSRI-MFQLPADQVP-DWDDRMHTVKWVDVPRN--MPGTFTTKRKVIETDPEPAHSVLEENYQELQLQISANVDFASYHCQARDVRFKETLVYQTRVFEFDVINSGRVQLEFSW-VSEDTSKAVSFAKPDHQGSAQKDQLSQGTMHTGSTLDSTMDHWAEGSPQPFSVEPSSGIVPVGKIQKFKVKFSPLDIGDFESNLFCQIPNLPPGEQGPVLVAKGRSTLPICHFDLKDSDYISGHQRNPELR----GSSGGALDPNTRVIEFTTVGIGGKNLRTFTILNPTNSTYSFCWISEEIESLQNPAAFTCLTEKGFIHPEKKAEIVFQFTPFHLGITESSWTFLIPEHNITVPFLLVGKTTEPLISLNKSHLNFSSLLIGREARETVQIINKEEQGFDFSFQDNSRYSEGFSNSLLVCPMEGWIPPLSRFPIDIFFTPKQEGDVNFNLICNVEKKVHPVTLNVKAEGYTMNVEIKCKDRTGSITLLTPNQT-------NIINFYEVELNECVQCEFNFINTGKFTFSFQAQLCGSK--TLLQYLEFSPIDSTVDVGQSVHATLSFQPLKKCVLTDLELIIKISHGPTFMCNISGCAVSPAIHFSFTSYNFGTCFIYQAGMPPYKQTLVITNKE-----ETPMSIDCLYTNTTHLEVNSRVDVVKPGNTLEIPITFYPRESINYQELIPFEINGLSQQTVEIKGKGTKMKILVLDPANRIVKLGAVLPGQVVKRTVSIMNNSLAQLTFNQSILFTIPELQEPKVLTLAPF-HNITLKPKE--VCKLEVIFAPKKRVPPFSEEVFMECMGLLRPLFLLSGCCQALEISLDQEHIPFGPVVYQTQATRRILMMNTGDVGARFKWDIKKFEPHFSISPEEGYITSGMEVSFEVTYHPTEVGKESLCKNILCYIQGGSPLSLTLSGVCVGPPAVKEVVNFTCQVRSKHTQTILLSNRTNQTWNLHPIFEGEHWEGPEFITLEAHQQNKPYEITYRPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTSELPKAVANIYREVPCKTPYTELLPITNWLNKPQRFRVIVEILKPEKPDLSITMKGLDYIDVLSGSKKDYKLNFFSHKEGTYAAKVIFRNEVTNEFLYYNVSFRVIPSGIIKTIEMVTPVRQVASASIKLENPLPYSVTFSTECRMPDIALPSQFVVPANSEGTFSFEFQPLKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQRTEYYCRTDCTDFHAEKLINAAPGGQGGTEASVEVLFEPSHLGETKGILILSSLAGGEYIIPLFGMALPPKPQGPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTI-RAGESVRPKKINNITVSFEGNPSGSKTPITTKLTVSCPPGEGSETGVKWVYYLKG 5118          

HSP 2 Score: 1456.81 bits (3770), Expect = 0.000e+0
Identity = 835/2308 (36.18%), Postives = 1331/2308 (57.67%), Query Frame = 3
Query:  114 IGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILA-----ADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKA-----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNE--FSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPN-IIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPS---ISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSF------------SEYYQETKKEFVEKNIELSEEELM--TYLEDLAVTNQPKKPLN---------KAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSE-IDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKY-------NEAPEASEIEQLENSIANKKDASQTFSKSA-----------------------------------MSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGT--QGGLA--IFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNI--QIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEE 6734
            +G +N F      + SKV+ P +PK++ +      +TPSEF+ +MSL T ++L  T+ M  P  IELLDMG TT+QK + + ++  LFQPFPS + F N  P E YE+PLILRNNDK+PRLVKV  E SPYF V+SP ++ HKVA G+P +F+I FTPE+ +DY   L  VTEREKFIVPI   G+RAILDFPD++ F   P+KY+  K L +RNIG+  A F I T  PFS+EP    L V ESMQ++V+F P+   D S  +I+ Y+TGE V+  ++G+  ++ +R++++ + IE+TY+ LAN R IT+HNRS+++ HF W  F++Q  ED ++      L  EE +E + F  +     L  + LS+++R++ N++++ +     F +++FT++P+EGD+WP++S +ITV F P+EA+ YQ   +C++ GRE RL L+I G G+GPK+ F+F+ LD+G +F  + HCYE IL NKG IDALF +    S +  CF F+P +G+I PS  Q +QI F S   LG F + F V ++G  EP  +  +G VIGPTF F+V  + FG+VS GFP +   SL NTSL+P+ ++LR+P DG     ++      D       +E  S  +P+EF+I P  G +       I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VP + L   E+DF   FL+Y YEK +++ N   LP  YE+  Q  E+   +L+SS   + ++SP+S + IP+ L+    GE  + V+  IFGS   PL   +K  GEGPV+ +    +D+G I VL+D S  L L N+S IPA F A M   +S++ +EP  G++     + L + ANLND + F D + L IENS T  +P+ A G G+TI  D P +  +NLG+HFS       +++IN+G+R QQL W N+ +     + + G      A                 P+  +HP   +L PG++  ++++GY   P++V+E ++CH+IIG Q GK L+  V++   F++P+++ S + L +RL+K  ++  +   + +   N+S L +N  L+   PF I E ++     + + + L  ++ + + I+F+P +++D ++ + ++ L + + EHP +D + L GEV++PNL F+   ++F CILN +E+ ++V + N SPL V++ W  LV D+ N I F     +P   P S+   + AT +  +         + + DLN           + K + + E+ + + + L K +    +    K S   I  +  +  ++E  E L+T    +NE++ +GIEE+FD+ PL+G L+P+S  QI+FT++GH+++ A   A+CEVE GPTY   L GEAS V Y F   +  +G  L+D V  +E+TL+N+GKVGFEF         P N  P G P+++P SGF+ +    ++ V YL G P  F  S  IQ+AH   E I++SG G FP++ +DLPRN      ++N   ++F  +   +TDK +            +E   E +   V  ++++  E L+  +Y+ +   T  P  P++         + + K+ LP Y L+FG +I+G V +  ++I NT HFP++    K  + + GF   L +VKNLP  E   FE+ FDP+ ANL +G  E  L + ++GGP+V + L A VT+P +  S   V+F  ++ G+  + TIQL N   V  EW   + + +D++ K      + P+ LR+K     +     +FE+ P +G L PG+K NVQ+KFMP +EK YS  LV  +A S++++ +   G GLEP+LEF  S +  GP+L    G E  + ++NPC+FPIE YSLEFD+ YL +E+ILR + GYDS+  LL+PPR  G+KLP E  EY+ E  K   E     Q   KY       NE  + +  +Q  ++   +   S+  S ++                                    SI +     + E+E  PVS+AIAR+LG++++ EG+ A+  +GIAI++ G+P+SGK+  +  +A+ Y+AA L++D I++EA+A+ +     +AR+LC+ AA    V + E+ A++ ++ +    QG L+     +    +T +   ++   + + S V    +     + S K H + +++  T  + SSP P  GP    L++   + GE   L++C+LPDE++++IL+ER+ LSDC +G+VFDGL+ LF+Q+ +     +L ++ +R  +Y + + +D+ ++K +E  ++E
Sbjct:   15 MGLVNMFK----GFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTEQRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTCVTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLDKNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSST-ILGNFEEEFLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYKLRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQASGTGSTIVSDKPFAPELNLGAHFSLDTHYYHFKLINKGRRIQQLFWMNDSFRPQAKLSKKGRVKKGHAHVQPQPSGSQEPRDPQSPVFHLHPASMELYPGQAIDVILEGYSATPRIVKEKLVCHAIIGAQKGKSLVMAVNITCEFVAPLIQLSTKQLIYRLEKKPNSILKPDYQPLAIKNISTLPVNLLLSTSGPFFICETDKSLLPATPEPIKLEIDEEKNLLIKFDPSYRNDLNNWVAEEILAIKYVEHPQIDSLDLRGEVHYPNLSFETKELDFGCILNDTELIRYVTITNCSPLVVKFRWFFLVNDEENQIRFVTLPKKPYSAPVSQMESIPATSEAASPPAILVTVESPEMDLN----------DFVKTVLVDEDARPEEKELRKTKASSVISDEIKISSTEIERIYSSQSQVEDQESLQTC--EQNEMLSIGIEEVFDILPLFGVLQPHSSHQISFTFYGHANIIAQAKALCEVEEGPTYEITLKGEASLVNYSFDTKDIHYGLQLFDHVTEREITLTNMGKVGFEFKVLTDHQSSPDNLLP-GVPLILPVSGFISSHQEQVLKVYYLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRN-----LTANEKYEMFLNQARKNTDKEYNKCEMLDHFDIITEEVPEDEPAEVSAHLQMEVERLIVQSYVLEHQKTTTP-DPMDDPCFSHRSRRKLAKIQLPEYILDFGYIILGEVRTHIIKIINTSHFPVSFHADKRVLHETGFSTELDRVKNLPHCETEIFEVRFDPQGANLPVGSKEVILPIKVVGGPTVHICLQAKVTIPTMTLSRGKVDFATIQCGQCLVETIQLSNHLQVPCEWFVQSQKPVDKLEK------HMPKYLRQKLRAELKPKT-RIFEIQPISGVLDPGEKSNVQVKFMPKEEKFYSQTLVFQIAQSAQKLTLLARGQGLEPRLEFSPSVLDLGPLLLCAPGDEAEVIVKNPCNFPIEFYSLEFDQQYLIEEKILRKLKGYDSYNTLLLPPRNPGEKLPPELYEYFKEIKKSKEE-----QMRAKYLENLAQENEEEDITSSDQGTSNSTKRTSLSRGISVTSNLEEWHALLVESKTYLEEEEDEESLEKIIFQTDKLQSIDSHSMEEVGEVENNPVSKAIARHLGIDISAEGRLAKNRKGIAIIIHGTPLSGKSANAVSVAKYYNAACLSIDSIVLEAVANSNNIPGIRARELCIRAAIEQSVKEGEEAAQEAAVGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSE--TPQISSSPLP-PGPIHRWLSVSPSVGGET-GLMSCVLPDELLVQILAERIQLSDCYRGVVFDGLDTLFAQNAAAALLCLLKAIGSREHIYILNMAQDYAAMKAQEKAKKE 2282          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 1751.49 bits (4535), Expect = 0.000e+0
Identity = 1005/2773 (36.24%), Postives = 1553/2773 (56.00%), Query Frame = 3
Query: 7215 ISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAH----PPIKPNQVPVEQHGENVNEENSTNPLK-RVGR----------TTVFNKRSKDHGANSGQVPPHTPVHDEN--PEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKI-IQQKLETE-LPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHY----------------------NFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNI------------KSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNA-----TEPGP-VTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFT------PRSSRPNTARQGKYETIKKXXXXXXDLN----NPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEP-QQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            + ++ ++S  +  KDP K+    L  KFKT++   K +  I+  WDR      PP    + P E       ++    PL  R GR               +R +   A   ++     + + +       E      E+  GVP + I+       D E +  +Q LE++ LPK +++L+ LGLG  GPPIPPPA FSIV YP++R    +++ L    H+                      +F+ T      ++      +  + K  EKI +   IQ    K  R       V         S    ++L NF  + S              +   ++   RWI+  + E+ L++ F SDE G FDQ FNFEIL T  +YQ++CRGIC +P I ++P++VFP RK + + NE++ KKY++  E + FGPLL  K + +  +  +P NME + I N+S M+ E +F F +D     + L+P +M L+P E Q LN+WA+P     FED+I+CC+ +NPEP I+++SC G+ P +EL+ + +HF+R+LLHR++ + V LRN T LPV WRIT LE LGD+F+ +   GTI   +E+ L+ YF+  KP   N KK IRLE+ D E L G++Q E + + AEAYD+ALD++FPKGA  GLD G ++V +E KQ + LKNRG YEI + F +D       N++++ ++ P +G ++P EK   VQ+ + AK+EV I+ + +L+C +IEPNI++ GE+IA IPI+ SA + YSKY ITP + INFG++   TRK+    IEN G  DF+F +            K+    ++       S  +TG   +     + Q E    G  Q+R   G FT++P  G +P+    ++ VDC++D  GKC+E + IDI+ R+P + P G+LY L  EA +P+  + N + IFEEH+IC T   ++  L  + SGG++ + EN+F+F NVLVG + +A+F++ N   + CD+++ ++P+         +  A + DIFEVEP++  I      + +V F+P  MQ Y  IF+  ++GLPS +L +S+ L F++ GEG LPRV V +P L N+    L LFK+ LLG  +   + L N+G LP ++H+D+ D    F +      A      E  P V +K+ H   L +  G    FDV+F  +  G+    I ++V+NNQYE+T I ++GEGYED IT +N   I   + P +         T+ +     E+++ A   + + FGDC+I    + SF++ NHS+   +RF WP   S+T        + FSP +GHLHPG A  ++ T++S  P       I+CKL RI M  L +   P +WDD   T+KW+DVP +  +      K+KVIET+ EP  + + E  + L L I+AN+++  Y C+  ++ F++T++++TR++   V N G++++++ W +  D S   +        S++ +   QG   T    +   +        PFS+ P  G++   + Q+F+V F+PL++  +++ + C+I NL P    P +   GRS  P CHF+L DSDY+   +R+P +R       G  ++PNTRVIE   +G+  ++++ F ++NPT + + + WI E+ E  +N     CL   G +   KK +  FQFT   +G+TES W F IPE  I VPFL+VG+ TEP ++ +KSH  F +LLIG E+ ETV+IIN + Q ++F+FQD SR++ G SNSL + PM G IP   +  I I FT      +NFNL C V+KK +P+++NVKAEGY+++  +  +D TG    LTP          N IN   +E+ E        +N G+F + F   +       L   L  +PI  TV +G+ +   L     +   L  +  ++ I +G +++ NI+     P + FSF+ ++FG CF+Y+ GM      LVITN++     + P+S++CL  +      N    V+ PG++  I ITF PR+   YQ+ + FEING+S+  V++ G   ++K+  +D  N  + LG V  G+ V +TV+I N +   +T       T  ELQ+  V  + P    I + P +     ++++F P +R+  F+EEV  E +G+  P+F+++G CQA +I  D E I FG V   +  T+++ M+N GD+GARFKW+   F+P FSI+P  GYI+ GME+ FE+++ P +   +    N+ C I+G   LSL L+GVC     VKE++NF   VR +  +++ + N TN TW L P+ EGEHW G E   +E  QQ K YE+T++P TM  + +KHQG++F  +PDG+G LY L G +E PKA++ I REVP + P++ELL + NWL +PQRF+VI E+LKPEK + S+ +KG +Y+DV  G  K YKL   + KEG    KV F NE T EF +Y +  +         I++ TPVRQ    S+ LEN     + +      P+I   +QF V + S+  F+FEF PL+  E+  +L + + D     Y+L L  TP+ PE+P+ F T +GS Q +L  F N+ + ++++ C+ D T FH +K I  AP      EA +EV FEP+ LGE+KG+L +S+   GE+I PL G+A PPKPQGPF I+ G S+ I F+NVF     F   +D+  F I +  E+++  K + + ++F+G+  G   P+  KL V+CP  E     ++WVYYL+G
Sbjct: 2434 LVQDQEDSEGDNSKDPDKQ----LAPKFKTYELTLKDVQNILMYWDRKQGVQLPPAGMEEAPHEP------DDQRQVPLGGRRGRKDRERERLEKERTEKERLEREKAERERLEKLRALEERSDWEGEGEEDHEGKKEKDLGVPFLDIQTP-----DFEGLSWKQALESDKLPKGEQILDILGLGASGPPIPPPALFSIVSYPVKRPPLTMTDDLE---HFVFVIPPSEDISLDEKKEMEIESDFLATTNTTKAQEEQTSSSKGGKQKMKEKIDQVFEIQ----KDKRHMALNRKVLSGEPAGTISQLSDTDLDNFNGQHS-------------QEKFTRLNHFRWIVPANGEVTLQVHFSSDEFGNFDQTFNFEILGTCCQYQLYCRGICTYPYICQDPKVVFPQRKMDMKTNEVIFKKYVMSTETYYFGPLLCGKSRDKYKSSLFPGNMETLTILNTSLMVVEASFYFQNDVKANTYFLEPNTMVLKPNEKQILNVWAYPTSVGVFEDSIVCCINDNPEPAIFQLSCQGIRPELELEPRQLHFDRLLLHRQESRVVLLRNVTLLPVAWRITSLEHLGDDFTVSLMQGTIPPEAEYGLHLYFQPTKP--VNIKKAIRLEVLDAENLLGVVQIENIMVFAEAYDIALDITFPKGAEGGLDFGIVRVTEEAKQPLQLKNRGKYEIAFSFSVDSVGISTPNINSMISVQPKKGSLTPTEKPTNVQVFFHAKKEVKIEHQPVLRCQIIEPNISEGGEIIASIPIKFSANAVYSKYNITPSSVINFGALICGTRKSTTFTIENQGVTDFKFALYKLTGESPIHQKKAASHVRHARSRESESFYKTGSSRAAKFSDTIQKEVTTTG--QARFAHGMFTVYPGFGSIPSGGQQVINVDCVADAMGKCEEFIAIDISGRDPAVHPAGILYTLLAEACLPAFVTENNALIFEEHQIC-TSANLHHILQTIESGGLFVEDENKFIFCNVLVGRQAKARFKISNVGKITCDVNIVVRPI-------SNKPFARIVDIFEVEPSKMCIASHSHAFATVSFTPQIMQNYQCIFEATLDGLPS-TLAKSRGLVFDIAGEGNLPRVTVVRPVLHNQYGNPLLLFKRLLLGHSEKLPLILKNNGVLPAQLHVDLQDELGVFSLKGRPTTAYIYITEENKPHVKAKKAHTASLVVSPGDTAEFDVVFHSQKVGRMRGIIHLSVINNQYEETSIHMVGEGYEDDITLDN---IHGLVAPTSQEDISISEFTEIIEDNDMEDLVAAALVDHIQFGDCHIGHSYNASFTVTNHSQVNLIRFEWPV--SAT--------IAFSPQMGHLHPGCAKDIVVTMKSDVPINLKNMRIRCKLSRI-MFQLPADQVP-DWDDRMHTVKWVDVPRN--MPGTFTTKRKVIETDPEPAHSVLEENYQELQLQISANVDFASYHCQARDVRFKETLVYQTRVFEFDVINSGRVQLEFSW-VSEDTSKAVSFAKPDHQGSAQKDQLSQGTMHTGSTLDSTMDHWAEGSPQPFSVEPSSGIVPVGKIQKFKVKFSPLDIGDFESNLFCQIPNLPPGEQGPVLVAKGRSTLPICHFDLKDSDYISGHQRNPELR----GSSGGALDPNTRVIEFTTVGIGGKNLRTFTILNPTNSTYSFCWISEEIESLQNPAAFTCLTEKGFIHPEKKAEIVFQFTPFHLGITESSWTFLIPEHNITVPFLLVGKTTEPLISLNKSHLNFSSLLIGREARETVQIINKEEQGFDFSFQDNSRYSEGFSNSLLVCPMEGWIPPLSRFPIDIFFTPKQEGDVNFNLICNVEKKVHPVTLNVKAEGYTMNVEIKCKDRTGSITLLTPNQT-------NIINFYEVELNECVQCEFNFINTGKFTFSFQAQLCGSK--TLLQYLEFSPIDSTVDVGQSVHATLSFQPLKKCVLTDLELIIKISHGPTFMCNISGCAVSPAIHFSFTSYNFGTCFIYQAGMPPYKQTLVITNKE-----ETPMSIDCLYTNTTHLEVNSRVDVVKPGNTLEIPITFYPRESINYQELIPFEINGLSQQTVEIKGKGTKMKILVLDPANRIVKLGAVLPGQVVKRTVSIMNNSLAQLTFNQSILFTIPELQEPKVLTLAPF-HNITLKPKE--VCKLEVIFAPKKRVPPFSEEVFMECMGLLRPLFLLSGCCQALEISLDQEHIPFGPVVYQTQATRRILMMNTGDVGARFKWDIKKFEPHFSISPEEGYITSGMEVSFEVTYHPTEVGKESLCKNILCYIQGGSPLSLTLSGVCVGPPAVKEVVNFTCQVRSKHTQTILLSNRTNQTWNLHPIFEGEHWEGPEFITLEAHQQNKPYEITYRPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTSELPKAVANIYREVPCKTPYTELLPITNWLNKPQRFRVIVEILKPEKPDLSITMKGLDYIDVLSGSKKDYKLNFFSHKEGTYAAKVIFRNEVTNEFLYYNVSFRVIPSGIIKTIEMVTPVRQVASASIKLENPLPYSVTFSTECRMPDIALPSQFVVPANSEGTFSFEFQPLKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQRTEYYCRTDCTDFHAEKLINAAPGGQGGTEASVEVLFEPSHLGETKGILILSSLAGGEYIIPLFGMALPPKPQGPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTI-RAGESVRPKKINNITVSFEGNPSGSKTPITTKLTVSCPPGEGSETGVKWVYYLKG 5118          

HSP 2 Score: 1456.81 bits (3770), Expect = 0.000e+0
Identity = 835/2308 (36.18%), Postives = 1331/2308 (57.67%), Query Frame = 3
Query:  114 IGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILA-----ADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKA-----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNE--FSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPN-IIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPS---ISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSF------------SEYYQETKKEFVEKNIELSEEELM--TYLEDLAVTNQPKKPLN---------KAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSE-IDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKY-------NEAPEASEIEQLENSIANKKDASQTFSKSA-----------------------------------MSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGT--QGGLA--IFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNI--QIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEE 6734
            +G +N F      + SKV+ P +PK++ +      +TPSEF+ +MSL T ++L  T+ M  P  IELLDMG TT+QK + + ++  LFQPFPS + F N  P E YE+PLILRNNDK+PRLVKV  E SPYF V+SP ++ HKVA G+P +F+I FTPE+ +DY   L  VTEREKFIVPI   G+RAILDFPD++ F   P+KY+  K L +RNIG+  A F I T  PFS+EP    L V ESMQ++V+F P+   D S  +I+ Y+TGE V+  ++G+  ++ +R++++ + IE+TY+ LAN R IT+HNRS+++ HF W  F++Q  ED ++      L  EE +E + F  +     L  + LS+++R++ N++++ +     F +++FT++P+EGD+WP++S +ITV F P+EA+ YQ   +C++ GRE RL L+I G G+GPK+ F+F+ LD+G +F  + HCYE IL NKG IDALF +    S +  CF F+P +G+I PS  Q +QI F S   LG F + F V ++G  EP  +  +G VIGPTF F+V  + FG+VS GFP +   SL NTSL+P+ ++LR+P DG     ++      D       +E  S  +P+EF+I P  G +       I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VP + L   E+DF   FL+Y YEK +++ N   LP  YE+  Q  E+   +L+SS   + ++SP+S + IP+ L+    GE  + V+  IFGS   PL   +K  GEGPV+ +    +D+G I VL+D S  L L N+S IPA F A M   +S++ +EP  G++     + L + ANLND + F D + L IENS T  +P+ A G G+TI  D P +  +NLG+HFS       +++IN+G+R QQL W N+ +     + + G      A                 P+  +HP   +L PG++  ++++GY   P++V+E ++CH+IIG Q GK L+  V++   F++P+++ S + L +RL+K  ++  +   + +   N+S L +N  L+   PF I E ++     + + + L  ++ + + I+F+P +++D ++ + ++ L + + EHP +D + L GEV++PNL F+   ++F CILN +E+ ++V + N SPL V++ W  LV D+ N I F     +P   P S+   + AT +  +         + + DLN           + K + + E+ + + + L K +    +    K S   I  +  +  ++E  E L+T    +NE++ +GIEE+FD+ PL+G L+P+S  QI+FT++GH+++ A   A+CEVE GPTY   L GEAS V Y F   +  +G  L+D V  +E+TL+N+GKVGFEF         P N  P G P+++P SGF+ +    ++ V YL G P  F  S  IQ+AH   E I++SG G FP++ +DLPRN      ++N   ++F  +   +TDK +            +E   E +   V  ++++  E L+  +Y+ +   T  P  P++         + + K+ LP Y L+FG +I+G V +  ++I NT HFP++    K  + + GF   L +VKNLP  E   FE+ FDP+ ANL +G  E  L + ++GGP+V + L A VT+P +  S   V+F  ++ G+  + TIQL N   V  EW   + + +D++ K      + P+ LR+K     +     +FE+ P +G L PG+K NVQ+KFMP +EK YS  LV  +A S++++ +   G GLEP+LEF  S +  GP+L    G E  + ++NPC+FPIE YSLEFD+ YL +E+ILR + GYDS+  LL+PPR  G+KLP E  EY+ E  K   E     Q   KY       NE  + +  +Q  ++   +   S+  S ++                                    SI +     + E+E  PVS+AIAR+LG++++ EG+ A+  +GIAI++ G+P+SGK+  +  +A+ Y+AA L++D I++EA+A+ +     +AR+LC+ AA    V + E+ A++ ++ +    QG L+     +    +T +   ++   + + S V    +     + S K H + +++  T  + SSP P  GP    L++   + GE   L++C+LPDE++++IL+ER+ LSDC +G+VFDGL+ LF+Q+ +     +L ++ +R  +Y + + +D+ ++K +E  ++E
Sbjct:   15 MGLVNMFK----GFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTEQRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTCVTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLDKNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSST-ILGNFEEEFLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYKLRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQASGTGSTIVSDKPFAPELNLGAHFSLDTHYYHFKLINKGRRIQQLFWMNDSFRPQAKLSKKGRVKKGHAHVQPQPSGSQEPRDPQSPVFHLHPASMELYPGQAIDVILEGYSATPRIVKEKLVCHAIIGAQKGKSLVMAVNITCEFVAPLIQLSTKQLIYRLEKKPNSILKPDYQPLAIKNISTLPVNLLLSTSGPFFICETDKSLLPATPEPIKLEIDEEKNLLIKFDPSYRNDLNNWVAEEILAIKYVEHPQIDSLDLRGEVHYPNLSFETKELDFGCILNDTELIRYVTITNCSPLVVKFRWFFLVNDEENQIRFVTLPKKPYSAPVSQMESIPATSEAASPPAILVTVESPEMDLN----------DFVKTVLVDEDARPEEKELRKTKASSVISDEIKISSTEIERIYSSQSQVEDQESLQTC--EQNEMLSIGIEEVFDILPLFGVLQPHSSHQISFTFYGHANIIAQAKALCEVEEGPTYEITLKGEASLVNYSFDTKDIHYGLQLFDHVTEREITLTNMGKVGFEFKVLTDHQSSPDNLLP-GVPLILPVSGFISSHQEQVLKVYYLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRN-----LTANEKYEMFLNQARKNTDKEYNKCEMLDHFDIITEEVPEDEPAEVSAHLQMEVERLIVQSYVLEHQKTTTP-DPMDDPCFSHRSRRKLAKIQLPEYILDFGYIILGEVRTHIIKIINTSHFPVSFHADKRVLHETGFSTELDRVKNLPHCETEIFEVRFDPQGANLPVGSKEVILPIKVVGGPTVHICLQAKVTIPTMTLSRGKVDFATIQCGQCLVETIQLSNHLQVPCEWFVQSQKPVDKLEK------HMPKYLRQKLRAELKPKT-RIFEIQPISGVLDPGEKSNVQVKFMPKEEKFYSQTLVFQIAQSAQKLTLLARGQGLEPRLEFSPSVLDLGPLLLCAPGDEAEVIVKNPCNFPIEFYSLEFDQQYLIEEKILRKLKGYDSYNTLLLPPRNPGEKLPPELYEYFKEIKKSKEE-----QMRAKYLENLAQENEEEDITSSDQGTSNSTKRTSLSRGISVTSNLEEWHALLVESKTYLEEEEDEESLEKIIFQTDKLQSIDSHSMEEVGEVENNPVSKAIARHLGIDISAEGRLAKNRKGIAIIIHGTPLSGKSANAVSVAKYYNAACLSIDSIVLEAVANSNNIPGIRARELCIRAAIEQSVKEGEEAAQEAAVGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSE--TPQISSSPLP-PGPIHRWLSVSPSVGGET-GLMSCVLPDELLVQILAERIQLSDCYRGVVFDGLDTLFAQNAAAALLCLLKAIGSREHIYILNMAQDYAAMKAQEKAKKE 2282          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 413/1006 (41.05%), Postives = 614/1006 (61.03%), Query Frame = 3
Query:  114 IGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILA-----ADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQ-TEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKA-----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQV 3062
            +G +N F      + SKV+ P +PK++ +      +TPSEF+ +MSL T ++L  T+ M  P  IELLDMG TT+QK + + ++  LFQPFPS + F N  P E YE+PLILRNNDK+PRLVKV  E SPYF V+SP ++ HKVA G+P +F+I FTPE+ +DY   L  VTEREKFIVPI   G+RAILDFPD++ F   P+KY+  K L +RNIG+  A F I T  PFS+EP    L V ESMQ++V+F P+   D S  +I+ Y+TGE V+  ++G+  ++ +R++++ + IE+TY+ LAN R IT+HNRS+++ HF W  F++Q  ED ++      L  EE +E + F  +     L  + LS+++R++ N++++ +     F +++FT++P+EGD+WP++S +ITV F P+EA+ YQ   +C++ GRE RL L+I G G+GPK+ F+F+ LD+G +F  + HCYE IL NKG IDALF +    S +  CF F+P +G+I PS  Q +QI F S   LG F + F V ++G  EP  +  +G VIGPTF F+V  + FG+VS GFP +   SL NTSL+P+ ++LR+P DG     ++      D       +E  S  +P+EF+I P  G +       I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VP + L   E+DF   FL+Y YEK +++ N   LP  YE+  Q  E+   +L+SS   + ++SP+S + IP+ L+    GE  + V+  IFGS   PL   +K  GEGPV+ +    +D+G I VL+D S  L L N+S IPA F A M   +S++ +EP  G++     + L + ANLND + F D + L IENS T  +P+ A G G+TI  D P +  +NLG+HFS       +++IN+G+R QQL W N+ +     + + G      A                 P+  +HP   +L PG++  ++++GY   P+V
Sbjct:   15 MGLVNMFK----GFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTEQRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTCVTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLDKNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSST-ILGNFEEEFLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYKLRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQASGTGSTIVSDKPFAPELNLGAHFSLDTHYYHFKLINKGRRIQQLFWMNDSFRPQAKLSKKGRVKKGHAHVQPQPSGSQEPRDPQSPVFHLHPASMELYPGQAIDVILEGYSATPRV 1015          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 413/1006 (41.05%), Postives = 614/1006 (61.03%), Query Frame = 3
Query:  114 IGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILA-----ADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQ-TEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKA-----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQV 3062
            +G +N F      + SKV+ P +PK++ +      +TPSEF+ +MSL T ++L  T+ M  P  IELLDMG TT+QK + + ++  LFQPFPS + F N  P E YE+PLILRNNDK+PRLVKV  E SPYF V+SP ++ HKVA G+P +F+I FTPE+ +DY   L  VTEREKFIVPI   G+RAILDFPD++ F   P+KY+  K L +RNIG+  A F I T  PFS+EP    L V ESMQ++V+F P+   D S  +I+ Y+TGE V+  ++G+  ++ +R++++ + IE+TY+ LAN R IT+HNRS+++ HF W  F++Q  ED ++      L  EE +E + F  +     L  + LS+++R++ N++++ +     F +++FT++P+EGD+WP++S +ITV F P+EA+ YQ   +C++ GRE RL L+I G G+GPK+ F+F+ LD+G +F  + HCYE IL NKG IDALF +    S +  CF F+P +G+I PS  Q +QI F S   LG F + F V ++G  EP  +  +G VIGPTF F+V  + FG+VS GFP +   SL NTSL+P+ ++LR+P DG     ++      D       +E  S  +P+EF+I P  G +       I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VP + L   E+DF   FL+Y YEK +++ N   LP  YE+  Q  E+   +L+SS   + ++SP+S + IP+ L+    GE  + V+  IFGS   PL   +K  GEGPV+ +    +D+G I VL+D S  L L N+S IPA F A M   +S++ +EP  G++     + L + ANLND + F D + L IENS T  +P+ A G G+TI  D P +  +NLG+HFS       +++IN+G+R QQL W N+ +     + + G      A                 P+  +HP   +L PG++  ++++GY   P+V
Sbjct:   15 MGLVNMFK----GFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTEQRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTCVTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLDKNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSST-ILGNFEEEFLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYKLRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQASGTGSTIVSDKPFAPELNLGAHFSLDTHYYHFKLINKGRRIQQLFWMNDSFRPQAKLSKKGRVKKGHAHVQPQPSGSQEPRDPQSPVFHLHPASMELYPGQAIDVILEGYSATPRV 1015          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Human
Match: HYDIN (HYDIN axonemal central pair apparatus protein [Source:HGNC Symbol;Acc:HGNC:19368])

HSP 1 Score: 768.844 bits (1984), Expect = 0.000e+0
Identity = 391/913 (42.83%), Postives = 573/913 (62.76%), Query Frame = 3
Query:  114 IGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILA-----ADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQ-TEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHF 2834
            +G +N F      + SKV+ P +PK++ +      +TPSEF+ +MSL T ++L  T+ M  P  IELLDMG TT+QK + + ++  LFQPFPS + F N  P E YE+PLILRNNDK+PRLVKV  E SPYF V+SP ++ HKVA G+P +F+I FTPE+ +DY   L  VTEREKFIVPI   G+RAILDFPD++ F   P+KY+  K L +RNIG+  A F I T  PFS+EP    L V ESMQ++V+F P+   D S  +I+ Y+TGE V+  ++G+  ++ +R++++ + IE+TY+ LAN R IT+HNRS+++ HF W  F++Q  ED ++      L  EE +E + F  +     L  + LS+++R++ N++++ +     F +++FT++P+EGD+WP++S +ITV F P+EA+ YQ   +C++ GRE RL L+I G G+GPK+ F+F+ LD+G +F  + HCYE IL NKG IDALF +    S +  CF F+P +G+I PS  Q +QI F S   LG F + F V ++G  EP  +  +G VIGPTF F+V  + FG+VS GFP +   SL NTSL+P+ ++LR+P DG     ++      D       +E  S  +P+EF+I P  G +       I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VP + L   E+DF   FL+Y YEK +++ N   LP  YE+  Q  E+   +L+SS   + ++SP+S + IP+ L+    GE  + V+  IFGS   PL   +K  GEGPV+ +    +D+G I VL+D S  L L N+S IPA F A M   +S++ +EP  G++     + L + ANLND + F D + L IENS T  +P+ A G G+TI  D P +  +NLG+HF
Sbjct:   42 MGLVNMFK----GFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTEQRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTCVTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLDKNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSST-ILGNFEEEFLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYKLRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQASGTGSTIVSDKPFAPELNLGAHF 949          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Zebrafish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 1607.04 bits (4160), Expect = 0.000e+0
Identity = 899/2432 (36.97%), Postives = 1389/2432 (57.11%), Query Frame = 3
Query: 8124 RWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQ-TETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNE---NILVGGSQSRQ---QFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSN-SLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNA---------TEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPIN----WDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNN----------PFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVK-EILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADG--GPVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            RWI+ P+  I LR++F S   GQF Q F+FE+L T+R YQ+ C+GIC +P+IS++P+I+F H K+       + K Y+++ +++EFGPLL  K + R   G+YPENME+ +I N+S M AEI F F HD+    F LDPP+MTL+  E + LN+WA+P   +  ED+++CC+K NPEPV++++SC+GV P +E+D K++HF++    RK+ +++ L N+T +P  WR+ GLE LGDEFS +Q+ G I   S+F L+ +F A  P K   K++I LE+SDVE + GI+Q +E +QI+AEAYD+A+D+  P+  +  LD GT KV +E K+ I L+N+G Y+I +KF LD +E    +L+++F++ P +G + P  K   VQI Y   +E+ I+D  IL C VIEPN+ + GE I+ IPI++S ++ +SKY I+P  DINFG +   +RK + + +EN G F+ RF I+  K     A      NK+   KDS   + S  +E   N+      S Q     G FTLFP  G++      +V VDC +D+ G  +E L IDITDR+P  +P+G+ Y+L  E  VP I S +++SIFEEHRIC   +++  E ++  S GIY + EN+F+F NVLVG   +A+FRL NP  V C+++L++K +     +          ++FE+ PT+  I      + +V FSPL+MQ Y  +F+  ++   S  S +R KAL F++ GEG LP + V KP  R  +   +  FK+SL+GR Q+  + + N+  +P +V + +      F +                ++PG   ++  +   L++  G +  F V F P+++ K+ A++K+ V +NQY+ T++Q++GEGY D I  EN+             + V Q  T+S+             ++ L FGDC++      +F++ N +    +RF W           N   + F+P VGHLH   +  V  T  S  P   N + I+C L  I         +P++    WDD+ +T+KW+DV      SS    K+K + T+ EP  T V  ++R ++L+++A  +Y +++C    I+F+DTML++TR++ + ++N+G +K++Y W I ++     T       T+R  +     +         +          PFS+ P  G I     Q F++ F+PL V  ++A++ C I NL   +  P  ++ GR L PYCHF L DSDYL   RR+P             ++PNTRVIE   +G+ +   + F ++NPT   + + W CEDS+ P       CL  +  ++ GK+V+  F++   ++ + ESFW F IPE  +++PFL+VG   EP V  D++H    +LL+G E+  TV ++N ++QP++F  Q  S H+ G+ + L ++PM G IP+  ++ + I  T T    + FNL   V +K  PL++NVK E YS+++ V +E       EL   S N  H V    +  ++E+  + T    + N G+F+ D  +D+      +L+  L + P S TV +G +    L     R   L+ +   + I  G  +   +      P LEFS  KH+FG  F Y  GM   T  LVI+NR S       IS++CL  +  V   NF   V+ PG S  + ++F PRK  +Y + ++FE+N  ++  V++ G   E+K++  D  +  +N G +++G++  K V++ N +H  +T  L    +   L    +  + P GQ  +   G   A+  +++F+P +R+  FTEE+  E +G   P+ ++ G CQA ++R D++ + FG V +    T+++ M N GDIGARFKW+  SF PDF+I+PA GYI+ GME+  E++F+P +   D+RYD+L CS+EG K+L L LTG C  V PV  E++NF   VR Q  +SL +    N  W LK VIEGEHWSG  T + EP Q   YE+T+KPL MTTDG+KH+GSVF + PDGSGILY L G AEPPKA   IT E+  +   ++ + V NWL RPQRF+ ++E++KP++S+ ++ L+G EYVDVP   +K YKL+    KEGL   KVTF NE+TGE+ FY +  KA  P     I+++T VRQ    SV +EN     +++     + +++   QF V + S +  TFE+ PL   ES A+L + + +    FYDL++    +  E+PL F   +GS  + +A F N+++ K+++ CK D+  F  +KSI  A       E  + V FEP  +G+ +  LTIS+   GEF+FPL G  TPPK QGP  I  GSSVSI+F+NVF +   F +Q+D+  F + K +E I + K   + + FDG   G  GP  GKL +TCP  E     + WVYYL+G
Sbjct: 2461 RWIVPPNGAITLRIKFNSSVHGQFHQTFSFEVLGTKRCYQLHCKGICTYPSISRDPKILFAHCKKTLRPESGLQKTYVIQSDLYEFGPLLCGKTRDRYKEGKYPENMEKFVIHNNSQMDAEIQFCFQHDSKATTFLLDPPNMTLKTNERKVLNVWAYPNNPKHIEDSVVCCIKGNPEPVLFRLSCIGVRPELEMDRKLLHFDKTPPFRKETQSLRLFNNTLMPAAWRLRGLELLGDEFSVSQNQGIIMPHSDFLLHMHFIAKSPIKL--KRSICLEVSDVENILGIVQHSENIQIIAEAYDIAVDIIIPEDLDGSLDFGTFKVSEEVKRSIKLENKGKYDIAFKFTLDATEPGMPDLNSIFSITPRKGSLRPNNKPTTVQIIYQNDKEMSIRDSPILCCQVIEPNL-EGGETISTIPIKVSVQAVFSKYIISPSNDINFGPMVHGSRKKQTLTVENKGNFEMRFTIRLCKNASVPAQRRGVVNKKPS-KDSYGAKPSSASELRLNVQTEAGLSTQVNLTCGVFTLFPCFGILAPGAQQVVNVDCKADSVGSWEECLAIDITDRDPSDNPDGIPYKLVAEVCVPGIASTDIASIFEEHRICKNSSMLQCEQYRD-SMGIYVQDENKFVFNNVLVGQSAKARFRLINPGKVSCELTLAIKTVKVRIITQNV-------EVFELTPTKMCIPSHSHAFATVTFSPLSMQMYHMVFEAVLKSNTSQVSAHRPKALVFDLMGEGNLPCITVLKPVQRTNQGHPVLQFKRSLVGRGQTLPLVIKNNSNVPAQVSLILQYLPDVFTLKAAPGTVCRLASSHIESDPGK-DAQLAYVASLTLMAGQQAEFLVGFHPKVAQKFEASMKLMVKDNQYDQTVVQIVGEGYHDIIILENVG------------NRVQQESTESL-------------SDHLDFGDCHVGCTYQETFTMTNPNSSKVLRFEW---------LPNSPQLSFAPQVGHLHAECSKVVTVTFCSEEPLMLNTQTIKCALSSITF------QQPVDQVPDWDDSHRTVKWVDVDK----SSQQPTKRKKVVTDPEPPHTVVENSSREIELIVSATCDYVQFQCDNRPIHFKDTMLYQTRVFQLQMENKGTVKLEYSWQILMETYGKITSFEHGGRTSRSAQGSRTPERPASSLQSVSSLLVGDPELPPFSVEPAVGCISPGTCQTFQIRFSPLEVAEFEASLICRIPNLK-DNQSPEFTVHGRCLLPYCHFHLKDSDYLTGNRRNP------EPHSTLMVDPNTRVIEFTSVGIGTSVCREFGIINPTNKPYSFTWRCEDSKSP-----FSCLTPSKSIQPGKEVKVSFEYQVLNLDIAESFWTFFIPEHSLSLPFLLVGIANEPVVFIDRAHLNLGSLLLGCETHRTVFVVNREDQPFHFTVQKSSCHSEGYQDKLVLDPMEGTIPANDRIPLVIWITPTREGDVAFNLVVTVQRKLQPLTMNVKGECYSMNAYVRYESPERSITEL---SSNQVHPV----DFKQLELNNKSTCTFVVSNPGKFSLDVEYDLSGPAALQLH--LQVEPKSDTVAVGGQSSLTLTFCPQRKCVLKDLTLSIKIKNGPIFCCALMGSAVAPDLEFSSLKHNFGLQFTYCSGMVPATHTLVISNRSSS-----AISLDCLFSNTTVLEVNFTPLVLSPGGSVEVLLSFYPRKAVRYHEKVVFEMNKCAKRVVEILGQGAEMKIDLEDPAHRVVNFGALQIGQQSRKLVSLVNNSHCSLTFCL-HRHSDNSLHHSKILSVRPDGQVTLKEGGGRCAV--ELLFSPQQRMPPFTEELQLECLGAVRPLLVMKGCCQAVEVRLDIDYLQFGAVVQRCQATRRIIMHNSGDIGARFKWDVKSFAPDFTISPAEGYITPGMEVSLEVTFAPTELRQDLRYDDLCCSVEGGKSLKLTLTGSC-IVPPVAPEVVNFACQVRSQCTQSLALPIRINQQWTLKCVIEGEHWSGPPTLLTEPTQQNTYEITYKPLVMTTDGEKHEGSVFFSFPDGSGILYILQGTAEPPKAEGTITEEIKCKTLHTQTVTVHNWLPRPQRFRAVRELIKPDRSDDTVSLEGLEYVDVPAQDAKSYKLSFFTYKEGLYSFKVTFKNETTGEYLFYNLNFKAVAPGVIRTIEMATRVRQITSASVEVENPLPVDVSFTAECQNTDVYVPPQFLVPAHSVVSLTFEYQPLCEGESTARLVLYAAELGHFFYDLKMKALSAPNEKPLYFTAPLGSKHSGIAKFTNFSRVKTEYICKTDSPSFTVEKSIKAAAGNQTGTEISMAVHFEPCLVGDIQSRLTISSDSGGEFVFPLYGTCTPPKAQGPLSISLGSSVSIAFKNVFQQTTTFSYQVDNPAFTV-KGAETISAQKTQHIQVIFDGPPTGSKGPYRGKLTITCPRMEGHGQCIFWVYYLKG 4804          

HSP 2 Score: 1379 bits (3568), Expect = 0.000e+0
Identity = 815/2236 (36.45%), Postives = 1260/2236 (56.35%), Query Frame = 3
Query:  168 VAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDP-ILAADLTSKVSPREYCSRHQ---PREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEIL-RQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGY----------------SYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEV--NEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQ-DLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRN------NGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIE-LSEEELMTYLE------DLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPG---ENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEEN---DQEELKKV 6746
            V P++PKL+++ A   K+ PS +  +MSL T ++L NT  M  P  +ELLDM  TT+ K +++ ++  +FQP+PS + F N  P +TY++PL LRN DKVPRLVKV  EDS YF VVSP +VS KVA G+   F I FTP++ +DY  ++I VTEREKF VPI  IG RAILDFPD ++F   P+K    +TL +RNIG+  A F +ST  PFSVEP    L   + MQ+ V F P+   D S  +++HY +GED+   ++G   +I + ++R+ V +E+TY+ LA+ +K+ + N+SD ++H+ W  F+++  E+ D+      L   ED+E E+F +++    L + +LS+ + +        +++     D    + P EG+IWP+++ ++ + FKP EAR YQ   +CE++GRE+RL L I G G+GPK+ F+F  LDMG I I +   Y++ L NKG I+  +K+    + +  CF+F P +G+I P + Q +++ F S + LG F +     + G  +P  + F+G +IGPTF F V ++ FGEVS GFP      L NTS+VP+ F LR+P DG     I + +  ++ +  E+    Q   P+EF + PS G + +M    I +   +N++  Y+  LVLDV GVG E+ +IPI A  +VP V L    L F   FL + YE+ +++ N + LP  Y +L +Q E+   +LYSS     I+ P S   IP+  +   +  L    +  + G    PL L + C+G+GP V++ +  L++G I VL D +  LQLSNES I A F A M++++S +RVEP  G +    +L LK+I NLND V F DE+ L I++S+   +PL A G GTTI  D P +  +NLG+HFS       +R+ NRG+R  QL+W+ EG+                  +K++ QT  +   + P+ ++ P R  L PG SA ++++G  D P+VV E ++C+++IGRQ  +E I   D+   F+SP +E S + L+F ++K+ D S   L + +   ++S L+L+ +L V  PF + +   ++ S + K + L     + + ++FNP+++ D HSR++++ L+  +  HP  D + L GEV FPNL+F  + ++F CILN+++  + + M N SPL V Y W+ LV  Q       + H       S+ I  DA  K   + ++  E    K+ D   DT R         D+ + +   L+ E L  G    N ++           T    E+  K   L  T N    +G++E+FD+  LYG L+P   + +TF++ GH+D+   V A+C+VEGGPTY   L G+AS V Y     + DFG  L+D VA  E+TL N GKV F+F++  +       +   GQP++IP+ G +E  + I ++V YL G P  F  +  +QVA +  E+I++ G G FPRL +DLPR+        + KE+ ++ ++  S   L   +    + Y  T    ++  +E L  +E  T ++      DL  +      L K + KL LP Y L+FG VI G +V+  V+I NT    ++ K  +  +   GF   L +V+ LP  E   FE+ FD R A  NLG + + + + ++ GP V V L A VTMP L  S++ ++F  ++ G  ++ITIQLHN  PV  EWT    E     + ++   + P  L +++ + K+   P+VFE++P+ G L PG + NVQ+KF P + K+YS R+V+ +A S++RI++   G G EP+LEF  S I FG +LP++ G    + IRNPC FP E YSL+FDK YL++EEILR + GYD+   LL+PPR AG+ LP E ++YY    K H   +   + ++   E  +       E  I           K   S+      A+ +LE  PVS A+ARY+G++L+PEGKAA   RGIAI+V G+P+SGKT TS  LA+ Y AA L+VD+++ EAL+SG++ AA +AR+LC  AA    VF   +  E       T    A       G+ +M  +  A H  + S +S++       ++ NK +   ++  N      S  P A     +++ ++     +N  L NC+LP++V++EILSERL LSDC +G+V DGLE  +  S + T Q++L + NNRR +Y + L   +   K  E    DQE+  ++
Sbjct:   28 VTPRHPKLVKREANVSKLIPSVYAREMSLTTEERLSNTFEMRPPRILELLDMSETTHHKFSSLDLDQAMFQPYPSEIVFQNYLPFQTYKVPLELRNGDKVPRLVKVIVEDSLYFKVVSPLDVSKKVAPGMASTFTILFTPQENKDYIHSVICVTEREKFEVPIRAIGPRAILDFPDSLHFLVCPVKCLSQRTLLVRNIGNCEAKFKLSTCRPFSVEPSVGTLIAGQCMQVTVGFMPKTTGDHSQVLLLHYHSGEDIEISLYGESTDINIGLDRNSVVMEKTYISLASSQKVAIINKSDSIVHYQWKTFATEGEEERDKLRLSSELNPVEDKEMEQFLTENTAASLQA-RLSLFSHTLQKGLMQTQQQLLSLDDQDIIMRPPEGEIWPNSTAEVNIIFKPQEARIYQQTVYCEISGRESRLPLCIQGEGLGPKLRFNFDFLDMGNIVIGSQQSYKLFLSNKGLINGTYKLMQPSTVLGLCFSFKPSEGMIPPGACQTMEVHFSSDK-LGVFTEELLFSVAGNPKPVTVTFRGCLIGPTFHFSVPELNFGEVSFGFPQMLTCCLSNTSVVPMSFGLRIPGDGMGQASITSREQVAQPNRSEWGMGDQTERPKEFILSPSTGTVRAMAEIDIQLTFCSNTVQDYNLALVLDVQGVGEEVLAIPIKARCVVPDVVLKNPVLKFQNCFLGHPYEQSVELVNETDLPACYGLLPQQYEEDPAVLYSSPHARGIIQPYSTELIPVVFQAKKVDNLEQTAYIAVLGRKDPPLELLLSCVGQGPSVSVSAAKLNFGYIPVLTDVTRTLQLSNESPIAARFCAQMLRNKSHWRVEPSEGEIPPEQSLELKLIVNLNDTVPFQDELLLEIQDSQIFNIPLAAKGKGTTIVTDRPFAPSLNLGTHFSSGPCQYAFRITNRGRRTHQLLWTTEGFPQFPNRDHLSPNKPRNKKSKSL-QTSPQ---EGPVFSLSPARLLLPPGHSADMLLEGSSDVPRVVTEKLVCYAVIGRQYVRECIITADVTCQFVSPAVEISSQQLNFYVEKAPDASLVPLYERLILKSLSSLNLSMELLVHEPFGLCDYDGDDLSTTSKSLVLAVGAQQELWVRFNPMYQQDCHSRVVEEVLEFCYHGHPQQDRVLLKGEVQFPNLKFSSTTLDFGCILNNTKSRRKLTMTNCSPLCVSYRWAFLVDQQ-------QCHIGFFDETSRGIDGDAGGKRKESGEAQWELLEQKEADGKTDTNR-------ETDVIIPQ---LEEEELHHGSSNGNEQNR-------TCLTRRSKELGSKPINL--TANGHPSVGVKEVFDISSLYGVLEPGDSKLVTFSFLGHADISTQVLALCDVEGGPTYEITLKGQASFVSYTLDTNDIDFGLQLFDHVAEAEVTLKNTGKVRFDFSTLNSEQGPFVEEILPGQPLVIPNKGHLEPYAEIKLSVYYLPGIPEVFHKTFQLQVAFYETESITVRGEGVFPRLCLDLPRDLNEEIYGSLLKEAKDTIENEKSSEALLKDEMPPEDDYIPTYDALLQMELERLIVKENATAVQKQHQATDLRGSGSSSNWLKK-LCKLSLPEYTLDFGFVINGNIVTHIVKITNTCPLAVSFKANRSSLAGTGFSTELDRVQGLPFCETETFEVKFDTRGA--NLGKINAVMPIQVMKGPQVQVRLCAEVTMPSLTVSTDTLQFHTIQCGLCEVITIQLHNDGPVPCEWTIRPEE-----RPKKIDKHIPLYL-RRQAQMKQRPPPVVFELLPSDGTLYPGDRTNVQVKFSPAEGKAYSQRIVITVAQSTQRILLLAQGQGEEPQLEFSSSEINFGSILPYSEGKVAEVIIRNPCPFPTEFYSLDFDKQYLKEEEILRMLKGYDAQNVLLLPPRVAGEPLPPEVLDYY----KEHSSKEPKQESTEGLAEGDKGETDALFEGEIP----GVNGLPKGNSSVVT----AVGDLEYDPVSTAVARYMGIDLSPEGKAALNRRGIAIIVHGAPLSGKTRTSVTLAKHYGAACLSVDEVVQEALSSGNSSAAWRARELCAKAAV---VFAQREEQEATVDITATASQAA-------GVLSMEAV--AKHTAEGSQISDLKVPPSSASTRNKTNITGRSQKN-----DSSNPAASVTDGQVHRRVSASASQNEELFNCLLPEDVLVEILSERLQLSDCYRGVVIDGLETQYCCSLNNTLQIVLKAFNNRRHIYVLNLFNSYSVFKLREKHKLDQEQEARI 2193          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Zebrafish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 506.523 bits (1303), Expect = 3.320e-157
Identity = 267/664 (40.21%), Postives = 406/664 (61.14%), Query Frame = 3
Query:  168 VAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDP-ILAADLTSKVSPREYCSRHQ---PREFSIEPSEG-VLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITA 2144
            V P++PKL+++ A    + PS +  +MSL T ++L NT  M  P  +ELLDM  TT+ K +++ ++  +FQP+PS + F N  P +TY++PL LRN DKVPRLVKV  EDS YF VVSP +VS KVA G+   F I FTP++ +DY  ++I VTEREKF VPI  IG RAILDFPD ++F   P+K    +TL +RNIG+  A F +ST  PFSVEP    L+  + MQ+ V F P+   D S  +++HY +GED+   ++G   +I + ++R+ V +E+TY+ LA+ +K+ + N+SD ++H+ W  F+++  E+ D+      L   ED+E E+F +++    L + +LS+ + +        +++     D    + P EG+IWP+++ ++ + FKP EAR YQ   +CE++GRE+RL L I G G+GPK+ F+F  LDMG I I +   Y++ L NKG I+  +K+    + +  CF+F P +G+I P + Q +++ F S + LG F +     + G  +P  + F+G +IGPTF F V ++ FGEVS GFP      L NTS+VP+ F LR+P DG     I + +  ++ +  E+    Q   P+EF + PS G V A +T C       +N++  Y+  LVLDV GVG E+ +IPI A
Sbjct:   28 VTPRHPKLVKREA---NLIPSVYAREMSLTTEERLSNTFEMRPPRILELLDMSETTHHKFSSLDLDQAMFQPYPSEIVFQNYLPFQTYKVPLELRNGDKVPRLVKVIVEDSLYFKVVSPLDVSKKVAPGMASTFTILFTPQENKDYIHSVICVTEREKFEVPIRAIGPRAILDFPDSLHFLVCPVKCLSQRTLLVRNIGNCEAKFKLSTCRPFSVEPSVGTLDAGQCMQVTVGFMPKTTGDHSQVLLLHYHSGEDIEISLYGESTDINIGLDRNSVVMEKTYISLASSQKVAIINKSDSIVHYQWKTFATEGEEERDKLRLSSELNQVEDKEMEQFLTENTDASLQA-RLSLFSHTLQKGLMQTQQQLLSLDDQDIIMRPPEGEIWPNSTAEVNIIFKPQEARIYQQTVYCEISGRESRLPLYIQGEGLGPKLRFNFDFLDMGNIVIGSQQSYKLFLSNKGLINGTYKLMQPSTVLGLCFSFKPSEGMIPPGACQTMEVHFSSDK-LGVFTEELLFSVAGNPKPVTVTFRGCLIGPTFHFSVPELNFGEVSFGFPQMLTCCLSNTSVVPMSFGLRIPGDGMGQASITSREQVAQPNRSEWGMGDQTERPKEFILSPSTGTVRAMLTFC-------SNTVQDYNLALVLDVQGVGEEVLAIPIKA 679          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Zebrafish
Match: BX571975.1 (pep chromosome:GRCz11:CHR_ALT_CTG18_1_23:21320032:21360296:1 gene:ENSDARG00000116600.1 transcript:ENSDART00000185269.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571975.1)

HSP 1 Score: 157.918 bits (398), Expect = 7.201e-39
Identity = 79/227 (34.80%), Postives = 138/227 (60.79%), Query Frame = 3
Query: 2967 APILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVN--EFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQ 3641
             P+ ++ P R  L PG SA ++++G  D P+VV E ++C+++IGRQ  +E I   D+   F+SP +E S + L+F ++K+ D S   L + +   ++S L+L+ +L V  PF + + +  + S + K + L     + + ++FNP+++ D HSR++++ L+  +  HP  D + L GEV FPNL+F  + ++F CILN+++  + + M N SPL V Y W+ LV  Q
Sbjct:   27 CPVFSLSPARLLLPPGHSADMLLEGSSDIPRVVTEKLVCYAVIGRQYVRECIITADVTCQFVSPAVEISSQQLNFYVEKAPDASLVPLYERLILKSLSSLNLSMELLVHEPFGLCDYDGDDLSTTSKSLVLAVGAQQELWVRFNPMYQPDCHSRVVEEVLEFCYHGHPQQDRVLLKGEVQFPNLKFSSTTLDFGCILNNTKSRRKLTMTNCSPLCVSYRWAFLVDQQ 253          

HSP 2 Score: 78.9518 bits (193), Expect = 1.190e-13
Identity = 38/90 (42.22%), Postives = 57/90 (63.33%), Query Frame = 3
Query: 6486 ENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEEN---DQEELKKV 6746
            +N  L NC+LP++V++EILSERL LSDC +G+V DGLE  +  S + T Q++L + NNR  +Y + L   +   K  E    DQE+  ++
Sbjct:  410 QNEELFNCLLPEDVLVEILSERLQLSDCYRGVVIDGLETQYCCSLNNTLQIVLKAFNNRHHIYVLNLFNSYSVFKLREKHKLDQEQEARI 499          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Zebrafish
Match: si:ch1073-349o24.2 (si:ch1073-349o24.2 [Source:ZFIN;Acc:ZDB-GENE-081104-83])

HSP 1 Score: 57.7658 bits (138), Expect = 5.724e-7
Identity = 66/298 (22.15%), Postives = 127/298 (42.62%), Query Frame = 3
Query: 1989 FSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELS-------CDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTK-VHFKIFGS-SKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATM-MKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLN 2852
            F + P  G L     C++ V         Y           G    ++ +   +  P +++S       C  LDF    +    EK  ++ N S++      +R+    E + +   +    ++P S L++P+     T+  ++   +     G+ ++E L ++  CIG  P+V+L +  LD+G ++   + S N+Q+ N S + A +   M     SVF V+   GI+   + LNL+V    +  V +   +   + + +   + L  IG   + +  P   +I+N G H S  +LN
Sbjct:  186 FQLSPETGQLNPGEECRVTVEFRPQQALVYQAEASCAFGDDGESRCAVLLRGLSKYPHLQISSTGQEEGCKVLDFGSVAVGEFLEKHFEIHNPSTVSFSLSWMRRPTLMESV-FRCEVYEGTIAPYSVLKVPVCFSPLTVESISVDYIRLTCPGAVNEELLKVSGTCIG--PIVSLSTSVLDFGCVEEGSEMSHNVQIINSSAVLAHYQFDMDTGGHSVFSVDKPCGILGGSSKLNLRVKFRPHCSVAYHKTVTCLLMHREPLFLDL--IGTCHSEQLKP---AILNPG-HLSAYRLN 474          

HSP 2 Score: 54.299 bits (129), Expect = 5.765e-6
Identity = 57/229 (24.89%), Postives = 93/229 (40.61%), Query Frame = 3
Query: 1278 FIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGR-ETRLSLKITGVGIGPKVEFS-------FKTLDMGYI----FIQAHHCYEIILVNKGDIDALFKIEGTGSP-----VSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTS 1913
            F+D  F + P  G + P     +TV F+P +A  YQ+ A C      E+R ++ + G+   P ++ S        K LD G +    F++ H  +EI   N   +   F +     P     V RC  +   +G I+P S   V + F             ++   G +   ++   G  IGP  S     + FG V  G   S  + + N+S V   ++  + T G S
Sbjct:  181 FVDPPFQLSPETGQLNPGEECRVTVEFRPQQALVYQAEASCAFGDDGESRCAVLLRGLSKYPHLQISSTGQEEGCKVLDFGSVAVGEFLEKH--FEIH--NPSTVS--FSLSWMRRPTLMESVFRCEVY---EGTIAPYSVLKVPVCFSPLTVESISVDYIRLTCPGAVNEELLKVSGTCIGPIVSLSTSVLDFGCVEEGSEMSHNVQIINSSAVLAHYQFDMDTGGHS 400          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Zebrafish
Match: dlec1 (DLEC1 cilia and flagella associated protein [Source:ZFIN;Acc:ZDB-GENE-091204-65])

HSP 1 Score: 55.0694 bits (131), Expect = 3.262e-6
Identity = 61/260 (23.46%), Postives = 109/260 (41.92%), Query Frame = 3
Query:  282 KTMELPAKIELLDMGNTTYQKTTNVSMED--PLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSP--PNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTER-EKFIVPIHCIGSRAILDFP---DEIYFPPTPLKYTETKTLFIRNIGSAIANFSI-------------------STSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRI 980
            K++ +P K +L ++G +  +     S+E   P+F   P  +FF +    + YE  + L+N     R +++    SP+F V     P     VA G+   + ++F P+   DY+  L+V T+     I+PI    S  IL  P   D  +     +K+ E   +  RN G +   F +                   +   PF++ P    L   ++  I+V F P  P+  + +  I  +  +     + G+GQ I V +
Sbjct:  279 KSLIIPGKKKLENVGKS-RKNNGRESLEGHAPIFTANPPVIFFSDYRVGQVYETSVELKNMTASSRHIRMIPPTSPHFSVGLGRFPGEGGIVAPGMSCQYMVRFAPDSLADYEDALVVETQMLYPLIIPIEACRSPPILTLPAVMDCGFCLVGGVKFME---VLCRNEGLSAGTFCVMPKKQWPASSLRSAVKSTFTEQPPFAISPSIFGLHPGQATVIEVVFFPTTPELSTQDFTIVCDNCQVKDITLQGTGQLITVEL 534          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Xenopus
Match: maob (monoamine oxidase B [Source:Xenbase;Acc:XB-GENE-949917])

HSP 1 Score: 1763.43 bits (4566), Expect = 0.000e+0
Identity = 1053/2846 (37.00%), Postives = 1611/2846 (56.61%), Query Frame = 3
Query: 7002 RGKSK---AGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLXXXXXXXXXXXXXXXIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHP-PIKPNQVPVEQH-------------GENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEE----SPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKP--MRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXX--XXLTPISD-------------DGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNS---NKETGQKDSIAIQKSKQ-----NENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINM-TDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLD---NSDIFTPRSSRPNTAR--------------QGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWIT------LVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGV--FKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            RGKS+    GK++ +G     N    K  V   +D  + ER  S      + A+DL     +   K   G I +I+++     D   K+   E E  L Q+FK +++  K+I +I + WDR     + P+   V QH             G+   ++   + L+++ R     +R +       ++       D+   H+       P+E      GVP    ++S   K   EKI+Q     +LP VD+VL+GLGLG  GPP+PPP+ FS+V +P  R  P+  E LG   H+ F+ T  D  +          DE K  E  + +L    P  K   M P KS    ++     R+S   K   ++  +      + +   +  TP+SD               L++ T RWI+    E+ L++ F S  +G FDQ  NFE+L T+R YQ++CRG+C FP+I  +PR+VFP+RK+  + +EIVHKK+IL    ++FGPLL  K +++  A ++PENME+ILI N SP+ +EI F F HD     F LDPP+M L+P + Q+L++WA+P     FED I+CC+K+NPEP I++I C GV P +ELD K IHF+++LL RKD +TV+LRNST LP  WR+TGLE+LGD+FS +QD G +   SE+ L  +F+A +    N KK IRLE+SDVE + GI+Q E +Q+ AE+YDVALD+SFPKG + GLD G +KV DE K  ++LKN+G YEI + F LD      ++ ++ FT+ P +G ++  ++A QVQI + +K+EV I D+ IL+C +IEP++ + GE IA IPIR+S +S ++KY+++P +DINFG++ + TRK     +EN G  +FR+ I S    + +  PL       + +G   S+A+ K K+      E    G  Q+R   G FT+ P  G V     V ++++C +D  GK +E L IDI+DR+P+   NG+ +RL  E+  P   +++ +SIFEEHRI      + + L  L +GGIY K ENRFLF NVLVG    A+F++ N   VPCD+ LS+KP+         + +A + DIFEV P R  I      Y SV F+P +MQ Y  IF+ ++E    N     ++LSF++ GEG LP V +++P  RNK    L LF++ LLG+ Q   + L N+G +P R           F+ S G            ++PH   L +  G    F V F P    +Y A + I+VV+NQYE + +QL+GEGY+D +T +N+  +   + P  P+ +               +++EA + + + FGDC+I +P  ++F++ N S+  ++RF WPS +          P++FSP VGH+H G +  V  T++S    T ++ PI+CK+ RI+     +  A   +WDD  +T+KW+D  +  S       KKKVIET+ EP    + + +R L+LL+TA +++ ++     ++ F+DT+L++TR+Y   +KN G +++++ W I +D    S  F+PR  RP+                     E++        +   PFS+ P  G I A E Q F + F+PL V  ++A +TC I NL      P +++ G S+ P+CHF+L DSDY+  GRR+P +RGP G+P G  ++P TRVIE   IG+ +   K  +++NPT + +   W CED +  +      CL  +GI++ GKKV+  F+F  Q + +TESFW F IPE  I+VPFL+VG+ +EP+V+ D+SH  F ++ +GHE  E V +IN +N+P++FAF++ SR + G S SL ++PM G I    ++ + I    T    LNFNL C +  KT PL +NVKAEG++ D  V  +D TG    LT        +  N I++G++ +   Q  ++       ++N+G+F ++F+  +   +  K  + + + P SG V  G+     L     +  TL+    ++ I  G      +     RP + FSF++++FG+CF+Y  GM+ +   L+ITN+D ++     +S++CL  +      +F A V++PG    I ITF PR    YQ++++F++NG S+  V+L G   E+K+E  D      N G V +G+ V K++ I N +  PVT K+  SP+   LQ   V    I+P G EI I P +     +++ F P  RI +F EEV  EA GV   + ++ G  Q  ++  D E ISFG V       +++ + N G++GARFKW+++ F+PDFSI+PASGYI+ G ++ FE+ F P + A DI Y+NL C IEG K L L L+G C  +   KE+++F   VR +  +++ + N TN  W L PVI+GE W+G +   VE QQ K YE+T++P+TMT++GKKHQGS+F  +PDG+G++Y L G A+PP++   I REVP + P++ELL V NWL + QRF  I E +KP++ +S+  +KG EY++VP    + YKL+  + KEG+       L ++T E+ FY +  KA  P     I++ TPVRQS   +V +EN  S  + +       EI+   Q  V +QS+    FE+ PL+  ES  +L + S D     Y+L L  TP+  E+PL F T +GS QT+ A F N+ + K++++CK+DN+ FH +K +T AP      E  ++V +EP +LGES+ +L IS+ V GE+  PL G +  PKPQGP  I+ GSS++I F+NVF++   F FQ D   F + K  E ++  K H + ++++    G   PV GKLV++CP A      + WVYYL+G
Sbjct: 2143 RGKSREDTGGKKSQIGSKQINNLHAVKSEV--RIDSGL-ERKVSVKDRPESVANDLDDALKRRKSKDIKGGIGDIAQQVSVPED-FEKEVVSESEKKLLQRFKNYESCKKEIMQISTFWDRVQGIMVIPSLAEVSQHEGEELIPERQLPSGKRNRKDRERDRLEKLEREKTEKERLEKERLEKERLTKLRSREDDAESHSQREGCEEPKEELKLDLGVPYFNFQMSGPEKPSGEKILQSG---KLPTVDKVLDGLGLGPSGPPMPPPSLFSVVLFPEMRTLPSDQETLG---HFTFIATSPDDPNIIV-------DEKKENEP-ESELVFPVPVLKEEQMTPTKSRAKKEKATDAGRESQKDKRRSASVQKSKQIQESHSPPPAPRTPLSDVDQSSIIGEAVQEKLLRLSTFRWIVPAGGEVPLKIHFASSTIGNFDQTLNFELLGTQRIYQLYCRGVCTFPSICTDPRVVFPNRKKETKPDEIVHKKFILNNGTYDFGPLLCGKTREKYKACQFPENMEKILICNKSPVDSEITFCFQHDVKAVSFILDPPTMHLKPNQKQELSIWAYPTSPGLFEDNIVCCIKDNPEPAIFRICCRGVRPELELDRKQIHFDKILLQRKDTRTVFLRNSTLLPAAWRLTGLENLGDDFSVSQDQGIVGPRSEYGLQLHFKAAR--ATNIKKLIRLEVSDVENILGIVQLENIQVWAESYDVALDISFPKGRDGGLDFGVVKVNDEAKHTLSLKNKGKYEIAFSFSLDAMGPELSDFNSFFTILPQKGTLNSTDRATQVQILFQSKKEVQIADKPILRCQIIEPSLGEGGETIASIPIRLSVQSVFTKYRLSPSSDINFGAMVLGTRKQSSFTLENCGSLEFRY-IISKMIREVMIQPLKRGVRSREGSGSSRSLALNKGKRADSQTKETNFAG--QARLALGMFTISPGFGTVQPGGHVTISIECFADQLGKSEEFLAIDISDRHPEDHANGIPFRLVTESCTPGFVTDDFASIFEEHRIVGDARTL-QYLPALQAGGIYLKEENRFLFWNVLVGQTSTARFKIQNTGKVPCDVVLSVKPI-------SSKTAARISDIFEVNPPRMNIPSHSHCYASVTFTPQSMQTYQCIFEASLEESNHN-----RSLSFDISGEGNLPHVSISRPVFRNKHGNPLLLFQRLLLGQFQQLPLILKNEGSVPTR-----------FYYSKG------------RRPHAASLILHPGDVAEFVVTFSPVSPQRYEAILPISVVDNQYEQSYVQLVGEGYQDDLTLDNIHNLGEVIAPEEPLEN---------------DVVEATRTDHIIFGDCHIAQPYQVTFTMTNRSKMDALRFQWPSDE----------PLQFSPRVGHIHTGCSKDVTLTLKSDVVLTLSKTPIKCKVSRISFPLPFDQVA---DWDDRMRTIKWVD--SGKSPVGQQSTKKKVIETDPEPAHVVLDDGSRELELLVTAKVDHAQFMTDCDQVVFKDTLLYQTRVYKYQMKNIGSVQLQFSWKILMDIQEKSVSFSPR--RPSIDEPLSSARSSSAQSRPASVLESVSSMMTMSAE-TLPFSVQPSSGTIPAGESQEFLIKFSPLEVGEFEARLTCSIPNLAMNQQAPVLTVKGHSVLPFCHFQLEDSDYISKGRRNPELRGPRGAPSGTTLDPKTRVIEFTSIGIKT---KTASILNPTSSAYSILWNCEDPQDFQTSPAFHCLNEHGIIQPGKKVEVTFEFVPQVLDITESFWSFTIPEQNISVPFLLVGKASEPSVSLDRSHHNFHSIFVGHELEEIVYLINNENKPFSFAFRENSRFSEGFSQSLLVKPMEGTITPLSRLPVCILIKPTQVGELNFNLICDIRTKTEPLCLNVKAEGHTTDVCVQCQDGTGAVTTLT-------SQETNEIDLGQVRI--IQLLYVVVLCLFNIMNNGQFPFNFSCALSAPETVK--DCITIHPDSGYVGPGQVAHFSLAFYPTKKCTLKDTQLIIKIENGPELRCCLNGRAVRPGMHFSFTQYNFGNCFIYHAGMQPVRKTLIITNKDERE-----VSMDCLYSNTAHIEVDFHAVVLLPGGKMEIPITFYPRAAILYQETVIFQMNGHSKQAVNLQGQGIEMKVEVSDPKYKVTNFGAVNIGQAVKKSIPIVNNSLCPVTCKITLSPSIAALQDPKVKALYISP-GSEITIPP-RGGICKLELQFNPRERIVQFAEEVMLEAYGVARSLLVLRGCSQGLELSLDQEYISFGAVVLQCQAIRRIVLSNTGELGARFKWDSEKFQPDFSISPASGYITAGTDVTFEVVFHPREIAADIHYENLSCFIEGSKALMLTLSGSCVGLPSTKEVVSFQCHVRSKQTQTILLINKTNQAWNLHPVIDGEQWTGQDIIAVEAQQNKPYEITYRPITMTSEGKKHQGSIFFPLPDGAGLMYLLHGIADPPRSSGNIIREVPCKTPYTELLSVANWLNKTQRFHAIVEAVKPDRLDSTTTIKGLEYIEVPAASKRDYKLSFHSYKEGVFLWIELRLYDATQEYLFYFVTFKATPPGIITTIEMVTPVRQSTVATVNVENPLSVPVTFVTDCKVAEINLPPQLTVPAQSEGSLMFEYQPLKSGESTGRLALQSTDLGLFQYELLLKATPALSEKPLYFRTTLGSSQTISAKFTNYTRQKAEYTCKVDNSDFHVEKLVTAAPGSQGGSEVSVDVTYEPVQLGESRAVLLISSPVGGEYTIPLFGSSLSPKPQGPIQIRSGSSITIPFKNVFLQTTAFTFQADPPAFTV-KPCEPVRPKKTHYISVSYEAPNPGSKVPVTGKLVISCPRATGIAQGIYWVYYLKG 4874          

HSP 2 Score: 930.243 bits (2403), Expect = 0.000e+0
Identity = 483/1147 (42.11%), Postives = 712/1147 (62.07%), Query Frame = 3
Query:  225 PSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLT----SKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQ-----TGTKNA-IKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSE-KQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLL 3629
            P  F+ +MSL T ++L +T+ M  P  I+LLDM  TT+QK + V ++  LFQPFPS + F N    ETYE+PLILRNNDKVPRLVKV  E+SPYF ++SP +V +KVA G+P +F+I FTPE+ +DY   L+ VTEREKF+VP+  IG+RA+LDFPD++ F   P+KY   KTL +RNIG+  A F + T  PF V P +  L V ESMQ+ V+F P    D +  +IIH++TGEDV+  ++G+  +I VR++++ + IE+TY+ L + R +T+ NRSD++ HF W  FSSQ  E  + + F   L+ EE+ E +RF  + +      ++LS+++R++ N++KM +     F DDIF I+P+EGD+WP++S++I+V FKP   + YQ   +C++TGRETRL L+I G G+GPK+ F+F  LD+G IF+ + H YE +L N+G +D +F +  T S V  CFTF+P++G+I P+ HQ +QI   S   LG F + F   +DG  E   +   G +IGPTF F +  ++FG++S GFPS+   SL NTSLVP+ F+LR+P DGT +P + +        + S R       P+EFS+ PS G + S     I V + +N + +Y   LV+DV G+G+++ ++PITA  +VP V L    L FSR FL Y YEK + + N S+LP  Y +  Q    T  +LY S   + I+ P   +++PI LK    GE   K    +FG ++ PL        EGPVV++    +D+G IKVL D S  L LSN+S IPA F   M   +S++R+EP  G +  H  + L V A+L+D + F D++QL IENS T  +PL A G GTTI  D   + ++NLG+HFS       + + NRG+R QQL W  EG+S  +   Q     TG  N+   +P+  +HP R +L+PG+S  ++++G+ D PQVV+E ++  +IIG+Q GKE I +VD+   FI+PVL  S ++LHF  +K  D+    ++K++   N+S L L   LT+  PF++   +     E K   L   +   I+++F+P +  D  S+II D L + + EHP+ D + +  EV+FPNL F  ++I+F CILN +E  Q + + N SPL V+Y WS L
Sbjct:    9 PLAFLKEMSLTTEERLASTREMHPPRIIQLLDMSETTHQKFSTVDLDQALFQPFPSEIVFQNYAACETYEVPLILRNNDKVPRLVKVIQENSPYFQIISPSDVCNKVAPGMPSIFRILFTPEENKDYFHELVCVTEREKFVVPVRAIGARALLDFPDQLNFLLCPVKYNSQKTLLVRNIGNREARFQLLTRSPFIVSPVSGTLAVGESMQVIVEFLPLEVGDHTQVMIIHFDTGEDVHVGLYGAATDINVRLDKNSLIIEKTYLSLTSQRTVTISNRSDIIAHFQWKAFSSQQEE--EHQKFCSDLRSEEEAETDRFLEECSADPSLRERLSLLSRTFQNRRKMVEGDNMLFSDDIFHIEPVEGDVWPNSSVEISVFFKPQAPKIYQRTIYCDITGRETRLPLRIRGEGLGPKLHFNFDQLDIGKIFVGSTHSYEAVLTNRGAVDGIFTLIPTCSAVGSCFTFSPNEGIILPAGHQAIQITVCSS-ILGEFKEEFHFSVDGASEEVKLTISGCIIGPTFHFSLPSLQFGDISFGFPSTLTFSLNNTSLVPMTFKLRIPGDGTGEPSITSSNQILNDRRSSWRRGVKNASPKEFSVAPSRGTIRSQGQLDIQVTICSNQVKRYELALVVDVDGIGDDVLALPITARCVVPTVCLMDSMLKFSRCFLHYPYEKTVTLKNLSNLPACYGLEPQEPNATSTVLYYSPNPSGIIEPQGSVDVPIILKAQVTGEQGIKAKIALFGCNESPLVSR-----EGPVVHVYPTEMDFGNIKVLTDISRILHLSNQSLIPARF---MAHKRSLWRIEPSHGEVPPHGEIQLTVFAHLDDTISFQDKIQLMIENSNTYFIPLYAKGIGTTIVTDKMFAPVLNLGAHFSAGPCQYHFTMTNRGRRTQQLYWMTEGFSQQRKRSQPPSIKTGAINSEHTSPVFKLHPSRMELTPGQSVDVLLEGFSDLPQVVKETLVGQAIIGKQTGKETIMEVDVICEFIAPVLNLSSKNLHFYTEKQPDDCLVPMSKSLKMKNISSLPLTIFLTLSEPFSLCNNDPLGNGEAKPQILEAGEENVITVRFDPTYIHDLRSQIIDDVLTIQYAEHPNTDHVSIKAEVHFPNLHFPTTQIHFGCILNDTESVQELTVTNSSPLPVQYHWSYL 1144          

HSP 3 Score: 587.03 bits (1512), Expect = 7.703e-167
Identity = 352/984 (35.77%), Postives = 549/984 (55.79%), Query Frame = 3
Query: 3951 EINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFT---SKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWT--TATSEIDEV----LKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSI-------------------------------ANKKDASQT---FSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGL---AIFKRSVVG----ITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIP-GENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVL 6749
            +I E LK   + +   +   I ++FD+ PL+GTL+P   + I FT++GH+ + A   A+C+V GGPTY   L GEAS V Y  +  + ++G   +DQVA   + L N GKV F FT        +M+PG      +P++ P SG + A    ++ V +  G P  F     +QVAHF  E+I++ G   FPR+ +DLPRN  I  +    +  ++  ++L     S      E ++ F++   E + E+L++         +    + + + K+ LP Y L+FG VI+G V +  V+I NTGHFP+  +  +  +   GF   L +VKNLPC +   F++ FDPR ANLNLG+VE+ +I+ + GG   PV L A VTMP L TSS+ VEF  V+ G+ ++ +IQL+NP PVL EW   T T +ID+     L+ +  +  +P+              P +FE++P AG L P QK NV+I+F P +EK YS RLV+ +A SS+R+++   G G+EP+LEF  S ++ GPVLPF+SG +  + ++NPC FPIE Y LE DK YLE+E+ILR + GYDS   LL+PPR  G+KLP E +EYY+E  KR  E    P  +D + E+ E   +     SI                                NK   +++   F+      T++++ A+ EL+Q PVS AIAR++G++++ EG+AA   RGIAI+V G+P++GK+  +  LA+ Y+   L++D ++++A++  ++P   +AR LC  AA    + + E+ A + +   G Q GL   A+ K +  G     T        S   + S V+  G+    Q   +K     +   +  +  SSP P A P   +L++    G  + L++C+LPDE++ +I+SERL L+DC +G++FDGL+ LF+++       +L S NNR+ +Y I L +D+ ++KE E  Q + K+VL
Sbjct: 1151 QIRELLKYASEVKPNCVLCFILQVFDIMPLFGTLQPGESQIICFTFYGHAGISAQAKALCKVSGGPTYEISLQGEASLVSYTLNTKDINYGIQRFDQVAEASIILKNTGKVSFPFTVLNQNCEGTMIPG------EPLVQPVSGHIAAGEEGVLKVSFFPGIPESFQRVIQLQVAHFEPESITLQGEAVFPRICLDLPRN--IKGKIPLENHHIYFSQMLSTAMDSL--LMMEMERLFLK---EHATEQLLS--------REGVHTVQQKLLKVLLPDYLLDFGYVILGDVRTYIVKITNTGHFPVCFRADRRGLVDSGFSTELDRVKNLPCCQTETFQVKFDPRGANLNLGLVEAVMIIQVSGGSKFPVRLRATVTMPSLCTSSDRVEFSPVQCGQCEIRSIQLYNPLPVLCEWAVMTCTLQIDKHTPLHLRKKLRQDMKPK--------------PPIFELMPAAGILLPSQKKNVEIRFFPQEEKLYSQRLVLQVAQSSQRVMILVEGKGMEPRLEFTPSVLELGPVLPFSSGDDVEVLVKNPCSFPIEFYCLEMDKQYLEEEKILRMLKGYDSQNTLLLPPRIPGEKLPYEILEYYEEQ-KRLQEEIVHPLLTD-HQESGEHPWVIMCTGSIIVYIMSYCITTLLSQVHQFYLTLILNVYAFLTNKYSHTKSVFFFTGEKQLQTDNDTKAVGELDQNPVSLAIARHMGIDISSEGRAASNRRGIAIIVHGAPLTGKSSAAVTLAQHYNIPCLSIDSVVLDAISDSNSPTGMRARQLCSKAAFDVALRESEETALQATETSG-QPGLSMEALAKHTAEGGQGTDTKTGPYSVISRANRGSIVTGKGKSESHQMQGSKQQHLSEPAGSQVIGKSSPFP-ACPTQKRLSVSASVGGELGLMSCVLPDELLQDIISERLQLNDCFRGVIFDGLDTLFARNMPSAVLSLLKSFNNRQHIYIINLHQDYATMKEREKAQRQ-KEVL 2094          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Xenopus
Match: DLEC1 (DLEC1, cilia and flagella associated protein [Source:NCBI gene;Acc:100488518])

HSP 1 Score: 72.4034 bits (176), Expect = 2.723e-11
Identity = 114/568 (20.07%), Postives = 208/568 (36.62%), Query Frame = 3
Query: 1293 FTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFA---------------FCEVTGRETRLSLKITGVGIGPKVEFS-FKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRH-QPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTA--IVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDS----------VSLDWGT-IKVLEDKSFNLQLSNESEIPAIF----------------------------HATMMKD----------QSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEF 2792
            F++ P +G + PH     TV++ P E   +   A               F         L L + G+    +++   +  +  G  +I      +  + NK     +++ E   S         P  G I P+    ++I     +  G   Q     ++   E + +  +    GP  S D+  +  G + +G  S    +++N S  PL+ +  V                K SP     ++ Q  +F IEP+ G L  +   K+ ++    +  +  T  VL+      E   +P+TA   +P+V L    L FS  ++    +  IKM N   LP ++    +   +  +  ++++  A   ++PN E E+ I L  YT  EL            KEPL L +    +G  +   S          + LD+G+ + +       L L+N+S I A F                            H+    D           + F   P  G +E    + ++V A  N   +++DE+   + +  TK +P+     G+ + F
Sbjct:  575 FSLTPAQGILQPHQDSTFTVSYTPTEMSEHHRVAHMVLREIPEPRGLTEFTPSVNDVIVLDLDLKGMAEAFQIQLEPYAIIFPGESYIGTTMRKQFKMWNKSKSAIVYRWEQITS--CHVVQIEPSSGTIEPNKCSELEICLTGGK-TGFCSQKVICHIEHSPETAALRVEATFKGPVVSIDIPSLDLGLLKLGSKSVSIFTIENKS--PLQAKWSV----------------KESPACLSEQNEQESQFLIEPNNGELLPLGQAKLALMFQPLTCQRLET--VLEFQVENGEGSYLPVTADVQLPQVRLLSSTLAFSGIYMGVPGQSSIKMLNQGRLPARF-CWGELTGSHSMQCAATITPANGTLAPNEEAEMNITLTSYTTDELYDIAFLCTVKDMKEPLTLRLMAKAQGLQITYSSDESAPVDPRDLLLDFGSEVPLYNTVQRKLILTNQSAISAPFSLEAAYFCGGDAQQLPILHSPYAPPPYLHSITCLDFRRALLSDGKGAAFVPRPSCGTLEGFQQIAIEVTAYSNMWGEYSDELLCKVGDLTTKSIPMKMAVRGSPLYF 1118          

HSP 2 Score: 55.8398 bits (133), Expect = 2.688e-6
Identity = 83/391 (21.23%), Postives = 152/391 (38.87%), Query Frame = 3
Query: 1950 SPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYH-------------------TGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDF-SRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKV---------LEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVI 3035
            +P++ C  H    FS+ P++G+L         V  T   + ++H                   T  V DVI     +  + +   A   +++L    + F   +++  +  K  KM+N S   I Y   R  + T   +      +  + PN   E+ I L     G  + KV   I   S E  AL ++   +GPVV++D  SLD G +K+         +E+KS      +  E PA   +   + +S F +EP +G +       L ++     C +    ++  +EN +   +P+ A      +     +SS +     +       + +++N+G+   +  W             TG+ +   A   T+ P    L+P E A + I
Sbjct:  562 APQDVCDLHTSLPFSLTPAQGILQPHQDSTFTVSYTPTEMSEHHRVAHMVLREIPEPRGLTEFTPSVNDVI-----VLDLDLKGMAEAFQIQLEPYAIIFPGESYIGTTMRKQFKMWNKSKSAIVY---RWEQITSCHVVQIEPSSGTIEPNKCSELEICLTGGKTGFCSQKVICHI-EHSPETAALRVEATFKGPVVSIDIPSLDLGLLKLGSKSVSIFTIENKSPLQAKWSVKESPACL-SEQNEQESQFLIEPNNGELLPLGQAKLALMFQPLTCQRLETVLEFQVENGEGSYLPVTADVQLPQVRL---LSSTLAFSGIYMGVPGQSSIKMLNQGRLPARFCWGE----------LTGSHSMQCA--ATITPANGTLAPNEEAEMNI 927          

HSP 3 Score: 54.6842 bits (130), Expect = 6.279e-6
Identity = 48/198 (24.24%), Postives = 85/198 (42.93%), Query Frame = 3
Query:  369 PLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSP--PNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTERE-KFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANF--------------SISTS-----GPFSVEPCASVLEVNESMQIDVQFTPELPKDFS 896
            P+F   P  +FF + +  + YE+ + LRN     R +++    +PYF V     P     VA G+   + ++F P+   D++  L+V T+     +VPI       +L  P  +   P  +   +    F+RN G +   F              S++TS     GPF + P A  L   + + ++V  +  L + F+
Sbjct:  274 PVFLANPPVVFFPDYEVGQIYEMAIELRNMTASSRHLRIIPPSTPYFSVGLGKFPGEGGIVAPGMSCHYTVRFVPDSLADFEDFLLVETQSPYPVLVPIEARRPPPVLTIPRTLNCGPCLIGGVKVLEYFLRNEGLSRGRFCIMPRRVWPPANFRSVATSGFVEDGPFGIRPAAFELYPGQGINMEVSESANLGRVFT 471          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Mouse
Match: Hydin (HYDIN, axonemal central pair apparatus protein [Source:MGI Symbol;Acc:MGI:2389007])

HSP 1 Score: 1702.57 bits (4408), Expect = 0.000e+0
Identity = 995/2769 (35.93%), Postives = 1575/2769 (56.88%), Query Frame = 3
Query: 7215 ISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTT-----------VFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKI-IQQKLETE-LPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTK-----PMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISD------DG-------LKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRF------------------NIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAF---------WVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENL-PIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTAR----QGKYETIKKXXXXXXDLN-NPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLL-LTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEP-QQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNV----EAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            IS+E ++S  + +KD  K     L QKFK +D   K +  I+  WDR    + P+    E   E  ++  + +                       +R +   A   ++     + + +            ++  GVP + I+       D E +  +Q LE++ LPK D++L+ LGLG  GPPIPPP  FSI+ YP +R++   +E+L    H+ F+             DI   DE K  E    D+ + T  TK     P  PK S+  +K+K  + R++  +K    +            S  + P+SD      DG       +++   RWI+ P+ E+ LR+ F S ++G +DQ FNFE+L TRR+YQ++CRG+C +P I ++P++VF  RK++ +  E+V KKY++  E F FGPLL  K + +  +  +P NME + I N SPM+ E  F F HD     + L+P +MTL+P E Q LN+WA+P     FED+I+CC+KENPEP I+K+SC G+ P +E++ + +HF+R+LLHRK+ K V LRN T LPV WRI+ LE LG++F+ +   GT+    E+ L  +F+  KP   N KK IR+E+ D E L G++Q E + I AE+YD+ALD++FPKGA  GLD GTL+V +E KQ + LKNRG YEI + F +D       NLS++ ++ P +G ++  +K   VQ+ + A++EV I  + IL+C +IEP + + GE+IA IPI+ S  + YSK+ I+P + INFG++   TRK+    IEN G  DF++                  +++ G+  ++ +   P + K     D++     +++ NI    +Q+R   G FT++P  G +P+    ++T++C +D  G+C+E L IDI+DR+P+ +P G+ Y L  EA +P+  ++N   IFEEH+IC +  + +  L  + SGG++ + EN+F+F NVLVG + +A+F++ N   + CDI++ +KP+         + +  + D F+VEP++  I  R   +V+V+F+P  MQ Y  IF+  ++GLPSN + RS+ L F++ GEG LPRV V +PTL N+    L LFK+ LLG  +   + L N+G +P ++H+D+ D    F         ++   ++N         K+ H   L +  G    FDV F     G+    I ++V+NNQYE+T+I L+GE YED IT +N+  +I S+    +  S V +   +S      E+++ A     + FG C+I    ++SF++ NHS+   +RF WP   +          + FSP +GHLHPG +  V+ T++S SP T  +  ++CKL +I M  L     P +WDD  +T+KW+D P +  ++     K+KVIE + EP  + V E  R L +  +AN+++  Y+C+ TE+ F++T++++TR++   + N GQ+ +++ W  +  +  +      R  +++    QG   ++    +   + + +PFS+ P  GV+   + Q+ +V F+P+++  +++++ C+I NL      P +   GRS+ P+CHF+L +SDY+   RR+P +R     P    + PNTRVIE   +G+  ++++ F ++NPT + + + W  E++E  ++     CL   GI+   KK +  FQF    + +TE FW F IPE  I+VPFL+VG+ T+P ++ DKSH  F +LLIG E+ ETV+IIN + Q +NFAFQD SR++ G +NSL + PM G IP   +  + I FT      +NFNL C + KK +PL++NVKAEGY++++ V   D  G ++ LT           N IN   +E+ E      + +N G+FN+ +  ++     PKL    L  TP   +V +G+    +L     +   L+ +   + I +G +++ NI      P + FSF+ H+FG CF+Y+ GM      LV+TN++     +  +S++CL  +      NF   VI PG +  I ITF PR+   Y++ + FEING+S+  V++ G   E+KL  +D  N  + LG V  G+ V KTV++ N +   +T       +  ELQ+  V  + P    I + P +     ++I F P +R+  F+EEV  E +G+  P+F+++G CQA +I  D E + FG V   +  T+++ ++N GD+GARFKW+    KP FSI+P  GYI  G E+  E+++ P +   +  Y N+ C I+G   L L L+G C     VKE++NFN  VR +  +++ + N +N TW L P+ EGEHW G E   +E  QQ K YE+T+KP TM  + +KHQG++F  +PDG+G LY L G AE PKA++ I REVP + P++ELL + NWL +PQRF+VI E+LKPEK++ S+ LKG +Y+DV  G  K YKL   + KEGL   KV F NE T EF +Y +  +         IQ+++PVRQS+  S+ LEN     + +       +I   +QF V   S+  F+FEF PL+  E   +L + + D     Y+L L   P+ PE+P+ F T +GS Q++LA F N+ + K+++ CK D + FH +K I  AP      E  +EV FEP+ LGE+KG+L +S+ + GE+I PL G+A PPKPQGPF+I+ G ++ I F+NVF+ A  F F +++  F I + +E ++  K + + + F+G+  G   P+  KL+VTCP+ E   + ++WVYYL+G
Sbjct: 2471 ISQEQEDSEGDFLKDSDKN----LAQKFKIYDMCLKDVQNILMYWDRKQGMMVPHTGTDEMSHEADDQRQAPSGGGGRKGRKDRERERLEKERAEKERLEREKAERERLEKLKALEERSDVEGEGEEEHEGKKDLGVPFINIQ-----SPDFEGVSWKQALESDKLPKGDQILDILGLGSSGPPIPPPVLFSIISYPAKRQSLVATEILK---HFVFV--------IPPNDDIPLMDEKKDPEG-DSDIFLNTIITKAQEEQPSPPKGSKQKLKDKPEQVRETQKEKRRTYS---SRKGLPGGTSGSIVPMSDIDQNSFDGEHSQEKFIRLNHFRWIVPPNGEVTLRVHFSSLDVGNYDQTFNFELLGTRRQYQLYCRGVCTYPYICRDPKVVFSQRKKDMKLKEVVVKKYVVSMEKFYFGPLLCGKSRDKYKSSLFPGNMETLTILNDSPMVVEAYFCFQHDIKASTYFLEPVNMTLKPNEKQALNVWAYPTAVGIFEDSIVCCIKENPEPAIFKLSCQGIRPEIEVEPRQLHFDRLLLHRKETKIVILRNVTPLPVAWRISNLEHLGEDFTVSMMQGTMLPKGEYGLQVHFQPSKP--VNIKKAIRIEVLDAENLVGVVQIENILIFAESYDIALDITFPKGAEGGLDFGTLRVMEEVKQTLQLKNRGKYEIIFSFTVDTLGVLPTNLSSMISVQPKRGTLASIDKPTTVQVFFRARKEVKIDCQPILRCQIIEPTLPE-GEIIASIPIKFSVNAVYSKFTISPSSIINFGALICGTRKSITFTIENQGIIDFKYALYRLTGESPILQKKITSHMRHGRTRESESFYKPGATKMAKFSDTV-----QKDTNI---ANQARFTHGMFTVYPGFGSIPSGGQQVITIECFADPVGRCEEFLAIDISDRDPRENPAGIPYTLLAEACLPAFVTDNNILIFEEHQICTSPNLYHI-LQTIQSGGLFVEDENKFIFCNVLVGHQAKARFKISNVGKISCDINIVIKPI-------SNKPANRITDTFDVEPSKMCIGSRSHAFVTVLFTPQTMQTYQCIFEATLDGLPSN-IARSRGLVFDIVGEGTLPRVTVIRPTLYNQHGNPLLLFKRLLLGHSEKLPLILKNNGTIPAQLHVDLRDQLGVFSLKGRPTTSYIYIMEENKPNE---KVKKAHTASLVVSPGDTAEFDVFFHSNKIGRMTGTIHLSVINNQYEETMIHLVGESYEDDITLDNIHGLISSTSQESSDKSEVIEIAEEST----MEDLVTAALMEHIQFGYCHIGISYNVSFTITNHSQVNVIRFEWPLLAT----------LSFSPQIGHLHPGCSKDVVVTLKSESPITLKKMCVKCKLSKI-MFQLPVDQVP-DWDDRMRTVKWVDAPRNTPLTLNT--KRKVIEMDPEPAHSVVEENYRELRIQFSANVDFASYQCETTEVFFKETLVYQTRVFEFDLVNTGQVLLEFCWISEEASKAVSFAMPERQGSSQKELSQGSGSSLDSALDRWTEASPSPFSVEPPSGVVPVGKTQKLKVKFSPMDIGEFESSLYCQIPNLPLGEQGPILITKGRSVLPFCHFDLKESDYISGHRRNPELR----GPGAGPLEPNTRVIEFTSVGIGGKNVQTFTILNPTNSTYSFCWTSEETESLQHPPAFVCLTEKGIIHPEKKAEIIFQFLPAHLDITEEFWTFSIPEHNISVPFLLVGKTTDPLISLDKSHLNFSSLLIGREARETVKIINKEEQGFNFAFQDNSRYSEGFNNSLIVCPMEGWIPPLSRFPVDIFFTPKQEGDVNFNLICNIKKKAHPLTLNVKAEGYTMNAEVKCRDRMGTTILLTSTQ-------VNTINFYEVELNECVQCEFSFINTGKFNFSYQAEL---SGPKLLLQYLDFTPTDSSVDVGQSEPANLSFQPYQKCVLKGLELKIKISHGPTFVCNILGCAVSPAVHFSFTSHNFGTCFIYQAGMPPYKQILVVTNKE-----ETSMSLDCLYTNTPHIEVNFNVDVIKPGKTLEIPITFYPREAISYRELIPFEINGLSQQTVEIKGKGTEMKLLVLDPANRIVKLGAVLPGQVVRKTVSLVNNSLAQLTFNHSVLFSIPELQEAKVITLEPF-HTITMKPKE--VCKLEITFAPKKRVPPFSEEVFMEWMGLLRPLFLLSGCCQALEISLDQEHLPFGPVVYQTQATRRILIMNTGDVGARFKWDVKKLKPHFSISPEEGYIISGTEVALEVTYHPTEIGKESLYKNILCFIQGGNPLCLTLSGTCVGPPVVKEVVNFNCQVRSRHTQTILLSNRSNQTWNLHPIFEGEHWEGPEFITLEAHQQNKPYEITYKPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTAELPKAVANIYREVPCKTPYTELLPISNWLNKPQRFRVIVEILKPEKTDLSVTLKGLDYIDVLSGSKKDYKLNFFSYKEGLYTAKVIFRNEVTNEFLYYTVSFRVTPSGIIKTIQMTSPVRQSVSASIKLENPLPYSVTFSTECKLSDISLPSQFAVPPNSEGTFSFEFQPLKAGELCGRLTLHNSDLGYYQYELALKALPAPPEKPVHFQTVLGSSQSILAKFTNYTRLKTEYYCKTDCSDFHTEKVINAAPGAQGGTEVSVEVFFEPSHLGETKGILCLSSLIGGEYIIPLFGIALPPKPQGPFLIRAGYNIIIPFKNVFLHATSFSFIVENPAFSI-RAAETVRPKKINNITVYFEGNPSGSKTPITSKLIVTCPQCEGTESGIKWVYYLKG 5151          

HSP 2 Score: 1453.73 bits (3762), Expect = 0.000e+0
Identity = 830/2323 (35.73%), Postives = 1322/2323 (56.91%), Query Frame = 3
Query:   81 YKMPIGKFGEVIGTMNTFGEQEIT-YDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDG---TSDPILAADLTSK--VSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGY--SYTKAMRQTGTKNAIKA----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNE--FSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDT-------TTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEF------------VEKNIELSEEELMTYLEDLAVTNQPKKPLN-----------KAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTT----ATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLK---RHMELD---------GAPQKSDKYNEAPE----------ASEIEQLENSIANKKDASQ----------TFSKSAMSITNSES-PALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAI----FKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIP-GENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEE---NDQEELKK 6743
            +K    +  E +G M+    + I+   SKV+ P +PK++ +      +TPSEF+ +MSL T +KL +T+ +  P   ELLDMG TT+QK + V ++  LFQPFPS + F N  P E YE+PL+LRNNDK+PR+VKV  E SPYF ++SP ++ HKVA G+P VF+I FTPE+ +DY   L  +TEREKFIVP+   G+RAILDFPDE+ F   P+KY   K L +RNIG+  + F + T  P+SVEP   +L V ESMQ++V F P+       ++I+ Y+TGE V+  ++G   ++ +R++++ + +E+TY+ LAN R IT+HNR++++ HF W  F+++  ED ++      L  EE +E      D  L     ++LSI++R++ N++K+ +     F+D +FTI+P EGD+WP++S +ITV F P+EA+ YQ   +C+++GRE RL L+I G G+GPK+ F+F+ LD+G +FI + HCYE IL NKG IDALF +    S +  CF F P +G+I PS  Q VQI F S   LG F + F + ++G  EP  +  +G VIGPTF F+V  + FG VS GFP +   SL NTSLVP+ F+LRV  DG   +S P  + +  SK            +P+EF+I P+ G + +     I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VPK++L   E+DF R FL+Y YEK I++ N   LP  Y++L Q  E +  +L SS     ++SP+S + IP+ L+   IG   + V+  +FGS + PLA  I+ IGEGPV+ +    +D+G I VL+D S  LQLSN+S IPA+F   M   +S++ V+P  G +     + L + ANL+D V F D + L I++S T  +P+ A G G+TI  D P +  +NLG+HFS       +++ N+G+R QQL W N+ +     ++ ++ G K +  +                P+  ++P R +L PG++  ++++GY   P+ V+E ++C +I+G Q GK L+  V++   FI+P+++ S + L +RL+K  +++ E   +++   N++ L +N  L+   PF I E ++     + K + L  ++ + + I+F+P +++D ++ + ++ L + + EHP VD + L  EV++PNL F+   I+F CILN +EV +++M+ N SPL V++ W  LV ++ N I      +P     S+   + AT           T E +  +F  S + + +D     EE++      ++ E    ++    G E     S  +P     +  +E              ++E++ +GIEE+FD+ PLYG L+P S  QI+FT++GH D+ A   A+CEVEGGPTY   L GEAS V Y F   + ++G  L+D V  +E+TL N GKVGFEF           N  P G P+++P SGF++++   ++ V YL G P  F  +  IQ+AH   E I++ G G FPR+++DL RN        N   + F  +   + +K +++Y    + E             +  ++++  E L+  ++D A+ +Q     N           + + K+ LP Y L+FG +++G V +  V+I NT HFP++    K  + + GF   L +VKNLP  E   FE+  DP+ ANL +G  E  L + + GGP++ + L A V +P +  S   +EF  ++ G+  + TIQL N   V  EW      +T+++D+ +     +  +  ++ K R          +FE+ P +G L PG++ NVQ+KFMP +EK YS  L+  +  SS+++ +   G GLEP+LEF  S ++ GP+LPF SG E  + +RNPC+FPIE YSLEFD+ YL +E++LR + GYDS+  LL+PPR  G+KLP E  +Y+ E  K    HM+                SD+   + +           S +E+   +I  K    +          TF    M  T+S S   + E+E  PVS+AIAR+LG++++ EG+ A+  +GIAI+V G+P+SGKT  +  +A+ Y+AA L +D I++EAL+  +     +AR+LC+ AA    + + E+ A + S+ + T     +      R    +T +    +     + S +   G+       S K H   +++     + SS P L GP   +L++    G    L++C+LPD+++I+IL+ER+ LS+C +G+VFDGL+ LF+++       +L ++ +R  +Y I + +D+  +K +E    +QEE K+
Sbjct:   45 FKQTNKRLEESMGAMHRKMAKVISGLQSKVLPPMSPKVVTEEEVNRMLTPSEFLKEMSLTTEQKLASTRIICRPQITELLDMGETTHQKFSRVDLDQALFQPFPSEIIFQNYSPCEVYEVPLVLRNNDKIPRMVKVVEESSPYFKIISPKDIGHKVAPGVPSVFRILFTPEENKDYAHMLTCITEREKFIVPVKARGARAILDFPDELNFSTCPVKYNTQKVLLVRNIGNKDSMFHLKTRSPYSVEPTGGILNVGESMQLEVDFEPQTVGSHDGKLIVTYDTGEMVFVCLYGVAIDVNIRLDKNSLIMEKTYISLANQRSITIHNRTNIIAHFQWKVFATEEEEDKEKYKICDGLNKEEKQETSMILEDSVLDPSLRERLSIISRTFENQRKLVQGDSMLFLDHVFTIEPPEGDVWPNSSAEITVYFNPLEAKLYQQTVYCDISGREIRLPLRIRGEGMGPKLHFNFELLDIGKVFIGSAHCYEAILSNKGSIDALFNVIPPTSALGACFVFNPKEGIIEPSGVQAVQISFSST-ILGYFEEEFLIDVNGSPEPVKMTIRGCVIGPTFHFNVPALNFGNVSYGFPHTLMCSLNNTSLVPMTFKLRVRGDGEGMSSIPSYSQESDSKQWSGINTEMPTTKPKEFTISPNSGTIRAQGFTAIKVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPKLQLVTTEVDFGRCFLKYPYEKTIQLVNHDDLPGCYKVLPQLYENSPPVLLSSPSPCGVISPHSTVSIPLALETQVIGAHRSIVYISVFGSQEAPLACNIQSIGEGPVIFIHPTQIDFGNIYVLKDTSRILQLSNQSFIPAVFRVRMANKKSLWTVKPSEGAVPAEDDIPLTLTANLDDIVTFKDTVILEIKHSNTYRIPIQATGIGSTIVSDKPFAPELNLGAHFSLDTHYYRFKLTNKGRRVQQLFWMNDDFRPKEKQSKKEPGKKGSTSSSRRQSKASQEPTDNGNPVFQLYPVRMELYPGQTIDVILEGYSATPKKVKEKLVCQAIVGTQKGKSLLMSVNIICEFIAPIIQLSAKQLLYRLEKKPNSNLESDYQSLVIKNITTLPVNMLLSTTRPFFICETDKSLLPATPKPIKLEVDEEKHLLIKFDPSYRNDLNNWVAEEVLSIKYLEHPQVDNLGLRAEVHYPNLSFEVMDIDFGCILNDTEVIRYIMITNCSPLVVKFRWFFLVDEEENQIRFAPCMKPYSAFLSQMESIAATSVTASSLAAPHTVEYTEMDFSDSIKTILMDDEAGPEEIKKPATSTMVSEA---IKYSSAGTE----RSQSQPDYPECMWIYE--------------QDEMLSIGIEEVFDILPLYGVLRPYSSHQISFTFYGHCDIIARAKALCEVEGGPTYEVLLKGEASLVNYSFDTKDINYGLQLFDHVTEREITLKNTGKVGFEFNVLSNYRSSQRNLLP-GVPLILPLSGFIQSNKEQVLKVYYLPGIPEVFQRNFQIQIAHLVPENITLYGEGIFPRISLDLHRN-----LQGNEKYEHFLEQAKKNVEKEYTKYEAVDQYEVMAEELPEEETAEISAHVQMEVERLI--VQDYALEHQRSISNNTEDIYFSQRSCRKLTKVQLPEYILDFGYIVLGDVRTHIVKITNTSHFPVSFHAEKQVLHETGFSTELDRVKNLPYYETETFEVRCDPQGANLPVGNKEVILPIKVYGGPTIHLCLQATVIIPSMTLSCNKIEFATIQCGQCMVETIQLSNHLQVPCEWFVHTPKSTNKLDKHMPKYLRRKLQAEMIPKSR----------IFEIQPTSGILDPGERANVQVKFMPKEEKLYSQSLLFQIGQSSQKLTLLAQGQGLEPRLEFSPSVLELGPLLPFASGDEAEVIVRNPCNFPIEFYSLEFDQQYLLEEKMLRQLKGYDSYNTLLLPPRNPGEKLPPEVYDYFKEMKKSKEEHMKAKYMENLENEEEEMNTSDQGTTSTKRTSISRGISVTSNLEERHLTIEAKNYLDEDDYEESLEKLTFQTDKMQSTDSHSVEEVGEVESNPVSKAIARHLGIDISAEGRLAKNRKGIAIIVHGTPLSGKTANAISMAKFYNAACLNIDSIVLEALSDTNNILGIRARELCIRAAIEQSMREAEESAHESSMTQNTVVPARLSTENLGRFTSELTLITQEYKVPKTVRGSVMLPKGKADSHFTGSQKQHHQHQSETPQVQISSS-PLLPGPTHRRLSVSASIGGETGLMSCVLPDDLLIQILAERIQLSNCFRGVVFDGLDTLFARNAPSALHCLLKAIGSREHIYVINMSQDYVVMKAQEKAKKEQEENKR 2326          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Mouse
Match: Dlec1 (deleted in lung and esophageal cancer 1 [Source:MGI Symbol;Acc:MGI:2443671])

HSP 1 Score: 75.0998 bits (183), Expect = 3.074e-12
Identity = 72/282 (25.53%), Postives = 123/282 (43.62%), Query Frame = 3
Query: 1737 PSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDV-IGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLL-YSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIP 2576
            P ++  +    GP  + DV  ++FG + +G  +S  I ++N S +   + L+        P+  A+    VSP           F IEP  G L  +  C++ + L A+   +  T L L+V  G G+ L   P+ A    P V L    L+FS  +L  S +    + N + LP ++   +      DL   + S    ++ P+ EL++ +EL  +T  +LT  V        ++PL L I     G  V +  V  D  T    +++   L+L   S++P
Sbjct:  840 PVVLHIEASFKGPALTIDVPALQFGLLRLGKKASISIQIRNVSQLSAVWHLK------ESPVCLAERDEDVSP-----------FDIEPFCGQLLPLGECRVTITLEASQCQRLQTVLELEVENGSGSYL---PVYAEVQQPHVYLKNSHLEFSNLYLGVSTKSRTTLVNGTLLPTRFHWGKLLGPQADLCTMTVSPTQGLLGPSEELQLTLELTTHTEEKLTNLVLLCHVSGMEKPLVLGISGKPLGLQVTISIVESDGSTTSTTQEE---LRLDFGSKVP 1098          

HSP 2 Score: 56.225 bits (134), Expect = 1.789e-6
Identity = 71/353 (20.11%), Postives = 151/353 (42.78%), Query Frame = 3
Query: 1800 IKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGL--VLDVI---------GVGNELYSIPITATAIVPKVELSCDELDF------------SRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFH--------ATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMA 2765
            I+F   +V   + +++ ++N + V L F  ++       P++  +  S  S +  C   +   FSI P +G+L S +  +  +  +   +  +H+ L  VL+ +          +G+  YS+      IV ++E+      F               ++  + +K  KM+N+S  PI+Y      + +   +      T ++ PN   +  + L     G  +  +  +I   S  P+ L I+   +GP + +D  +L +G +++ +  S ++Q+ N S++ A++H        A   +D S F +EP  G +       + +    + C +    ++L +EN     +P+ A
Sbjct:  614 IRFEPENVQSTAKKQLIIRNATHVELAFHWQI-MKPNLQPLMPGETHSSDSIK--CHPDRETAFSIIPEKGILESHSDQEFILSFSPYKLKCFHSVLQMVLEAVPEPLSSGLENLGDYSYSV---DDMIVLEIEVKGLAEPFQVLLEPYALIIPGENYIGITVKKDFKMWNNSKSPIRY---MWGKISHCHIIEVEPCTGVIEPNEVGDFELNLTGGVPGPTSQDLECEI-KDSPCPVVLHIEASFKGPALTIDVPALQFGLLRLGKKASISIQIRNVSQLSAVWHLKESPVCLAERDEDVSPFDIEPFCGQLLPLGECRVTITLEASQCQRLQTVLELEVENGSGSYLPVYA 956          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Mouse
Match: Dlec1 (deleted in lung and esophageal cancer 1 [Source:MGI Symbol;Acc:MGI:2443671])

HSP 1 Score: 73.1738 bits (178), Expect = 1.281e-11
Identity = 63/242 (26.03%), Postives = 107/242 (44.21%), Query Frame = 3
Query: 1737 PSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDV-IGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLL-YSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTI 2456
            P ++  +    GP  + DV  ++FG + +G  +S  I ++N S +   + L+        P+  A+    VSP           F IEP  G L  +  C++ + L A+   +  T L L+V  G G+ L   P+ A    P V L    L+FS  +L  S +    + N + LP ++   +      DL   + S    ++ P+ EL++ +EL  +T  +LT  V        ++PL L I
Sbjct:  840 PVVLHIEASFKGPALTIDVPALQFGLLRLGKKASISIQIRNVSQLSAVWHLK------ESPVCLAERDEDVSP-----------FDIEPFCGQLLPLGECRVTITLEASQCQRLQTVLELEVENGSGSYL---PVYAEVQQPHVYLKNSHLEFSNLYLGVSTKSRTTLVNGTLLPTRFHWGKLLGPQADLCTMTVSPTQGLLGPSEELQLTLELTTHTEEKLTNLVLLCHVSGMEKPLVLGI 1061          

HSP 2 Score: 56.225 bits (134), Expect = 1.716e-6
Identity = 71/353 (20.11%), Postives = 151/353 (42.78%), Query Frame = 3
Query: 1800 IKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGL--VLDVI---------GVGNELYSIPITATAIVPKVELSCDELDF------------SRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFH--------ATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMA 2765
            I+F   +V   + +++ ++N + V L F  ++       P++  +  S  S +  C   +   FSI P +G+L S +  +  +  +   +  +H+ L  VL+ +          +G+  YS+      IV ++E+      F               ++  + +K  KM+N+S  PI+Y      + +   +      T ++ PN   +  + L     G  +  +  +I   S  P+ L I+   +GP + +D  +L +G +++ +  S ++Q+ N S++ A++H        A   +D S F +EP  G +       + +    + C +    ++L +EN     +P+ A
Sbjct:  614 IRFEPENVQSTAKKQLIIRNATHVELAFHWQI-MKPNLQPLMPGETHSSDSIK--CHPDRETAFSIIPEKGILESHSDQEFILSFSPYKLKCFHSVLQMVLEAVPEPLSSGLENLGDYSYSV---DDMIVLEIEVKGLAEPFQVLLEPYALIIPGENYIGITVKKDFKMWNNSKSPIRY---MWGKISHCHIIEVEPCTGVIEPNEVGDFELNLTGGVPGPTSQDLECEI-KDSPCPVVLHIEASFKGPALTIDVPALQFGLLRLGKKASISIQIRNVSQLSAVWHLKESPVCLAERDEDVSPFDIEPFCGQLLPLGECRVTITLEASQCQRLQTVLELEVENGSGSYLPVYA 956          
BLAST of Hydin_ADK domain-containing protein vs. UniProt
Match: sp|Q4G0P3|HYDIN_HUMAN (Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3)

HSP 1 Score: 1751.49 bits (4535), Expect = 0.000e+0
Identity = 1005/2773 (36.24%), Postives = 1553/2773 (56.00%), Query Frame = 3
Query: 7215 ISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAH----PPIKPNQVPVEQHGENVNEENSTNPLK-RVGR----------TTVFNKRSKDHGANSGQVPPHTPVHDEN--PEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKI-IQQKLETE-LPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHY----------------------NFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNI------------KSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNA-----TEPGP-VTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFT------PRSSRPNTARQGKYETIKKXXXXXXDLN----NPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEP-QQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            + ++ ++S  +  KDP K+    L  KFKT++   K +  I+  WDR      PP    + P E       ++    PL  R GR               +R +   A   ++     + + +       E      E+  GVP + I+       D E +  +Q LE++ LPK +++L+ LGLG  GPPIPPPA FSIV YP++R    +++ L    H+                      +F+ T      ++      +  + K  EKI +   IQ    K  R       V         S    ++L NF  + S              +   ++   RWI+  + E+ L++ F SDE G FDQ FNFEIL T  +YQ++CRGIC +P I ++P++VFP RK + + NE++ KKY++  E + FGPLL  K + +  +  +P NME + I N+S M+ E +F F +D     + L+P +M L+P E Q LN+WA+P     FED+I+CC+ +NPEP I+++SC G+ P +EL+ + +HF+R+LLHR++ + V LRN T LPV WRIT LE LGD+F+ +   GTI   +E+ L+ YF+  KP   N KK IRLE+ D E L G++Q E + + AEAYD+ALD++FPKGA  GLD G ++V +E KQ + LKNRG YEI + F +D       N++++ ++ P +G ++P EK   VQ+ + AK+EV I+ + +L+C +IEPNI++ GE+IA IPI+ SA + YSKY ITP + INFG++   TRK+    IEN G  DF+F +            K+    ++       S  +TG   +     + Q E    G  Q+R   G FT++P  G +P+    ++ VDC++D  GKC+E + IDI+ R+P + P G+LY L  EA +P+  + N + IFEEH+IC T   ++  L  + SGG++ + EN+F+F NVLVG + +A+F++ N   + CD+++ ++P+         +  A + DIFEVEP++  I      + +V F+P  MQ Y  IF+  ++GLPS +L +S+ L F++ GEG LPRV V +P L N+    L LFK+ LLG  +   + L N+G LP ++H+D+ D    F +      A      E  P V +K+ H   L +  G    FDV+F  +  G+    I ++V+NNQYE+T I ++GEGYED IT +N   I   + P +         T+ +     E+++ A   + + FGDC+I    + SF++ NHS+   +RF WP   S+T        + FSP +GHLHPG A  ++ T++S  P       I+CKL RI M  L +   P +WDD   T+KW+DVP +  +      K+KVIET+ EP  + + E  + L L I+AN+++  Y C+  ++ F++T++++TR++   V N G++++++ W +  D S   +        S++ +   QG   T    +   +        PFS+ P  G++   + Q+F+V F+PL++  +++ + C+I NL P    P +   GRS  P CHF+L DSDY+   +R+P +R       G  ++PNTRVIE   +G+  ++++ F ++NPT + + + WI E+ E  +N     CL   G +   KK +  FQFT   +G+TES W F IPE  I VPFL+VG+ TEP ++ +KSH  F +LLIG E+ ETV+IIN + Q ++F+FQD SR++ G SNSL + PM G IP   +  I I FT      +NFNL C V+KK +P+++NVKAEGY+++  +  +D TG    LTP          N IN   +E+ E        +N G+F + F   +       L   L  +PI  TV +G+ +   L     +   L  +  ++ I +G +++ NI+     P + FSF+ ++FG CF+Y+ GM      LVITN++     + P+S++CL  +      N    V+ PG++  I ITF PR+   YQ+ + FEING+S+  V++ G   ++K+  +D  N  + LG V  G+ V +TV+I N +   +T       T  ELQ+  V  + P    I + P +     ++++F P +R+  F+EEV  E +G+  P+F+++G CQA +I  D E I FG V   +  T+++ M+N GD+GARFKW+   F+P FSI+P  GYI+ GME+ FE+++ P +   +    N+ C I+G   LSL L+GVC     VKE++NF   VR +  +++ + N TN TW L P+ EGEHW G E   +E  QQ K YE+T++P TM  + +KHQG++F  +PDG+G LY L G +E PKA++ I REVP + P++ELL + NWL +PQRF+VI E+LKPEK + S+ +KG +Y+DV  G  K YKL   + KEG    KV F NE T EF +Y +  +         I++ TPVRQ    S+ LEN     + +      P+I   +QF V + S+  F+FEF PL+  E+  +L + + D     Y+L L  TP+ PE+P+ F T +GS Q +L  F N+ + ++++ C+ D T FH +K I  AP      EA +EV FEP+ LGE+KG+L +S+   GE+I PL G+A PPKPQGPF I+ G S+ I F+NVF     F   +D+  F I +  E+++  K + + ++F+G+  G   P+  KL V+CP  E     ++WVYYL+G
Sbjct: 2434 LVQDQEDSEGDNSKDPDKQ----LAPKFKTYELTLKDVQNILMYWDRKQGVQLPPAGMEEAPHEP------DDQRQVPLGGRRGRKDRERERLEKERTEKERLEREKAERERLEKLRALEERSDWEGEGEEDHEGKKEKDLGVPFLDIQTP-----DFEGLSWKQALESDKLPKGEQILDILGLGASGPPIPPPALFSIVSYPVKRPPLTMTDDLE---HFVFVIPPSEDISLDEKKEMEIESDFLATTNTTKAQEEQTSSSKGGKQKMKEKIDQVFEIQ----KDKRHMALNRKVLSGEPAGTISQLSDTDLDNFNGQHS-------------QEKFTRLNHFRWIVPANGEVTLQVHFSSDEFGNFDQTFNFEILGTCCQYQLYCRGICTYPYICQDPKVVFPQRKMDMKTNEVIFKKYVMSTETYYFGPLLCGKSRDKYKSSLFPGNMETLTILNTSLMVVEASFYFQNDVKANTYFLEPNTMVLKPNEKQILNVWAYPTSVGVFEDSIVCCINDNPEPAIFQLSCQGIRPELELEPRQLHFDRLLLHRQESRVVLLRNVTLLPVAWRITSLEHLGDDFTVSLMQGTIPPEAEYGLHLYFQPTKP--VNIKKAIRLEVLDAENLLGVVQIENIMVFAEAYDIALDITFPKGAEGGLDFGIVRVTEEAKQPLQLKNRGKYEIAFSFSVDSVGISTPNINSMISVQPKKGSLTPTEKPTNVQVFFHAKKEVKIEHQPVLRCQIIEPNISEGGEIIASIPIKFSANAVYSKYNITPSSVINFGALICGTRKSTTFTIENQGVTDFKFALYKLTGESPIHQKKAASHVRHARSRESESFYKTGSSRAAKFSDTIQKEVTTTG--QARFAHGMFTVYPGFGSIPSGGQQVINVDCVADAMGKCEEFIAIDISGRDPAVHPAGILYTLLAEACLPAFVTENNALIFEEHQIC-TSANLHHILQTIESGGLFVEDENKFIFCNVLVGRQAKARFKISNVGKITCDVNIVVRPI-------SNKPFARIVDIFEVEPSKMCIASHSHAFATVSFTPQIMQNYQCIFEATLDGLPS-TLAKSRGLVFDIAGEGNLPRVTVVRPVLHNQYGNPLLLFKRLLLGHSEKLPLILKNNGVLPAQLHVDLQDELGVFSLKGRPTTAYIYITEENKPHVKAKKAHTASLVVSPGDTAEFDVVFHSQKVGRMRGIIHLSVINNQYEETSIHMVGEGYEDDITLDN---IHGLVAPTSQEDISISEFTEIIEDNDMEDLVAAALVDHIQFGDCHIGHSYNASFTVTNHSQVNLIRFEWPV--SAT--------IAFSPQMGHLHPGCAKDIVVTMKSDVPINLKNMRIRCKLSRI-MFQLPADQVP-DWDDRMHTVKWVDVPRN--MPGTFTTKRKVIETDPEPAHSVLEENYQELQLQISANVDFASYHCQARDVRFKETLVYQTRVFEFDVINSGRVQLEFSW-VSEDTSKAVSFAKPDHQGSAQKDQLSQGTMHTGSTLDSTMDHWAEGSPQPFSVEPSSGIVPVGKIQKFKVKFSPLDIGDFESNLFCQIPNLPPGEQGPVLVAKGRSTLPICHFDLKDSDYISGHQRNPELR----GSSGGALDPNTRVIEFTTVGIGGKNLRTFTILNPTNSTYSFCWISEEIESLQNPAAFTCLTEKGFIHPEKKAEIVFQFTPFHLGITESSWTFLIPEHNITVPFLLVGKTTEPLISLNKSHLNFSSLLIGREARETVQIINKEEQGFDFSFQDNSRYSEGFSNSLLVCPMEGWIPPLSRFPIDIFFTPKQEGDVNFNLICNVEKKVHPVTLNVKAEGYTMNVEIKCKDRTGSITLLTPNQT-------NIINFYEVELNECVQCEFNFINTGKFTFSFQAQLCGSK--TLLQYLEFSPIDSTVDVGQSVHATLSFQPLKKCVLTDLELIIKISHGPTFMCNISGCAVSPAIHFSFTSYNFGTCFIYQAGMPPYKQTLVITNKE-----ETPMSIDCLYTNTTHLEVNSRVDVVKPGNTLEIPITFYPRESINYQELIPFEINGLSQQTVEIKGKGTKMKILVLDPANRIVKLGAVLPGQVVKRTVSIMNNSLAQLTFNQSILFTIPELQEPKVLTLAPF-HNITLKPKE--VCKLEVIFAPKKRVPPFSEEVFMECMGLLRPLFLLSGCCQALEISLDQEHIPFGPVVYQTQATRRILMMNTGDVGARFKWDIKKFEPHFSISPEEGYITSGMEVSFEVTYHPTEVGKESLCKNILCYIQGGSPLSLTLSGVCVGPPAVKEVVNFTCQVRSKHTQTILLSNRTNQTWNLHPIFEGEHWEGPEFITLEAHQQNKPYEITYRPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTSELPKAVANIYREVPCKTPYTELLPITNWLNKPQRFRVIVEILKPEKPDLSITMKGLDYIDVLSGSKKDYKLNFFSHKEGTYAAKVIFRNEVTNEFLYYNVSFRVIPSGIIKTIEMVTPVRQVASASIKLENPLPYSVTFSTECRMPDIALPSQFVVPANSEGTFSFEFQPLKAGETFGRLTLHNTDLGYYQYELYLKATPALPEKPVHFQTVLGSSQIILVKFINYTRQRTEYYCRTDCTDFHAEKLINAAPGGQGGTEASVEVLFEPSHLGETKGILILSSLAGGEYIIPLFGMALPPKPQGPFSIRAGYSIIIPFKNVFYHMVTFSIIVDNPAFTI-RAGESVRPKKINNITVSFEGNPSGSKTPITTKLTVSCPPGEGSETGVKWVYYLKG 5118          

HSP 2 Score: 1456.81 bits (3770), Expect = 0.000e+0
Identity = 835/2308 (36.18%), Postives = 1331/2308 (57.67%), Query Frame = 3
Query:  114 IGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILA-----ADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKA-----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNE--FSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPN-IIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPS---ISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSF------------SEYYQETKKEFVEKNIELSEEELM--TYLEDLAVTNQPKKPLN---------KAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSE-IDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKY-------NEAPEASEIEQLENSIANKKDASQTFSKSA-----------------------------------MSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGT--QGGLA--IFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNI--QIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEE 6734
            +G +N F      + SKV+ P +PK++ +      +TPSEF+ +MSL T ++L  T+ M  P  IELLDMG TT+QK + + ++  LFQPFPS + F N  P E YE+PLILRNNDK+PRLVKV  E SPYF V+SP ++ HKVA G+P +F+I FTPE+ +DY   L  VTEREKFIVPI   G+RAILDFPD++ F   P+KY+  K L +RNIG+  A F I T  PFS+EP    L V ESMQ++V+F P+   D S  +I+ Y+TGE V+  ++G+  ++ +R++++ + IE+TY+ LAN R IT+HNRS+++ HF W  F++Q  ED ++      L  EE +E + F  +     L  + LS+++R++ N++++ +     F +++FT++P+EGD+WP++S +ITV F P+EA+ YQ   +C++ GRE RL L+I G G+GPK+ F+F+ LD+G +F  + HCYE IL NKG IDALF +    S +  CF F+P +G+I PS  Q +QI F S   LG F + F V ++G  EP  +  +G VIGPTF F+V  + FG+VS GFP +   SL NTSL+P+ ++LR+P DG     ++      D       +E  S  +P+EF+I P  G +       I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VP + L   E+DF   FL+Y YEK +++ N   LP  YE+  Q  E+   +L+SS   + ++SP+S + IP+ L+    GE  + V+  IFGS   PL   +K  GEGPV+ +    +D+G I VL+D S  L L N+S IPA F A M   +S++ +EP  G++     + L + ANLND + F D + L IENS T  +P+ A G G+TI  D P +  +NLG+HFS       +++IN+G+R QQL W N+ +     + + G      A                 P+  +HP   +L PG++  ++++GY   P++V+E ++CH+IIG Q GK L+  V++   F++P+++ S + L +RL+K  ++  +   + +   N+S L +N  L+   PF I E ++     + + + L  ++ + + I+F+P +++D ++ + ++ L + + EHP +D + L GEV++PNL F+   ++F CILN +E+ ++V + N SPL V++ W  LV D+ N I F     +P   P S+   + AT +  +         + + DLN           + K + + E+ + + + L K +    +    K S   I  +  +  ++E  E L+T    +NE++ +GIEE+FD+ PL+G L+P+S  QI+FT++GH+++ A   A+CEVE GPTY   L GEAS V Y F   +  +G  L+D V  +E+TL+N+GKVGFEF         P N  P G P+++P SGF+ +    ++ V YL G P  F  S  IQ+AH   E I++SG G FP++ +DLPRN      ++N   ++F  +   +TDK +            +E   E +   V  ++++  E L+  +Y+ +   T  P  P++         + + K+ LP Y L+FG +I+G V +  ++I NT HFP++    K  + + GF   L +VKNLP  E   FE+ FDP+ ANL +G  E  L + ++GGP+V + L A VT+P +  S   V+F  ++ G+  + TIQL N   V  EW   + + +D++ K      + P+ LR+K     +     +FE+ P +G L PG+K NVQ+KFMP +EK YS  LV  +A S++++ +   G GLEP+LEF  S +  GP+L    G E  + ++NPC+FPIE YSLEFD+ YL +E+ILR + GYDS+  LL+PPR  G+KLP E  EY+ E  K   E     Q   KY       NE  + +  +Q  ++   +   S+  S ++                                    SI +     + E+E  PVS+AIAR+LG++++ EG+ A+  +GIAI++ G+P+SGK+  +  +A+ Y+AA L++D I++EA+A+ +     +AR+LC+ AA    V + E+ A++ ++ +    QG L+     +    +T +   ++   + + S V    +     + S K H + +++  T  + SSP P  GP    L++   + GE   L++C+LPDE++++IL+ER+ LSDC +G+VFDGL+ LF+Q+ +     +L ++ +R  +Y + + +D+ ++K +E  ++E
Sbjct:   15 MGLVNMFK----GFQSKVLPPLSPKVVTEEEVNRMLTPSEFLKEMSLTTEQRLAKTRLMCRPQIIELLDMGETTHQKFSGIDLDQALFQPFPSEIIFQNYTPCEVYEVPLILRNNDKIPRLVKVVEESSPYFKVISPKDIGHKVAPGVPSIFRILFTPEENKDYAHTLTCVTEREKFIVPIKARGARAILDFPDKLNFSTCPVKYSTQKILLVRNIGNKNAVFHIKTCRPFSIEPAIGTLNVGESMQLEVEFEPQSVGDHSGRLIVCYDTGEKVFVSLYGAAIDMNIRLDKNSLTIEKTYISLANQRTITIHNRSNIIAHFLWKVFATQQEEDREKYRACDDLIKEEKDETDEFFEECITDPLLREHLSVLSRTFANQRRLVQGDSKLFFNNVFTVEPLEGDVWPNSSAEITVYFNPLEAKLYQQTIYCDILGREIRLPLRIKGEGMGPKIHFNFELLDIGKVFTGSAHCYEAILYNKGSIDALFNMTPPTSALGACFVFSPKEGIIEPSGVQAIQISFSST-ILGNFEEEFLVNVNGSPEPVKLTIRGCVIGPTFHFNVPALHFGDVSFGFPHTLICSLNNTSLIPMTYKLRIPGDGLGHKSISYCEQHVDYKRPSWTKEEISSMKPKEFTISPDCGTIRPQGFAAIRVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPALHLVNTEVDFGHCFLKYPYEKTLQLANQDDLPGFYEVQPQVCEEVPTVLFSSPTPSGVISPSSTIHIPLVLETQVTGEHRSTVYISIFGSQDPPLVCHLKSAGEGPVIYVHPNQVDFGNIYVLKDSSRILNLCNQSFIPAFFQAHMAHKKSLWTIEPNEGMVPPETDVQLALTANLNDTLTFKDCVILDIENSSTYRIPVQASGTGSTIVSDKPFAPELNLGAHFSLDTHYYHFKLINKGRRIQQLFWMNDSFRPQAKLSKKGRVKKGHAHVQPQPSGSQEPRDPQSPVFHLHPASMELYPGQAIDVILEGYSATPRIVKEKLVCHAIIGAQKGKSLVMAVNITCEFVAPLIQLSTKQLIYRLEKKPNSILKPDYQPLAIKNISTLPVNLLLSTSGPFFICETDKSLLPATPEPIKLEIDEEKNLLIKFDPSYRNDLNNWVAEEILAIKYVEHPQIDSLDLRGEVHYPNLSFETKELDFGCILNDTELIRYVTITNCSPLVVKFRWFFLVNDEENQIRFVTLPKKPYSAPVSQMESIPATSEAASPPAILVTVESPEMDLN----------DFVKTVLVDEDARPEEKELRKTKASSVISDEIKISSTEIERIYSSQSQVEDQESLQTC--EQNEMLSIGIEEVFDILPLFGVLQPHSSHQISFTFYGHANIIAQAKALCEVEEGPTYEITLKGEASLVNYSFDTKDIHYGLQLFDHVTEREITLTNMGKVGFEFKVLTDHQSSPDNLLP-GVPLILPVSGFISSHQEQVLKVYYLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRN-----LTANEKYEMFLNQARKNTDKEYNKCEMLDHFDIITEEVPEDEPAEVSAHLQMEVERLIVQSYVLEHQKTTTP-DPMDDPCFSHRSRRKLAKIQLPEYILDFGYIILGEVRTHIIKIINTSHFPVSFHADKRVLHETGFSTELDRVKNLPHCETEIFEVRFDPQGANLPVGSKEVILPIKVVGGPTVHICLQAKVTIPTMTLSRGKVDFATIQCGQCLVETIQLSNHLQVPCEWFVQSQKPVDKLEK------HMPKYLRQKLRAELKPKT-RIFEIQPISGVLDPGEKSNVQVKFMPKEEKFYSQTLVFQIAQSAQKLTLLARGQGLEPRLEFSPSVLDLGPLLLCAPGDEAEVIVKNPCNFPIEFYSLEFDQQYLIEEKILRKLKGYDSYNTLLLPPRNPGEKLPPELYEYFKEIKKSKEE-----QMRAKYLENLAQENEEEDITSSDQGTSNSTKRTSLSRGISVTSNLEEWHALLVESKTYLEEEEDEESLEKIIFQTDKLQSIDSHSMEEVGEVENNPVSKAIARHLGIDISAEGRLAKNRKGIAIIIHGTPLSGKSANAVSVAKYYNAACLSIDSIVLEAVANSNNIPGIRARELCIRAAIEQSVKEGEEAAQEAAVGQNVIGQGRLSTDTLGKLASEMTLVAPEIKPGKSVRGSVVITKSKADSHGSGSQKQHHSHQSE--TPQISSSPLP-PGPIHRWLSVSPSVGGET-GLMSCVLPDELLVQILAERIQLSDCYRGVVFDGLDTLFAQNAAAALLCLLKAIGSREHIYILNMAQDYAAMKAQEKAKKE 2282          
BLAST of Hydin_ADK domain-containing protein vs. UniProt
Match: sp|Q80W93|HYDIN_MOUSE (Hydrocephalus-inducing protein OS=Mus musculus OX=10090 GN=Hydin PE=1 SV=2)

HSP 1 Score: 1702.57 bits (4408), Expect = 0.000e+0
Identity = 995/2769 (35.93%), Postives = 1575/2769 (56.88%), Query Frame = 3
Query: 7215 ISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTT-----------VFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKI-IQQKLETE-LPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTK-----PMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISD------DG-------LKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRF------------------NIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAF---------WVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENL-PIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTAR----QGKYETIKKXXXXXXDLN-NPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLL-LTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEP-QQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNV----EAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGG--PVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            IS+E ++S  + +KD  K     L QKFK +D   K +  I+  WDR    + P+    E   E  ++  + +                       +R +   A   ++     + + +            ++  GVP + I+       D E +  +Q LE++ LPK D++L+ LGLG  GPPIPPP  FSI+ YP +R++   +E+L    H+ F+             DI   DE K  E    D+ + T  TK     P  PK S+  +K+K  + R++  +K    +            S  + P+SD      DG       +++   RWI+ P+ E+ LR+ F S ++G +DQ FNFE+L TRR+YQ++CRG+C +P I ++P++VF  RK++ +  E+V KKY++  E F FGPLL  K + +  +  +P NME + I N SPM+ E  F F HD     + L+P +MTL+P E Q LN+WA+P     FED+I+CC+KENPEP I+K+SC G+ P +E++ + +HF+R+LLHRK+ K V LRN T LPV WRI+ LE LG++F+ +   GT+    E+ L  +F+  KP   N KK IR+E+ D E L G++Q E + I AE+YD+ALD++FPKGA  GLD GTL+V +E KQ + LKNRG YEI + F +D       NLS++ ++ P +G ++  +K   VQ+ + A++EV I  + IL+C +IEP + + GE+IA IPI+ S  + YSK+ I+P + INFG++   TRK+    IEN G  DF++                  +++ G+  ++ +   P + K     D++     +++ NI    +Q+R   G FT++P  G +P+    ++T++C +D  G+C+E L IDI+DR+P+ +P G+ Y L  EA +P+  ++N   IFEEH+IC +  + +  L  + SGG++ + EN+F+F NVLVG + +A+F++ N   + CDI++ +KP+         + +  + D F+VEP++  I  R   +V+V+F+P  MQ Y  IF+  ++GLPSN + RS+ L F++ GEG LPRV V +PTL N+    L LFK+ LLG  +   + L N+G +P ++H+D+ D    F         ++   ++N         K+ H   L +  G    FDV F     G+    I ++V+NNQYE+T+I L+GE YED IT +N+  +I S+    +  S V +   +S      E+++ A     + FG C+I    ++SF++ NHS+   +RF WP   +          + FSP +GHLHPG +  V+ T++S SP T  +  ++CKL +I M  L     P +WDD  +T+KW+D P +  ++     K+KVIE + EP  + V E  R L +  +AN+++  Y+C+ TE+ F++T++++TR++   + N GQ+ +++ W  +  +  +      R  +++    QG   ++    +   + + +PFS+ P  GV+   + Q+ +V F+P+++  +++++ C+I NL      P +   GRS+ P+CHF+L +SDY+   RR+P +R     P    + PNTRVIE   +G+  ++++ F ++NPT + + + W  E++E  ++     CL   GI+   KK +  FQF    + +TE FW F IPE  I+VPFL+VG+ T+P ++ DKSH  F +LLIG E+ ETV+IIN + Q +NFAFQD SR++ G +NSL + PM G IP   +  + I FT      +NFNL C + KK +PL++NVKAEGY++++ V   D  G ++ LT           N IN   +E+ E      + +N G+FN+ +  ++     PKL    L  TP   +V +G+    +L     +   L+ +   + I +G +++ NI      P + FSF+ H+FG CF+Y+ GM      LV+TN++     +  +S++CL  +      NF   VI PG +  I ITF PR+   Y++ + FEING+S+  V++ G   E+KL  +D  N  + LG V  G+ V KTV++ N +   +T       +  ELQ+  V  + P    I + P +     ++I F P +R+  F+EEV  E +G+  P+F+++G CQA +I  D E + FG V   +  T+++ ++N GD+GARFKW+    KP FSI+P  GYI  G E+  E+++ P +   +  Y N+ C I+G   L L L+G C     VKE++NFN  VR +  +++ + N +N TW L P+ EGEHW G E   +E  QQ K YE+T+KP TM  + +KHQG++F  +PDG+G LY L G AE PKA++ I REVP + P++ELL + NWL +PQRF+VI E+LKPEK++ S+ LKG +Y+DV  G  K YKL   + KEGL   KV F NE T EF +Y +  +         IQ+++PVRQS+  S+ LEN     + +       +I   +QF V   S+  F+FEF PL+  E   +L + + D     Y+L L   P+ PE+P+ F T +GS Q++LA F N+ + K+++ CK D + FH +K I  AP      E  +EV FEP+ LGE+KG+L +S+ + GE+I PL G+A PPKPQGPF+I+ G ++ I F+NVF+ A  F F +++  F I + +E ++  K + + + F+G+  G   P+  KL+VTCP+ E   + ++WVYYL+G
Sbjct: 2471 ISQEQEDSEGDFLKDSDKN----LAQKFKIYDMCLKDVQNILMYWDRKQGMMVPHTGTDEMSHEADDQRQAPSGGGGRKGRKDRERERLEKERAEKERLEREKAERERLEKLKALEERSDVEGEGEEEHEGKKDLGVPFINIQ-----SPDFEGVSWKQALESDKLPKGDQILDILGLGSSGPPIPPPVLFSIISYPAKRQSLVATEILK---HFVFV--------IPPNDDIPLMDEKKDPEG-DSDIFLNTIITKAQEEQPSPPKGSKQKLKDKPEQVRETQKEKRRTYS---SRKGLPGGTSGSIVPMSDIDQNSFDGEHSQEKFIRLNHFRWIVPPNGEVTLRVHFSSLDVGNYDQTFNFELLGTRRQYQLYCRGVCTYPYICRDPKVVFSQRKKDMKLKEVVVKKYVVSMEKFYFGPLLCGKSRDKYKSSLFPGNMETLTILNDSPMVVEAYFCFQHDIKASTYFLEPVNMTLKPNEKQALNVWAYPTAVGIFEDSIVCCIKENPEPAIFKLSCQGIRPEIEVEPRQLHFDRLLLHRKETKIVILRNVTPLPVAWRISNLEHLGEDFTVSMMQGTMLPKGEYGLQVHFQPSKP--VNIKKAIRIEVLDAENLVGVVQIENILIFAESYDIALDITFPKGAEGGLDFGTLRVMEEVKQTLQLKNRGKYEIIFSFTVDTLGVLPTNLSSMISVQPKRGTLASIDKPTTVQVFFRARKEVKIDCQPILRCQIIEPTLPE-GEIIASIPIKFSVNAVYSKFTISPSSIINFGALICGTRKSITFTIENQGIIDFKYALYRLTGESPILQKKITSHMRHGRTRESESFYKPGATKMAKFSDTV-----QKDTNI---ANQARFTHGMFTVYPGFGSIPSGGQQVITIECFADPVGRCEEFLAIDISDRDPRENPAGIPYTLLAEACLPAFVTDNNILIFEEHQICTSPNLYHI-LQTIQSGGLFVEDENKFIFCNVLVGHQAKARFKISNVGKISCDINIVIKPI-------SNKPANRITDTFDVEPSKMCIGSRSHAFVTVLFTPQTMQTYQCIFEATLDGLPSN-IARSRGLVFDIVGEGTLPRVTVIRPTLYNQHGNPLLLFKRLLLGHSEKLPLILKNNGTIPAQLHVDLRDQLGVFSLKGRPTTSYIYIMEENKPNE---KVKKAHTASLVVSPGDTAEFDVFFHSNKIGRMTGTIHLSVINNQYEETMIHLVGESYEDDITLDNIHGLISSTSQESSDKSEVIEIAEEST----MEDLVTAALMEHIQFGYCHIGISYNVSFTITNHSQVNVIRFEWPLLAT----------LSFSPQIGHLHPGCSKDVVVTLKSESPITLKKMCVKCKLSKI-MFQLPVDQVP-DWDDRMRTVKWVDAPRNTPLTLNT--KRKVIEMDPEPAHSVVEENYRELRIQFSANVDFASYQCETTEVFFKETLVYQTRVFEFDLVNTGQVLLEFCWISEEASKAVSFAMPERQGSSQKELSQGSGSSLDSALDRWTEASPSPFSVEPPSGVVPVGKTQKLKVKFSPMDIGEFESSLYCQIPNLPLGEQGPILITKGRSVLPFCHFDLKESDYISGHRRNPELR----GPGAGPLEPNTRVIEFTSVGIGGKNVQTFTILNPTNSTYSFCWTSEETESLQHPPAFVCLTEKGIIHPEKKAEIIFQFLPAHLDITEEFWTFSIPEHNISVPFLLVGKTTDPLISLDKSHLNFSSLLIGREARETVKIINKEEQGFNFAFQDNSRYSEGFNNSLIVCPMEGWIPPLSRFPVDIFFTPKQEGDVNFNLICNIKKKAHPLTLNVKAEGYTMNAEVKCRDRMGTTILLTSTQ-------VNTINFYEVELNECVQCEFSFINTGKFNFSYQAEL---SGPKLLLQYLDFTPTDSSVDVGQSEPANLSFQPYQKCVLKGLELKIKISHGPTFVCNILGCAVSPAVHFSFTSHNFGTCFIYQAGMPPYKQILVVTNKE-----ETSMSLDCLYTNTPHIEVNFNVDVIKPGKTLEIPITFYPREAISYRELIPFEINGLSQQTVEIKGKGTEMKLLVLDPANRIVKLGAVLPGQVVRKTVSLVNNSLAQLTFNHSVLFSIPELQEAKVITLEPF-HTITMKPKE--VCKLEITFAPKKRVPPFSEEVFMEWMGLLRPLFLLSGCCQALEISLDQEHLPFGPVVYQTQATRRILIMNTGDVGARFKWDVKKLKPHFSISPEEGYIISGTEVALEVTYHPTEIGKESLYKNILCFIQGGNPLCLTLSGTCVGPPVVKEVVNFNCQVRSRHTQTILLSNRSNQTWNLHPIFEGEHWEGPEFITLEAHQQNKPYEITYKPRTMNLENRKHQGTLFFPLPDGTGWLYALHGTAELPKAVANIYREVPCKTPYTELLPISNWLNKPQRFRVIVEILKPEKTDLSVTLKGLDYIDVLSGSKKDYKLNFFSYKEGLYTAKVIFRNEVTNEFLYYTVSFRVTPSGIIKTIQMTSPVRQSVSASIKLENPLPYSVTFSTECKLSDISLPSQFAVPPNSEGTFSFEFQPLKAGELCGRLTLHNSDLGYYQYELALKALPAPPEKPVHFQTVLGSSQSILAKFTNYTRLKTEYYCKTDCSDFHTEKVINAAPGAQGGTEVSVEVFFEPSHLGETKGILCLSSLIGGEYIIPLFGIALPPKPQGPFLIRAGYNIIIPFKNVFLHATSFSFIVENPAFSI-RAAETVRPKKINNITVYFEGNPSGSKTPITSKLIVTCPQCEGTESGIKWVYYLKG 5151          

HSP 2 Score: 1453.73 bits (3762), Expect = 0.000e+0
Identity = 830/2323 (35.73%), Postives = 1322/2323 (56.91%), Query Frame = 3
Query:   81 YKMPIGKFGEVIGTMNTFGEQEIT-YDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDG---TSDPILAADLTSK--VSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGY--SYTKAMRQTGTKNAIKA----------------PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNE--FSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDT-------TTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEF------------VEKNIELSEEELMTYLEDLAVTNQPKKPLN-----------KAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTT----ATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLK---RHMELD---------GAPQKSDKYNEAPE----------ASEIEQLENSIANKKDASQ----------TFSKSAMSITNSES-PALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAI----FKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIP-GENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEE---NDQEELKK 6743
            +K    +  E +G M+    + I+   SKV+ P +PK++ +      +TPSEF+ +MSL T +KL +T+ +  P   ELLDMG TT+QK + V ++  LFQPFPS + F N  P E YE+PL+LRNNDK+PR+VKV  E SPYF ++SP ++ HKVA G+P VF+I FTPE+ +DY   L  +TEREKFIVP+   G+RAILDFPDE+ F   P+KY   K L +RNIG+  + F + T  P+SVEP   +L V ESMQ++V F P+       ++I+ Y+TGE V+  ++G   ++ +R++++ + +E+TY+ LAN R IT+HNR++++ HF W  F+++  ED ++      L  EE +E      D  L     ++LSI++R++ N++K+ +     F+D +FTI+P EGD+WP++S +ITV F P+EA+ YQ   +C+++GRE RL L+I G G+GPK+ F+F+ LD+G +FI + HCYE IL NKG IDALF +    S +  CF F P +G+I PS  Q VQI F S   LG F + F + ++G  EP  +  +G VIGPTF F+V  + FG VS GFP +   SL NTSLVP+ F+LRV  DG   +S P  + +  SK            +P+EF+I P+ G + +     I V L +N++ KY   LV+DV G+G E+ ++ ITA  +VPK++L   E+DF R FL+Y YEK I++ N   LP  Y++L Q  E +  +L SS     ++SP+S + IP+ L+   IG   + V+  +FGS + PLA  I+ IGEGPV+ +    +D+G I VL+D S  LQLSN+S IPA+F   M   +S++ V+P  G +     + L + ANL+D V F D + L I++S T  +P+ A G G+TI  D P +  +NLG+HFS       +++ N+G+R QQL W N+ +     ++ ++ G K +  +                P+  ++P R +L PG++  ++++GY   P+ V+E ++C +I+G Q GK L+  V++   FI+P+++ S + L +RL+K  +++ E   +++   N++ L +N  L+   PF I E ++     + K + L  ++ + + I+F+P +++D ++ + ++ L + + EHP VD + L  EV++PNL F+   I+F CILN +EV +++M+ N SPL V++ W  LV ++ N I      +P     S+   + AT           T E +  +F  S + + +D     EE++      ++ E    ++    G E     S  +P     +  +E              ++E++ +GIEE+FD+ PLYG L+P S  QI+FT++GH D+ A   A+CEVEGGPTY   L GEAS V Y F   + ++G  L+D V  +E+TL N GKVGFEF           N  P G P+++P SGF++++   ++ V YL G P  F  +  IQ+AH   E I++ G G FPR+++DL RN        N   + F  +   + +K +++Y    + E             +  ++++  E L+  ++D A+ +Q     N           + + K+ LP Y L+FG +++G V +  V+I NT HFP++    K  + + GF   L +VKNLP  E   FE+  DP+ ANL +G  E  L + + GGP++ + L A V +P +  S   +EF  ++ G+  + TIQL N   V  EW      +T+++D+ +     +  +  ++ K R          +FE+ P +G L PG++ NVQ+KFMP +EK YS  L+  +  SS+++ +   G GLEP+LEF  S ++ GP+LPF SG E  + +RNPC+FPIE YSLEFD+ YL +E++LR + GYDS+  LL+PPR  G+KLP E  +Y+ E  K    HM+                SD+   + +           S +E+   +I  K    +          TF    M  T+S S   + E+E  PVS+AIAR+LG++++ EG+ A+  +GIAI+V G+P+SGKT  +  +A+ Y+AA L +D I++EAL+  +     +AR+LC+ AA    + + E+ A + S+ + T     +      R    +T +    +     + S +   G+       S K H   +++     + SS P L GP   +L++    G    L++C+LPD+++I+IL+ER+ LS+C +G+VFDGL+ LF+++       +L ++ +R  +Y I + +D+  +K +E    +QEE K+
Sbjct:   45 FKQTNKRLEESMGAMHRKMAKVISGLQSKVLPPMSPKVVTEEEVNRMLTPSEFLKEMSLTTEQKLASTRIICRPQITELLDMGETTHQKFSRVDLDQALFQPFPSEIIFQNYSPCEVYEVPLVLRNNDKIPRMVKVVEESSPYFKIISPKDIGHKVAPGVPSVFRILFTPEENKDYAHMLTCITEREKFIVPVKARGARAILDFPDELNFSTCPVKYNTQKVLLVRNIGNKDSMFHLKTRSPYSVEPTGGILNVGESMQLEVDFEPQTVGSHDGKLIVTYDTGEMVFVCLYGVAIDVNIRLDKNSLIMEKTYISLANQRSITIHNRTNIIAHFQWKVFATEEEEDKEKYKICDGLNKEEKQETSMILEDSVLDPSLRERLSIISRTFENQRKLVQGDSMLFLDHVFTIEPPEGDVWPNSSAEITVYFNPLEAKLYQQTVYCDISGREIRLPLRIRGEGMGPKLHFNFELLDIGKVFIGSAHCYEAILSNKGSIDALFNVIPPTSALGACFVFNPKEGIIEPSGVQAVQISFSST-ILGYFEEEFLIDVNGSPEPVKMTIRGCVIGPTFHFNVPALNFGNVSYGFPHTLMCSLNNTSLVPMTFKLRVRGDGEGMSSIPSYSQESDSKQWSGINTEMPTTKPKEFTISPNSGTIRAQGFTAIKVTLCSNTVQKYELALVVDVEGIGEEVLALLITARCVVPKLQLVTTEVDFGRCFLKYPYEKTIQLVNHDDLPGCYKVLPQLYENSPPVLLSSPSPCGVISPHSTVSIPLALETQVIGAHRSIVYISVFGSQEAPLACNIQSIGEGPVIFIHPTQIDFGNIYVLKDTSRILQLSNQSFIPAVFRVRMANKKSLWTVKPSEGAVPAEDDIPLTLTANLDDIVTFKDTVILEIKHSNTYRIPIQATGIGSTIVSDKPFAPELNLGAHFSLDTHYYRFKLTNKGRRVQQLFWMNDDFRPKEKQSKKEPGKKGSTSSSRRQSKASQEPTDNGNPVFQLYPVRMELYPGQTIDVILEGYSATPKKVKEKLVCQAIVGTQKGKSLLMSVNIICEFIAPIIQLSAKQLLYRLEKKPNSNLESDYQSLVIKNITTLPVNMLLSTTRPFFICETDKSLLPATPKPIKLEVDEEKHLLIKFDPSYRNDLNNWVAEEVLSIKYLEHPQVDNLGLRAEVHYPNLSFEVMDIDFGCILNDTEVIRYIMITNCSPLVVKFRWFFLVDEEENQIRFAPCMKPYSAFLSQMESIAATSVTASSLAAPHTVEYTEMDFSDSIKTILMDDEAGPEEIKKPATSTMVSEA---IKYSSAGTE----RSQSQPDYPECMWIYE--------------QDEMLSIGIEEVFDILPLYGVLRPYSSHQISFTFYGHCDIIARAKALCEVEGGPTYEVLLKGEASLVNYSFDTKDINYGLQLFDHVTEREITLKNTGKVGFEFNVLSNYRSSQRNLLP-GVPLILPLSGFIQSNKEQVLKVYYLPGIPEVFQRNFQIQIAHLVPENITLYGEGIFPRISLDLHRN-----LQGNEKYEHFLEQAKKNVEKEYTKYEAVDQYEVMAEELPEEETAEISAHVQMEVERLI--VQDYALEHQRSISNNTEDIYFSQRSCRKLTKVQLPEYILDFGYIVLGDVRTHIVKITNTSHFPVSFHAEKQVLHETGFSTELDRVKNLPYYETETFEVRCDPQGANLPVGNKEVILPIKVYGGPTIHLCLQATVIIPSMTLSCNKIEFATIQCGQCMVETIQLSNHLQVPCEWFVHTPKSTNKLDKHMPKYLRRKLQAEMIPKSR----------IFEIQPTSGILDPGERANVQVKFMPKEEKLYSQSLLFQIGQSSQKLTLLAQGQGLEPRLEFSPSVLELGPLLPFASGDEAEVIVRNPCNFPIEFYSLEFDQQYLLEEKMLRQLKGYDSYNTLLLPPRNPGEKLPPEVYDYFKEMKKSKEEHMKAKYMENLENEEEEMNTSDQGTTSTKRTSISRGISVTSNLEERHLTIEAKNYLDEDDYEESLEKLTFQTDKMQSTDSHSVEEVGEVESNPVSKAIARHLGIDISAEGRLAKNRKGIAIIVHGTPLSGKTANAISMAKFYNAACLNIDSIVLEALSDTNNILGIRARELCIRAAIEQSMREAEESAHESSMTQNTVVPARLSTENLGRFTSELTLITQEYKVPKTVRGSVMLPKGKADSHFTGSQKQHHQHQSETPQVQISSS-PLLPGPTHRRLSVSASIGGETGLMSCVLPDDLLIQILAERIQLSNCFRGVVFDGLDTLFARNAPSALHCLLKAIGSREHIYVINMSQDYVVMKAQEKAKKEQEENKR 2326          
BLAST of Hydin_ADK domain-containing protein vs. UniProt
Match: sp|Q9Y238|DLEC1_HUMAN (Deleted in lung and esophageal cancer protein 1 OS=Homo sapiens OX=9606 GN=DLEC1 PE=2 SV=2)

HSP 1 Score: 77.0258 bits (188), Expect = 5.344e-12
Identity = 97/424 (22.88%), Postives = 171/424 (40.33%), Query Frame = 3
Query: 1284 DDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVG---------------IGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKI-EGTGSPV-------SRC--FTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYS-IPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILR-QTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEG 2474
            +  F+I P +G + PHT  +  ++F P E R + S     +      +S +   +G               +   VE  F+ L   Y  I     Y  I V K      FK+   + SP+       S C      P  G+I PS     ++ F +    G   Q    +++    P ++  + +  GP    +V  ++FG + +G  ++  I ++N S +P  +R++        P+   +    VSP           F IEPS G L S+  C++++ L A       T L L+   V N  +S +P+ A    P V L   +++    +L    +  I + N + LP ++   +    + E  + + S    ++ P+ E ++ +EL  +T  ELT           K+PL L I    +G
Sbjct:  676 ETAFSIMPRKGVLSPHTDHEFILSFSPHELRDFHSVLQMVLEEVPEPVSSEAESLGHSSYSVDDVIVLEIEVKGSVE-PFQVLLEPYALIIPGENYIGINVKKA-----FKMWNNSKSPIRYLWGKISDCHIIEVEPGTGVIEPSEVGDFELNF-TGGVPGPTSQDLLCEIEDSPSPVVLHIEAVFKGPALIINVSALQFGLLRLGQKATNSIQIRNVSQLPATWRMK------ESPVSLQERPEDVSP-----------FDIEPSSGQLHSLGECRVDITLEALHCQHLETVLELE---VENGAWSYLPVYAEVQKPHVYLQSSQVEVRNLYLGVPTKTTITLINGTLLPTQFHWGKLLGHQAEFCMVTVSPKHGLLGPSEECQLKLELTAHTQEELTHLALPCHVSGMKKPLVLGISGKPQG 1072          
BLAST of Hydin_ADK domain-containing protein vs. UniProt
Match: sp|A8JFU2|CFA65_CHLRE (Cilia- and flagella-associated protein 65 (Fragment) OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP65 PE=1 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 2.526e-8
Identity = 107/540 (19.81%), Postives = 177/540 (32.78%), Query Frame = 3
Query:  387 PSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIG-----PTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREF 1991
            P  + + + +P   Y   L+L+N       ++     S  F +  P     K+  G+    K+ F P ++Q Y  N+ +       +VP+H       ++ P  + F  TP K T T  L +RN G    +       PFS+ P  + L   E +     FTP     ++       E+G     +I G G+   + +E++ V      VG    R +   N S V  HF                    +   E   +   F      G L  ++ S++  SY                                         P    T+ S  F   T    R++L + G  + P V  S +  + G +   A     + + N   +   +  +    P+   F  +   G+++P S   V I F+    L A        +    EP  +D            P  S    +     V  G P+ EE  L +          + P+  T DP  A  + S       CSR    E+
Sbjct:   44 PEQLEWRHWNPGTEYVKQLVLKNVSTSVLKIRFKQPTSKAFGMDFP--EPFKLRPGMSQPLKVVFRPLKQQHYSDNVELFVGNVSCLVPVHAYTPVTHIEVPPALDFGFTPTKETVTAQLPVRNTGDVRVDVLWKLDAPFSISPLFASLAPGEVVAFTASFTPPEACSYTASAACQLESGAAAICKISGIGKFPYLSVEQAGVDFGAVVVGQRVERLVRFGNHSVVPAHF-------------------AVTHDEAGPDDGVFTVGPARGTLGPEEYSMLKLSYT----------------------------------------PRATGTFSSETFHIGTAGGNRVALNLRGTAVAPLVTLSTRAFNFGNVAAGATASRVLYIRNHSAVPVPYDFQ--VDPLD-VFAISRTRGVLAPDSTAHVTITFRPMAGLAANLWRRVTLLLKDAEPQGVDLVATAYTDKSRPPPLSQRHVERYMARVLSGGPAVEESQLDS----------KPPSAATGDPAAALTVDSDALDFGSCSRLSASEY 509          
BLAST of Hydin_ADK domain-containing protein vs. UniProt
Match: sp|F1P4W9|CFA65_CHICK (Cilia- and flagella-associated protein 65 OS=Gallus gallus OX=9031 GN=CFAP65 PE=2 SV=2)

HSP 1 Score: 59.6918 bits (143), Expect = 1.055e-6
Identity = 59/253 (23.32%), Postives = 109/253 (43.08%), Query Frame = 3
Query: 1980 PREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVG------NELYSIPITATAIVPKVELSC--------------DELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKT-EDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKV 2675
            P  FS+ P  GVL+    C + V+    +        V +VI          +  ++ + A A  P ++++               D L F    +  S EK +++ N S++     I R  +   +D ++S  +  A+V    +L + I  +   +GE +T           +   L +    +GP+V+L   S+D+  I + E  +  L++SN S++PA +   +    SVF ++   G++E   TL LKV
Sbjct:  177 PSPFSMTPEHGVLSVGAECTVKVLFQPKAAA------VCNVIATCWFGVEEKQKRTMQLRAQAKYPYLQVNVPGEQHKGAQPGKLQDVLCFGSVPVGTSVEKCVEILNMSAVDAPCMIERAKDPLLQDHVFSCDVSHAVVPAKGKLALCIRFQPQAVGEHSTDYFTVTPTGCLQQTVLKMVGSCKGPLVSLHQSSVDFDWINLGESSTQMLKISNVSDVPAYYQFDIDGRGSVFSLDRPCGVLEGTTTLVLKV 423          
BLAST of Hydin_ADK domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23510681 (tr|A0A210QFE7|A0A210QFE7_MIZYE Hydrocephalus-inducing protein-like OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01316 PE=4 SV=1)

HSP 1 Score: 2205.64 bits (5714), Expect = 0.000e+0
Identity = 1187/2831 (41.93%), Postives = 1742/2831 (61.53%), Query Frame = 3
Query: 7083 VATMDKHVPERPDSHMTEMSNEA--DDLXXXXXXXXXXXXXXXIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVE------QH----GENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGP--EESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXX--XXLTPISD-DGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNI-----KSGKPFQNLAGPLPNSNKET-------------------------------------GQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVI--NKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVS-TGDQNAT---EPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPAD---NSISSGAVH--------KKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNN----PFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQC---SIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKN-KSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGP--VMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            V+     + +RP+SH TE S+    D  K KK     KK     ++  KE  ES  EI+ DP KE E LL Q+F+T +   K+I++++  WDR    IK    P E      QH    G+    ++  +  ++        +  K++   + +           P    E +   P  E+  G+P++ I+ S K+ +  +K++  +   +LP ++EVL+G+GLG +GPPIPP ATF++V YP++RRAP +SE     G Y F+ +  D  +   L       E++      +  ++ TPT K    K  +   KE    +RK S ++   S  + R +     +      TP+SD D L +   RW++  + E+ LRLRF S+ELGQFDQ  NFEI+ TRR+YQ++CRGICAFP+IS+EPRIVFP RK+NK+ +EIVHKKYIL  + FEFGPLLI K ++R   GRYPENME++LI N+SP+ A+I+F F HD+  E F LDPP+MTL+P ++Q L +WA+PR  + +EDAI+CC++ENPEPV+++++C+GV   +ELD K +HFE+VLLHRKD KT+YLRNST LPV W+++ LE+LGD+F+ A D G ++  SE+ L+ YFRAMKP ++  +K IRLEI DV+E+ G+  TE + + AEAYD+ALDMSFPKGA+ GLD GT++VG+E KQ  TLKNRG YEI+Y+F+L+  +    + S LFT+ P +G +SP ++  QV + + + +EV IKD+ ILKC VIEPN+AD GE+IA IP++++ ++ ++KY + P  DINFGS+ V ++KTRQ +I+N GEFD ++ I     ++ +     A P    NK +                                      + +++ + +   N     G +QSR     F + PA G++ + NS ++ V+CI++ PG C+E L IDI+DR+P   P G+ Y+L  EA +PSI+ +++ SIFEEHR+C  +++   N +L     GG+YG+ E +F+F NV+VG K +A+F++ N N VPCD+ LSLKP+         +G     D+FE+EP +A I      Y +V F+P +MQ + A F+ +IEG+PSN   + + L+F++ GEG LPR+ + KPT+RNK+ Q L LFK+ LLGR     + L NDG LP +V ID++DPD AF +  +G   A    + G VT K+PH   + ++V    SFDV+F+P    +  A+I++TV++NQYED++IQL+GEGYE+ IT +N+  IE  + P     ++             E+ + A K N++ FGDC I EP+++SF++ NHS+    RF WP          N + +KFSP+VGHLHP     +  T +S  PKT  E+ + CK   +N    E   K  +WDD  +T+KW+DVP     +S++ G           KKKVIETE EP FTEVP++AR +DLL+TA  ++ KYKCK+  ++F+DT++F+TR+Y  ++ N+G ++M Y W + ++N          P   R   + +  +  E   DL +    PF+I P  G I+A +K  F+V F+PL+V+ Y+A + C I NL+     P + + G+SL PYCHFEL DSDY+ S RR+P MRGPGG+P G+ ++PNTRVIE + IG+  R++K+F +VNPT   + + W CED   PK      CL   G++++GKK Q  F++ S  V + ESFW+F IPE  I VPFL+VG+  EP+++ D+SH  F ALLIGH++VE V +IN ++QP+ F+F++ S H+ G+S+ L +EPM G IP+  ++++ + FT T ++ +NFN+ C++ KK  P+++NVKAEGYS++ T+  ED+ G+  E          + +N I  G +EV EQQ R I ++N G+FN+DF W++   +  K   M+ ++P+SG V  GE+ +C L       T+L+    +L +  G SY + +      P L FSF   +FG CF+YR GM      L +TN+D K+     ISV+CL    +   HNFEA VI PG S  + ITF PR+  KY +++ FEING+S+  + + G+  E+K+E  D  +  LNLG   V + V K + I N +  P+T  L  +P    LQ+ GV  I+P+   I + P K   I ++++F P  RI +F+EEV  E  G+  P+F++ G C   +I  D  +I FG V K S  T+KL M N GD+  +FKW++  F+PDFSITPA GYI+ GM++ FE++F P +   DIRYD+L+C        K ++L LTG+C ++   KE  + +  VRQ + K L I N TN TW+LKP+I+GE+WSG  TF VE  QTK + LT++PLTMT +GKKHQG++F  +PDG G+L+N+ G +EPPK  SK   +VP ++  +ELL V NWLKRPQRF V+KE +K EK ++   +KG EY+DVP  G K YKLT  A KEG+  +KVTF+NE T E+QFYE+  +A K  +   I LSTPVRQS+ H++ ++N     +++  + T PEI    QF V + S    + E+ PL+V +   K+E    D  S  YDL L  T + PE+ L F T +G  Q+ +A F N+AK  K+D++CK DN+ FH +KS+  AP      E  LEV FEP++LGE +  L +S+   GE++FPL G    PKPQGP+IIK   +  ISFRNVF     F FQ+D+  FH+ K SE+++S K+HR+V+ FDG+  G    VMGKLVV+C  +  G +N QWVYYLRG
Sbjct: 2454 VSKAGSSITDRPESHQTEKSDTVLDDGKKGKKGGKDAKKPGDGKEKSDKEKGESETEIVHDPLKESEILLMQRFRTVEHSSKEIADLIEFWDRTTLGIKRPPTPSEKSEEDGQHHPPSGKKAKGKDKHDKQEKEKEKERQKQIEKENAERAAKEAAAAATQQGEPADG-EGVEDTPKDEDGSGIPHLHIDCSDKASTPFDKLMNLQ---KLPTMNEVLDGIGLGPRGPPIPPSATFAVVPYPVKRRAPPVSEF---GGRYIFVASSPDDPNIGMLDSKDPEPEEEKSVTPDKGNDLATPT-KGKSGKTDKSAGKEDKKGERKKSAERKQTSKTVSRRNSMQVPSPPPGAATPVSDMDRLSI--FRWVVPANGEVILRLRFHSEELGQFDQTLNFEIVGTRRRYQLYCRGICAFPSISREPRIVFPSRKKNKKSDEIVHKKYILSSDTFEFGPLLIMKSRERYKEGRYPENMEKLLINNTSPIEADISFCFQHDSKGETFLLDPPNMTLKPGDTQTLTIWAYPRSPEVYEDAIVCCIRENPEPVVFRVNCVGVKAELELDKKALHFEKVLLHRKDTKTIYLRNSTMLPVRWKLSLLENLGDDFTVAADSGVVEPRSEYPLHFYFRAMKPVQS-ARKMIRLEIYDVDEIFGMFSTENITVTAEAYDIALDMSFPKGADGGLDFGTIRVGEEQKQQCTLKNRGKYEIQYQFDLEDCDPDNPSASKLFTVIPQKGSLSPLDRPTQVTVLFKSMKEVHIKDQAILKCLVIEPNVADGGEIIASIPVKVTVKAGFNKYNVLPTNDINFGSMIVNSKKTRQFVIQNKGEFDMKYTIVKMIKETQQSQTRHARPPIKDNKRSKSRDGSSSGRSVARPKKADSVSEYSTTHSQIQLASGVSRMNNVVVNRRLHNSTRQEGVTQSRLPLQMFVVSPAIGIISSNNSQVINVECIAETPGSCEEELAIDISDRDPTDHPGGIPYKLIAEACIPSINVDDIGSIFEEHRVCKNLSIWQHNNQLQLENEGGVYGEDEKKFVFNNVIVGHKAKARFKIANINKVPCDVVLSLKPI-------LVKGMTKHLDVFEIEPAKALIPNHSHVYATVTFTPPSMQTFSATFEASIEGVPSNQA-KGRTLTFDISGEGNLPRIGIQKPTVRNKRGQPLVLFKRILLGRSDVMPLILVNDGTLPSKVDIDLIDPDKAFRLRPSGTTQAIMEDDFGEVT-KRPHTASVIVNVSEAASFDVIFKPTAVQRSQAHIRLTVIDNQYEDSVIQLVGEGYEEEITLDNINSIEVPVEPENEEGNMA------------EDDVGAAKPNLIKFGDCAIGEPRTLSFAMTNHSKTDIYRFQWPE---------NAL-LKFSPTVGHLHPESTKDMTITFKSDQPKTLTEEKVNCK---VNKIMFEKQDKVADWDDRIRTVKWVDVPTSPQPSSVNEGGNKAPLSSRPAKKKVIETEAEPVFTEVPDSARQVDLLVTALCDFSKYKCKIEAVSFRDTLMFQTRVYDFTLSNKGAVQMDYSWQVVMEN---------MPTFQRAVTFMSEAERPESRMDLADSSYVPFTIEPEYGTIQAGKKSSFKVRFSPLDVNDYEARLICSIPNLEKTQQGPVVGIKGKSLMPYCHFELEDSDYISSSRRNPEMRGPGGAPAGSTLDPNTRVIEFSCIGVGVRNLKNFAIVNPTNQPYNFEWSCEDDSDPKKPASFNCLVPKGLIKSGKKFQVSFEYVSHQVDIVESFWKFRIPEQDITVPFLLVGKAREPDISMDRSHMNFKALLIGHQAVERVYLINQEDQPFYFSFEEDSCHSAGYSDHLHVEPMSGNIPAKSRMAVDLYFTPTTDKEVNFNIVCKIKKKVLPVTLNVKAEGYSMNCTLTCEDSQGNKQEFF-------QDSHNIIKFGEVEVNEQQIRNIFVMNSGKFNFDFQWELNTGN--KKREMVSISPVSGGVAHGEEQKCTLLFCPPCKTSLKDCSLILKVSNGPSYHVALEGLGVTPGLHFSFQSCNFGSCFIYRAGMPAHYKVLKLTNKDKKE-----ISVDCLYAQTNHLHHNFEACVIQPGQSVDVTITFYPRQAIKYNETMTFEINGLSKHSIQVIGNGTEMKIEVADPRHKILNLGPRVVSDLVKKYIPIVNNSPAPITFNLALTPVSAALQKPGVISISPVNT-ITLEP-KGGTIKVEVIFAPKCRIPQFSEEVMLECAGLYQPLFVLQGSCLGMEINLDTYAIPFGAVVKDSQSTRKLVMSNTGDMNTKFKWDSKKFRPDFSITPAEGYITSGMDVTFEVTFHPKELNQDIRYDSLRCFFPESSPHKPVTLTLTGMCVSLPAPKETQHLSTHVRQAETKFLSIPNKTNMTWILKPIIDGEYWSGPVTFTVEAGQTKQFPLTYRPLTMTPEGKKHQGTIFFPMPDGQGLLFNMMGVSEPPKPNSKPHFDVPCKVAHTELLSVDNWLKRPQRFAVLKETIKAEKLDTGTSVKGMEYIDVPASGKKDYKLTFYAHKEGVTMLKVTFINEKTQEYQFYEVTFRATKQGTVGTIDLSTPVRQSVLHTITIDNPLGYAVSFNGTCTLPEILMPPQFNVPANSTGEVSIEYQPLKVGDFQGKIEYVCSDLGSYTYDLNLKATAAGPEKALYFRTCLGQAQSHIAKFLNFAKQAKADYTCKTDNSDFHVEKSVAAAPGSTGGTEVNLEVTFEPSRLGEQRASLLVSSTQGGEYMFPLFGTCVAPKPQGPYIIKAAGTTHISFRNVFASTTPFMFQVDNPLFHLTKQSESVRSRKEHRIVVGFDGNDSGSKAVVMGKLVVSCARSAGGSSNAQWVYYLRG 5214          

HSP 2 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 560/1214 (46.13%), Postives = 793/1214 (65.32%), Query Frame = 3
Query:   87 MPIGKFGEVIGTMNTF---GEQEITYDSKVVAPKNPKLLR-QRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAA-DLTS----KVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQ-TEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYS-YTKAMRQTGTKNAI-------------KAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIF 3656
            MP+G FGEV+GT  T    G +   Y SKV+AP+NPKLL+       KMTPS+F+F M +DT +KL NT  M++P KIELLDM +T+ Q+ + +++++P+FQP+PS +FF N  P E YE+PLILRNNDKVPRLVKVT  DSPYF V+SP +V +KV  GLP  FKIQFTP++++DY   L+ +TEREKFIVP+  IGSRAILDFPD I FP  P+K+T ++TL IRNIG+  A F++S   PF+V P    L V +SMQ+ V+F P+   D   ++ +HY TGEDV   +HG  Q+  +R++++ + IE T++ +AN R +T+HNR+DV+ HF W+ F++Q  ED  +      L  EE  + E+F  +        DKLSI+ R++ N++ + +     F DD+  I+P+EGDIWP++S ++ V FKP EA++Y   AFC+VTGRE+RL L+I G G+GP V+FSF++LDMG IFI + H YEI+L NKGDIDA++ +    S    CF+F P +G++ P  HQ + I F S  +LG F + F+ ++DG  E   + F G VIGPTF F+VQK+KFG +S GF ++E   LQNTSLVP+ F LRVP DG+SD I    DL S    + SP        P+EF I P+ G L   +  KI V   +N+I KY   +V+DV+ VG E+ ++PI A  IVP V +    LD+ R FL++SYE  +K+ N + LP KYE++ Q   +   + Y S     IV P+S  E+PI ++   + E     +F IFGS   PL++ I C GEGPVV++  + +DW  I VL D    + LSNES IPA F A M++ +SVFRVEP  G +    TL L + ANLNDCV+F D++Q++   S+ + +PL A G GTTI  DPP++  +NLG +FS   L +T+ + N+ +RHQQLVWS +G+    KA ++  + NA+             + PI  ++P+RFDL PG S  + I+G VD PQ V+E +MCH+IIGRQGGKELI +VD+  +FISP+LEFS ++++FR+DK  +    + T+ +  TNVS L L+  L + +PF I+  +    SE  + L+ N+  T+ IQF+P +K D H R I D L V++ EHPH+D I L GEV FPN+ F++S ++F CILN +EV+++V + N SP+EV+Y WS LVG +PN++ 
Sbjct:    1 MPLGPFGEVVGTTGTLEALGPEAANYRSKVIAPRNPKLLKPGDEEGHKMTPSKFLFDMQMDTEQKLANTHYMKVPRKIELLDMADTSLQRFSQINIDEPMFQPYPSEIFFQNFKPFEVYEVPLILRNNDKVPRLVKVTQADSPYFSVISPHDVGNKVGPGLPTTFKIQFTPDEKKDYNHELVCITEREKFIVPVKAIGSRAILDFPDNIIFPVGPVKHTSSRTLLIRNIGNKEAKFTLSVENPFTVSPEIGTLPVQDSMQVTVEFNPKKTGDHMKDLSLHYHTGEDVLIALHGQAQDANMRLDKNSLRIENTFISMANERTVTIHNRTDVIAHFRWTQFATQEEEDQQKHRLTSTLTSEEQSDTEKFLQECVQDPTLRDKLSILGRTFQNRRMLVENDNMLFNDDVVKIEPVEGDIWPNSSFEVNVIFKPREAQSYTRTAFCDVTGRESRLPLRIRGDGVGPSVQFSFESLDMGNIFIGSKHTYEIVLANKGDIDAIYSVMPNSSIFGPCFSFNPSEGIVMPGGHQAIHISFTSP-YLGDFQETFQFQVDGQPEILEVQFSGSVIGPTFQFNVQKLKFGVISYGFLNTETCVLQNTSLVPMSFHLRVPGDGSSDSICCTNDLDSAHSDRGSPTARPGAGPPKEFEIIPASGTLQPQSEIKITVNFISNTIKKYEMAMVVDVVNVGEEILTLPIYAKCIVPNVSVLSPMLDYGRCFLRHSYEHSVKLHNDTDLPAKYELVTQNVHRDTPITYKSPQPKGIVEPHSLCEVPIIIQAEALEEQQVISYFSIFGSPDPPLSVQISCTGEGPVVHISPMDIDWNVIPVLTDTPRKVILSNESLIPAKFTAHMVRQKSVFRVEPAEGEIPAEKTLELTITANLNDCVRFQDKLQVNFLESQVRHIPLTAYGQGTTIVSDPPLTPHLNLGPNFSNRPLQKTFTLTNKSRRHQQLVWSMDGFGPIAKAKKEIASYNALDMKFKNTPPPPEPRRPIFKLNPNRFDLPPGASMDMHIEGMVDSPQNVKERLMCHAIIGRQGGKELIMRVDVSADFISPLLEFSTKAVYFRVDKKPEEELTVQTRELKMTNVSTLPLSTGLKLQHPFQIVMDDGSLTSEMDVRLNVNEEYTLMIQFDPAYKDDLHIRTIDDILHVTYQEHPHIDYIALRGEVYFPNIDFEKSVVDFGCILNDTEVTRYVNITNNSPMEVKYHWSFLVGKEPNVVI 1213          

HSP 3 Score: 429.869 bits (1104), Expect = 4.360e-116
Identity = 262/708 (37.01%), Postives = 383/708 (54.10%), Query Frame = 3
Query: 4767 LPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPC---QENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHM----------------------------ELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESP-ALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAAR-RSEVFDMEDGAEKKSLFEGTQGGLAI--FKRSVVGITAMHNMMQAS---HNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAM--------------MKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEE 6734
            LP Y L+FG V++G V +  V+  NTG FP + ++ +  +  FGF + L +V+NLP     E ++F ++FDPR ANL+ G VE+ + +NII GP + + L A VTMPD+  S + ++F   K GE K+IT+QLHN   V  EW +  ++ D    SR+ K  E RIL                                                  + +A SS+RI++ C G G EP L+F  + ++FGP+LP + G E+ I IRNPC FPIE Y+LEFD  YLE+E+ILR + GYD    +L+PPR   +KLPQE +EYYDE +K+                              + DG  ++S+   +    +       SI    D      K   S   S S   + ELE TPVS AIAR+LG++LTPEG AAR  RGIA++V G+PMSGKT TS  LA  Y AA+LT+DQ++++A+++G T +  +AR++C +AAR R+E   + +G E   L +   GGL++        G T+   + QA     NRKTSTVS+V          +K HG       T +  SS     G  +              + ++  + GE   L++C+LP++++++I+SERL L+DC +G+V DGLE LF+Q+    A +IL +LNNRRF+YF+TLK D+  +KE+E   +E
Sbjct: 1683 LPEYLLDFGYVVLGTVRTHIVRATNTGWFPTSFQVEREDIHHFGFHVELDRVRNLPGAPDHETVDFVVSFDPRGANLSEGSVETIVPINIINGPVIQIRLRAKVTMPDMEISDDTLDFNETKCGECKVITVQLHNQQQVKCEWNSLPADKD----SRK-KYYEQRIL--------------------------------------------------IRIAQSSQRILLLCRGQGREPHLDFDRNMVEFGPILPHSMGDEQDIVIRNPCSFPIEFYNLEFDSTYLEEEKILRLMKGYDEMNTVLLPPRGPTEKLPQELLEYYDEQMKKLEELERVRREAEEVAAEAARLEEDKDGESGDGDGRGEESEIKTDGAFGTAAGSHPPSIIEPVDIEDRLKKEEGSEAQSTSALGVGELEITPVSAAIARHLGIDLTPEGTAARNRRGIAVVVHGAPMSGKTVTSVALARMYEAAILTIDQVVLDAISTG-TKSGMRAREMCQEAARKRAEELKLMEGEE---LEKKPGGGLSVEAVTAHTQGTTSTAAVSQAHSVVSNRKTSTVSDV-------KGKDKHHGGSVAGAKTGINTSSIDGATGSQVPSSPPPLAAPIARRLSVSASVAGEE-GLMSCVLPEDLLVDIISERLQLNDCHRGVVLDGLETLFAQNLHTAANVILKALNNRRFIYFLTLKLDYCVLKEQEKKAQE 2323          

HSP 4 Score: 192.586 bits (488), Expect = 2.345e-44
Identity = 94/199 (47.24%), Postives = 125/199 (62.81%), Query Frame = 3
Query: 3948 LEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNN 4544
            L+ N  L  LL+ + +  P+GIEE+FD+ PLYG L+P   EQ+T T++GH+D+     AIC VEGGPTY   L GEAS V YK      D+G+ +YDQVA  E+TL N GKVGFEF +      L     P G PI++P +GFVE  S   + + YL G P  F+ + +IQVAHF  + I I G G FPR+++DLPR +
Sbjct: 1368 LQTNRALSALLEVDRDETPVGIEEVFDILPLYGILQPGDTEQVTMTFYGHADIWGETKAICVVEGGPTYELLLKGEASLVDYKIDCKEIDYGKQMYDQVASAEITLCNSGKVGFEFCAMGMDPTLAKKPAP-GVPIMVPHAGFVEPLSEQKLVIKYLPGVPEVFSKTFNIQVAHFEPDKICIQGEGVFPRISLDLPRTS 1565          
BLAST of Hydin_ADK domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20302759 (tr|A0A1S3J5T2|A0A1S3J5T2_LINUN hydrocephalus-inducing protein OS=Lingula unguis OX=7574 GN=LOC106170364 PE=4 SV=1)

HSP 1 Score: 2162.11 bits (5601), Expect = 0.000e+0
Identity = 1150/2659 (43.25%), Postives = 1681/2659 (63.22%), Query Frame = 3
Query: 7587 GVPNVIIEVSKKSKSDREKIIQQKLETE-LPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPF----EKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISD--------DG-----LKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSEN-RKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQ-KDS------------IAIQKSKQNENI-----LVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVS-TGDQNATEPGPVTS--KQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPIN----WDDTKKTMKWIDVPADNSISSGAVH------------------------------KKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDN------SDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEA----QLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADG--GPVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            G+P+++++ +     D ++   Q LE + LP V E+L+GLGLG  GPP+PPPA F++V YP++RRAP  +E    + HY F+    D  +    +   E + ++      +K KED    T +TK  + +K     + + ++ + S+GKK          S + +     +TPI D        DG      K+ T RW+I  + E+ +RLRF S+ELGQFDQ  NFEI+ TRR+YQ++CRGICAFPNIS+EPRIVF HRK+NK+ +EIV KKYIL  EVFEFGPLL+ K + +I  G++PE+ME++ I N+SP+ A+I+F + +D+  E F LDPP+M L+P ESQ+L++WA+P+ A  +ED I+CC++ENPEPV +K+SC GV P +ELD K + FE+VLLHRKD KT+YLRNST LPV W+I GLESLGD+FS +Q+ G I   SEF L+A+FRA K     +KK IRL I D E   G++ TET+Q+ AEAYDVALDMSFPKGA+ G+D G L+V +E+KQ I+LKN+G YEI+Y F  + +++    ++ NLF++ P++  +SP ++   V + + +++E  I+D+ IL+C VIEPN  D GEVIA IP++I+ ++ +SKY I P  D+NFG++ V ++K+R   IEN GEFDF++ +   K  +     + + ++  G+ KD+             ++ K K+ E++     + GG QSR   G FT+FPA G++      ++ VDCI++ PG+CDE++ I+I+D++P  +P G+ YRL  EA +PSI+  ++ SIFEEHRIC  ++V     HQL SGG+YG+ EN+F+F NV+VG K  A+F++ N N VPCD++ S++P+         R S+   DIFEVEP R QI      Y +V F+P +MQ + A+F+ +IEG+P     + + L FEV GEG LPR+ + KPT+RNKK Q L LF+K L+GR++   + L NDG LP +V ID+VDPD  F +  TG+  A          K+PH   + ++V    SFDV+F+P L+ +  A++++ VV+NQYED++IQL+GEGYED IT +N   I S ++P+ P     +G          EE +EA K+N + FGDCYINEP++++F++ NHS+   VRF WP  D  T          FSP VGHLH G +  +  T ++  PK+ NE P+ C++ ++         KP+N    WDD  +T+KW+DV                                          KKKVIETE EP FTEVP+++R++D+L++AN ++CK KCK+  I F+DT++F+TR+Y   + N+G +++ Y W + ++N      S  F     RP    + +  ++     +      P+SI P  G I A +K  F+V F+PL+V  ++A + C + NL+     P I++ GRSL PYCHFEL DSDY+ + RR+P + GP G+P G  ++PNTRVIE + IG+  ++ + F +VNPT   F + W+ ED++ PK   +  CL   G V +GKK +  F F    + V ESFWRF IPE  I++PFL+ G   EP+++ D+SH  + ALLIGHE++ETV ++N ++  + F F + S H+ G+++ L++EPM G I    ++ + + FT T ++ +NFN+ C V +KT+P+++NVKAEGY++  T+  ED++G+ VELT    NG     N IN G +EV EQ  R + ++N G+FN+D+ W+I  +   K + M+ +TP  G V+ GEK +C L       T+L+    +L I  G SY +N+      P L FSF  H+FG CF+YR GM +LT  L +TN+D+KD     IS++CL +++    H+FEA V+ PG +  I  TF P++ K+Y + + FEING+S+  +++ G   ++K+E  +     +N G ++V + V K + I N +  P++  L  +P    LQ   +   +P    I + P K     +++ F+P  RI++FTEEV  E  G+  P+F+ITG CQ  +I  D ++I FG V + S  T+KL M N GDIGARF W+ + FKPDFSI+P SGYIS GME+ FEI+F P++ + DIRY+ L+C IEG K L L LTG+C  V PVKE  + N  VRQ++ K++ I N TN  WVLKPVIEGE++SG E F VEPQQTK +EL ++PLT+T +GKKH GS+F  +PDG+G++YNL G ++PPK  ++ITR+VP +  ++E+L V NWLKRPQRF+V  + LKP+K +S   LKG +Y+DVPG   K YKLT  A KEG   IKVTF NE TGE+Q+YE+  +A KP   A I+L+TPVRQ++QH++ L+N  +  I +  S   PE+   +Q  V  ++   F  E+ PL+V E  A+L   S D     Y L L   P+ PE+ L F + +G  Q   A F N+AK+K+D++CKIDN  FHC+KS+  AP         L+V +EP+++GES+G LTI++   G++ FPL G A PPKPQGPFIIK GS+ SI+FRNVF+    F FQ+D+  FH+ K+ ENI+S KDHR+V+ FDG+  G    VMGKL+VTC  +  G +N+QWVYYL+G
Sbjct: 3290 GIPHILLDCT-----DIDQPGPQILENKKLPTVQEILDGLGLGPNGPPVPPPAEFAVVPYPVKRRAPGDTE---PSSHYVFVAASADDPNIASEEKPKEPEPEEEKSVTPDKSKEDHTTPTKSTKGSKAEKLRAGAESQKAQRKTSAGKKGGRKG---STSGAASPPPGSVTPIMDADQASTIGDGGDAKNPKLGTFRWVIPANGEVTIRLRFLSEELGQFDQTLNFEIVGTRRRYQLYCRGICAFPNISREPRIVFQHRKKNKKSDEIVSKKYILMNEVFEFGPLLVGKPRDKIKEGKFPEHMEKMTIMNTSPLDADISFCYYNDSKAETFLLDPPTMLLKPGESQELSIWAYPKTAGFYEDTIVCCIRENPEPVTFKVSCHGVRPELELDKKQLLFEKVLLHRKDTKTIYLRNSTLLPVAWKIDGLESLGDDFSVSQESGIIQPKSEFALHAHFRATKA-TVTSKKVIRLHIMDAEGFMGMVYTETIQVHAEAYDVALDMSFPKGADGGIDFGALRVMEESKQQISLKNKGKYEIQYSFTFEPTDDPATKDVHNLFSISPAKATLSPVDRPTPVSVVFRSRQECWIRDQPILRCQVIEPNYGDGGEVIASIPVKITVKAVFSKYNIYPVTDMNFGALLVNSKKSRTFTIENKGEFDFKYTV--AKMVREKDKEVAHRSRGAGKDKDAKRTKSRDGSSSGRSVVKPKKTESVRQDLGVGGGGQSRLILGMFTIFPAYGIILPNGQQVINVDCIAEQPGRCDEDIAIEISDKDPSDNPTGIPYRLMAEACIPSINLADVGSIFEEHRICKNLSVWQHS-HQLESGGVYGEDENKFVFQNVIVGRKARARFKITNTNKVPCDVAFSVRPV-------ASRHSSKHQDIFEVEPVRGQISSHSHMYATVTFTPPSMQAFNAMFEASIEGIPQQQA-KGRNLVFEVAGEGNLPRITIMKPTVRNKKGQPLILFRKILIGRNERMPLLLVNDGTLPSKVDIDLVDPDGCFSMKPTGNTRAIMADGEDDGLKRPHTASVVVNVEESASFDVIFKPTLAQRSTAHVRLAVVDNQYEDSVIQLVGEGYEDDITLDN---IHSVVMPVDPEKE--EGNMA-------EEDVEAAKSNHVHFGDCYINEPRTLTFTMTNHSKTDCVRFQWPDHDQLT----------FSPKVGHLHAGVSKDMTVTFKTGEPKSLNESPVPCRVTKVTFD------KPVNQVSDWDDRLRTVKWVDVTPPPPAQPVEPAPPAPPEKGQPKPQTPVPTLPPVPAFTPRPAKKKVIETEPEPAFTEVPDSSRTVDMLVSANSDFCKVKCKLDSIKFKDTLMFQTRVYEFQMNNKGSVQLDYNWQVVMENFSPMARSVTFATDPDRP----ESRASSVTSYISDIGTGYIPYSIEPECGTIAAGKKATFKVKFSPLDVHEFEARLICSVPNLEEGKQGPVIAVKGRSLMPYCHFELEDSDYISNARRNPELPGPNGAPSGTSLDPNTRVIEFHSIGVGVKNTRKFFIVNPTNATFTFTWVNEDAQDPKKVPVFNCLVPKGSVRSGKKHEITFDFIPNELDVVESFWRFIIPEHSISIPFLLAGFTKEPSISLDRSHLNYKALLIGHEAIETVYMLNNEDTAFKFDFVEESCHSAGYASHLRVEPMSGWIQPGDRLPVNLFFTPTNDKEVNFNVICNVKRKTFPITLNVKAEGYTMSCTLMCEDSSGNKVELT---SNG----LNEINFGEVEVNEQSVRNLFIINHGKFNFDYKWEINERSS-KGHKMVSVTPDVGGVMFGEKQKCVLSFCPPTSTSLRGCELILRISNGPSYTINVVGYGRPPGLHFSFHTHNFGPCFIYRPGMPKLTTTLKVTNKDTKD-----ISLDCLYKNSAQLHHDFEAQVLPPGKTVDINFTFYPQEVKRYIEQVTFEINGLSKQGIEIIGQGTKMKIEVANPKQKLVNFGALRVNQVVKKVIPIVNNSPAPISFNLTITPNNMALQDASILNWSP-KNNITLEP-KGGTCKVEVTFSPKTRITQFTEEVLLECAGMNQPLFVITGSCQGVEISLDNDAIPFGAVVQRSQSTRKLVMTNSGDIGARFHWDVEKFKPDFSISPVSGYISPGMEVNFEITFHPLELSQDIRYERLKCDIEGDKPLRLTLTGMCIGVPPVKEQQHINTHVRQKETKNIMIMNRTNMHWVLKPVIEGEYFSGPEIFEVEPQQTKPFELCYRPLTLTPEGKKHLGSIFFPLPDGTGLMYNLVGSSDPPKVNARITRDVPCKTSYTEILSVNNWLKRPQRFRVKFDPLKPDKLDSGTTLKGLDYIDVPGNTKKDYKLTFYAHKEGQSVIKVTFTNEQTGEYQYYELTYRATKPDVIATIELTTPVRQTVQHTIELKNPLTYSITFAASCDKPEVLMPSQLVVPGETTGYFNLEYLPLKVGEETAELNFISNDLGQYNYILVLKAAPAGPEKALYFRSCLGLNQVQQARFLNFAKSKTDYACKIDNPDFHCEKSVPAAPGSSGGTWVALDVTYEPSRIGESRGTLTITSPTGGDYTFPLFGTAIPPKPQGPFIIKAGSTTSITFRNVFMHTTPFTFQVDNPLFHVTKSGENIRSRKDHRIVVGFDGNDSGTKAAVMGKLIVTCARSAGGSSNVQWVYYLKG 5878          

HSP 2 Score: 1129.78 bits (2921), Expect = 0.000e+0
Identity = 627/1543 (40.64%), Postives = 915/1543 (59.30%), Query Frame = 3
Query:   87 MPIGKFGEVIGTMNTF---GEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEIL-RQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQT--------GTKNAIKA-----PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNIL---EVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDI--ALIEEMKLDLESLDKGQEPHNLESTKKPSISIV------------------LKTHEKLEINEKLKTLLDTENEII--------PLGI---EEIFDVKPLYGTLKPNSFEQIT----FTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGI 4550
            MPIG FGE++GT  T     E    Y S VV P+NPK+++   P  KMTPS +MFQMSLDT KKL NT  M +P K+ELLDMG TTYQ  ++VS+++ +FQPFPS +FF N  P ETYE+PL+LRNNDKVPRLVKVT  DSPYF ++SP +V HKV  GLP  F+I FTP+Q +DY   L+ VTEREKFIVP+ CIG+RA+LDFPDE+ FP +P+KY  TKTL +RNIG+  A F + T  PF V P   VL VNESMQ+ ++F P    D   ++I+H +TGED+Y   +G+ Q+  VR++++ + IE TY+ +AN R IT+ NRSDV+ HF+W+ F++Q  ED+ +  + + L+ EE  E +RF  +        DK+S+++R++ N+KK+    K  F D++  I+P+EGDIWP++S ++T+ FKP +A+ Y   AFC+VTGRE+RL L+I GVG+GPKV+FSF  LDMG IF+ + H YE++L NKGDIDA+F +    S     FTF P + ++ P  HQ +QI F S   LG F + F  ++DG  E   + F G VIGPTF FDV K++FG +S GF ++   +L NT+LVP+ F LRVP DG SD  +++      +  E  S   P+EF + PS G L   +  +I V +T+N++ KY   LV+DV GVG+E+ S+PITA  +VP + +    LD+ R FL++ YE+ +K+ N + LP KYE+L +Q ++   + Y S     I++PNS +++P+ ++   + EL     F IFGS + PL + + CIGEGPVV++  + LDWG + VL D S  ++LSNES IPA F A M++  S + VEPR G +     L L V ANL+DCV+F D++Q++    +++ +P+   G+GTTI  DPP++  +NLG +FSK    + +R+ N+G+R QQLVW+ EGYS  +A R T          KN   A     PI  + P R +L PGES  +V++GYVD PQ V E ++CH+IIGR GGKELI +VD+   FISP+L+FS R++ FR+DK  +    + T+    +NVS L LN  L + YPF ++     ++   SE +M L   +++TI IQF+P +K D H R  ++ L V++ EHPHVD I L GEV FPNL+F++S INF CILN +EV+++V + N SP+EV+Y W  L+GD+P  +FH+R  + +      E + +  E+  +  +S+Q  G  +       + I +  QY++++  +  EE   +++S      P        P I+++                  +K H   ++  K + L+   +E+         P GI     + DV PL   ++P   E++     F  FG  +V   V  IC  EG   +               + L  D+GQ+       K + LSN   +  +FT+            P     + P  G + A   + + V        RF D   +        TI ++G+G    +  D P   G+
Sbjct:    1 MPIGPFGEIVGTTGTLEGVAEGAKNYKSNVVVPRNPKVVKPDEPGFKMTPSIYMFQMSLDTEKKLANTHDMRIPKKVELLDMGETTYQLVSHVSIDECMFQPFPSEVFFQNYKPFETYEIPLVLRNNDKVPRLVKVTQADSPYFKIISPNDVGHKVGPGLPRTFRILFTPDQIKDYNHELVCVTEREKFIVPVKCIGARALLDFPDEVNFPVSPVKYPSTKTLLVRNIGNMDAKFDLKTEEPFKVSPLNGVLPVNESMQVTIEFKPMTVGDHCKDLILHLDTGEDIYISCYGAAQDANVRLDKNSIRIENTYISMANQRTITIINRSDVIAHFHWTQFATQQEEDMQKMRYCQDLEKEEMSETDRFLEECISDPTLRDKMSVLSRTFQNRKKLIGNDKMLFSDNVVRIEPVEGDIWPNSSAEVTMIFKPDQAKNYTRTAFCDVTGRESRLPLRIQGVGMGPKVQFSFDVLDMGNIFVNSTHSYEVVLANKGDIDAIFTLLPNNSIFGPRFTFNPSESIVMPGGHQAIQITFNSP-ILGDFQEDFYFQVDGQPEKLKLTFSGSVIGPTFHFDVPKLEFGTISYGFVNTRHCTLVNTALVPMTFNLRVPGDGISD-SISSLSDYDSNYSEAGSMLPPKEFEVVPSTGTLQPQSEVRIQVNVTSNTVKKYDMALVVDVDGVGDEVVSLPITARCVVPPITVLTPILDYGRCFLRHPYERYVKLHNDTDLPAKYELLVQQVDEMTTIFYHSPQPKGILAPNSVMDVPLIIEPQGLEELECVALFLIFGSGEVPLPVQLICIGEGPVVHVTPLQLDWGQMPVLTDVSKTIKLSNESLIPAKFTAHMVRPNSNWCVEPREGEIPAEEVLELTVTANLDDCVRFQDKLQVNFLEGQSRTIPVTGYGYGTTIATDPPMAEGVNLGPYFSKNPCRKVFRLTNKGRRLQQLVWTTEGYSLLRAKRDTVEPDTKDVRYKNMPPAPEPWQPIFKLTPARIELVPGESQDVVLEGYVDMPQNVHETLLCHAIIGRSGGKELIMRVDIRAEFISPLLDFSSRNVFFRVDKHPEEELSLQTQDFTLSNVSSLPLNVMLGLKYPFQLVIREGQDKKICSEMEMSLAIGESQTIRIQFDPSYKDDFHIRTAEEVLTVAYKEHPHVDYIALRGEVYFPNLEFEKSVINFGCILNDTEVTRYVNITNNSPMEVKYKWCFLIGDEPCTVFHKR--QTVTHQVIGEELEEYYEEGQSQGRSSQGEGQPEGQGQQVEVEIQDSEQYAQELEESRQEEKVREIQSKWVVSLPITARCV-VPPITVLTPILDYGRCFLRHPYERYVKLHNDTDLPAKYELLVQQVDEMTTIFYHSPQPKGILAPNSVMDV-PL--IIEPQGLEELECVALFLIFGSGEVPLPVQLICIGEGPVVH--------------VTPLQLDWGQMPVLTDVSKTIKLSNESLIPAKFTAHMVR--------PNSNWCVEPREGEIPAEEVLELTVTANLDDCVRFQDKLQVNFLEGQSRTIPVTGYGYGTTIATDPPMAEGV 1513          

HSP 3 Score: 1055.43 bits (2728), Expect = 0.000e+0
Identity = 623/1705 (36.54%), Postives = 951/1705 (55.78%), Query Frame = 3
Query: 2121 LYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEIL-RQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQT--------GTKNAIKAP-----ILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNIL---EVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRR---LHXXXXXXXXXXXXLDATEKDTT-------------------TEKSTQEFGTSKQD---LNLDTLRIGEELQYSKDI-------ALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEK----------------LEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPR---NNGIAKESSNSSDDLFSMRVLFDTD--KSFSEYYQETKKE----FVEKNIELSEEELMTYLEDLAV---------------------------TNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPC---QENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEA---------------------------------PEASEIEQLENSIANKKDASQTFSKSAMSITNSE---------------SPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARR-SEVFDMEDGA--EKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKT---------------------DCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSI 6707
            + S+PITA  +VP + +    LD+ R FL++ YE+ +K+ N + LP KYE+L +Q ++   + Y S     I++PNS +++P+ ++   + EL     F IFGS + PL + + CIGEGPVV++  + LDWG + VL D S  ++LSNES IPA F A M++  S + VEPR G +     L L V ANL+DCV+F D++Q++    +++ +P+   G+GTTI  DPP++  +NLG +FSK    + +R+ N+G+R QQLVW+ EGYS  +A R T          KN   AP     I  + P R +L PGES  +V++GYVD PQ V E ++CH+IIGR GGKELI +VD+   FISP+L+FS R++ FR+DK  +    + T+    +NVS L L   L + YPF ++     ++   SE +M L   +++TI IQF+P +K D H R  ++ L V++ EHPHVD I L GEV FPNL+F++S INF CILN +EV+++V + N SP+EV+Y W  L+GD+P  +FH+R    H+ I +   +      ++  ++                   +E+  QE   S+Q+   ++ + + I +E Q   D        A  E+ + D +  +KG  P   E+ +K  +   +    +                + +N KL  L+D E E   LG+EEIFD+ PLYGTLK    EQIT T++GH+D+ +   AICEVEGGPTY  EL GEAS V+Y F   + D+G+ +YDQVA  ++TL N GKVGF FT+      L   +   G P++IP +G++E  S +++ V YL G P RF  S  IQVAHF  +TI+I G G FPR+++DLPR   N+G        + +L S       D   S +   +ET +E    F++     SE EL   +E L V                           + +  K   +  N+  LP Y L+FG V++G V +  V+  N+G +P +  +        GF + L +VK LP     E ++F ++FDPR ANL LG +++ + + I+ GP + V L+ANVTMP++  S++ +EF  VK GE K+ITIQL+N   V  EW +   E D+       K ++   +  +R   +E AKP  FE++P  G L PGQ++NVQ+KFMP +EK Y +R+ + +A SS+R++V   G GLEP+L+F+++ ++FGP+LP + G E+ + +RNPC FPIEIY+LEFDK YLE+E++LR + GYD +  +L+PPR   +KLP E +EYY++ +K+  E++   ++ ++  EA                                 P+ +         A+     +T   S       +               S  + ELE TPVS AIAR+LG++LT EGKAAR  RG+A +V G+PM+GKT ++  LA+ Y AALLT+D +I+EA+++GSTPA  +AR++C +AAR+ +E+  + +G   E + +  G     A+   +     A  +      NRKTSTV++      K  +       D T                     D +       P        + ++  + GE   L++C+LP+E++++IL+ERL L+DC +G+VFDGL+ LFS +       +L +LNNR++LYF+TLK  + ++
Sbjct: 1281 VVSLPITARCVVPPITVLTPILDYGRCFLRHPYERYVKLHNDTDLPAKYELLVQQVDEMTTIFYHSPQPKGILAPNSVMDVPLIIEPQGLEELECVALFLIFGSGEVPLPVQLICIGEGPVVHVTPLQLDWGQMPVLTDVSKTIKLSNESLIPAKFTAHMVRPNSNWCVEPREGEIPAEEVLELTVTANLDDCVRFQDKLQVNFLEGQSRTIPVTGYGYGTTIATDPPMAEGVNLGPYFSKNPCRKVFRLTNKGRRLQQLVWTTEGYSLLRAKRDTVEPDTKDVRYKNMPPAPEPWQPIFKLTPARIELVPGESQDVVLEGYVDMPQNVHETLLCHAIIGRSGGKELIMRVDIRAEFISPLLDFSSRNVFFRVDKHPEEELSLQTQDFTLSNVSSLPLTIMLGLKYPFQLIIREGQDKKICSEMEMSLAIGESQTIRIQFDPSYKDDFHIRTAEEVLTVAYKEHPHVDYIALRGEVYFPNLEFEKSVINFGCILNDTEVTRYVNITNNSPMEVKYKWCFLIGDEPCTVFHKRQTVTHQVIGEELEEYYEEGQSQGRSSQGEGQPEGQGQQVEVEIQDSEQYAQELEESRQEEKEVDKELMLIIDEDQKDLDTEKGSVHKADSEKAETDRQVSEKGGSPQMQEAVEKLDLGRGVSVQSRQSRAMSRMDTGTPKPPVLVNAKLAELMDREPEEEDLGVEEIFDILPLYGTLKSGDTEQITLTFYGHADIGSKARAICEVEGGPTYVVELKGEASLVQYAFDCQDIDYGKQMYDQVAETQITLINTGKVGFNFTAINMDPSLE-KKPRAGVPVMIPHTGYIEPFSELILTVKYLPGVPERFHRSFQIQVAHFEPDTINIYGEGVFPRISLDLPRVDDNDGRYSSQLKEARELLSGEKKCGKDPFNSLASTLRETHREDDNVFLQPEGMPSELELQMEVERLMVKEYAMDQLQQSNRSETHDTSHVPTTHDSKEHSKKGKRKKNRPRLPDYLLDFGYVVLGTVRTHIVRATNSGWYPASFSVDHEQSHGTGFNVELDRVKQLPGAPDHETVDFVVSFDPRGANLPLGDIDTVVPITIVNGPQINVRLHANVTMPEMTVSADTLEFGEVKCGECKIITIQLYNHKFVRCEWNSLPLEKDK-------KKDKHIPMHLRRKMRQEKAKPRTFEVMPPMGVLMPGQRLNVQVKFMPTEEKYYEYRVPIRIAQSSQRLLVLARGNGLEPRLDFEKTLMEFGPILPHSPGDEREVVVRNPCQFPIEIYNLEFDKTYLEEEKVLRLMKGYDEYNTILLPPRGPSEKLPAELLEYYEDQMKKLEEVERKKREKEEAAEASRKEQEEREAAAEEGEEKAEGENGEPETPKLDIPQIARTAPSRTGTADASKGEETKEGSGEDEEKEDKEEEQEEDKPGESIGSAGVGELEITPVSAAIARHLGIDLTQEGKAARNRRGVAFIVHGAPMAGKTSSAVALAKHYEAALLTLDGVILEAISNGSTPAGLRAREMCAEAARKQAELEKLAEGMGEEGEKIKAGGLTAEAVAAHTQGTGPAAAHAPSIISNRKTSTVADHKGGKEKIKAGIAASSVDGTSQSDNAKIQRGRGAAAAAQEEDASQVPSSPPPLAAPIARRLSVSASVAGEG-GLMSCVLPEELLVDILAERLQLNDCHRGVVFDGLDTLFSANMVNALYALLKALNNRKYLYFVTLKLSYDTL 2976          
BLAST of Hydin_ADK domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23842334 (tr|V4BQE4|V4BQE4_LOTGI Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_122343 PE=4 SV=1)

HSP 1 Score: 2076.98 bits (5380), Expect = 0.000e+0
Identity = 1115/2626 (42.46%), Postives = 1636/2626 (62.30%), Query Frame = 3
Query: 7572 PEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPF----EKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISD-DGLK------------VQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKD----SIAIQKSKQ--------------NENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMV-PIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPK--SISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTD-LESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNT-ARQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGK-KVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGW-KNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDG--SADGGPVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            P++  G+P+++++ S K     EK ++     +LP +DEVL+GLGLG+ GPPIPPPA+FS++ YP++R+ P ++E     G + F+ +  D  +    +   + D D+      +KIKE+L   TPT    + K  +  V  ++ K+RKSS  +  + N         +      TP+SD DG +            +   RW++  + E  LRLRF+S+ELGQFDQ  NFEI+ TRR+YQ+FCRG+CAFP IS+EPRIVFP RK++K+ +EIV+KKYIL  EVFEFGPLL+ K + R   G+YPENM  + + N+SP+ A+++F +L+D+  + F L+PPSM L+P ES  L +WA+P+   +++D+I+CCV+ENPEP+I+K+SC G  P +ELD K +HF++VLLHRKD KT+YLRNST LPV W+++GLE+LGD+FS A D G ++ +SE+ L+AYFRA+KP +  +KK IRLEISD E + G++ TE +Q++AEAYDVALDMSFPKG + G+D G ++V +ETKQ+ TLKN+G YEI+++F  +  +    ++SNLF++ PS+G +S  ++  QVQ+ + ++ EV IKD  ILKCHVIEPN++D GE+IA IP+++S +S +SK+ I P  DINFGS+ V ++KTR   IEN GEFDF++ I      Q +    P  N  T Q        A+ KSK                ++   G  QSR Q G FT+FPA G++       +TVDCI++  G+ DE + ID+TDRNPK +P G+ Y+L  EA +PSI++ ++ +IFEEHRIC  ++V  +  +Q  SGG+YG+ E +F+F NV+VG K +A+F++ N N VPCD+  SLKP+        G+G+    ++FEVEP+R Q+      YV++ F+P +MQ + AIFD +IEGL  N   R K L+FEVCGEG LPR+ + KPT+RNK+ Q L LF+K+LL R ++  I L NDG LP +V        S F +            +  K+ H   + ++VG + +F+ +F+P  + +Y  +I+++V++NQYED+I+QL+GEGYED +T +N+  + S  + P     ++              EII A +N I       + + K  ++ FS+ NH+    +RF WP+             +KF P +GHLH G    +  T ++  PKT+ E+ + CK+ +I+    +E  A   +WDD  +T+KW+D    N+ +     K KV+E E EP F EVP+T+R+L+LL++A  +YC++KCK   INF+DT++F+TR+Y +S+ N+G + + + W + +D+   F P   R  T   +G+    + +  +   +  PFSI P  G I   +K+ F V F+PL+V  YK  + C I NL      P ISLSG+SL PYCHFEL DSDY+   RR+P +RGPGG+PPG  ++PNTRVIE   +G+          V   R   +   I +   LP  + L+Q + ++   E+ K  +   F+F S  +G+ ESFWRF IP+  I+VPFL+VG   EP+V+ D+SH  F ALLIG E++E V + N +N  ++F F + S ++ G+S  L ++P  G IP    + I + F+   ++ +NFNL C++ +K  P+++NVKAEGYS+ S+++ ED+ G+++EL         +  N IN G +EV E+  R + ++N G+FN+DF W+I  K D +  +++ ++P+ G V+ GEK +C +        +L+     L I  G  Y L +      P L FS+  ++FG+CF++R G+ + +  L +TN+D K+     ISV+CL E  +   H F+A VI PG S  I   F PRK  KY +S+ FEING+S+  V+ TG   E+K+E  D     +NLG   VGE V K + I N +  P+T  L  +PT   LQQ  +  I P     +  P +     +++ F P +RI+ FTEEV  E  G+  P+F++ G C   ++  D E+I FG V + S  T+KL M N GD+  +F+W+   FKPDFSI P  GYI+ GME+ F+++F P     DIRY+ L+CS++G  K + L LTG+C  + PVKE  +F   VRQ++ K + I N TN  W LKPVI+GE+WSG  T +VEPQQ K+YELT+KPLTMT +GKKH GS+F  +PDG+G++YNL+G AEPPKA  KITR+VP +  ++E+L+V NWLK+PQRF+V  E LK +K ++   +KG EY+DVP    K YK T  A KEG+  +KV F NE TGE+QFYE+  +A +P  T  I+L++PVRQS+ H++ LEN  S  +N+ ++   PE+   +Q  +Q+ S+     E+ PLRV E   ++E S  D     YDL L  TPS PE+ L F T +G  Q   A F N+AK K+D+SCKIDN+ FH DK++  AP      E   +V FEP+KLGE K +LT+S+Q  GE+IFPL G   PPKPQGP IIK GS+  I+FRNVF     F FQ+D+  FH++K  E++++ KDHR+V+ FDG  S     VMGKL+V+C  +  G  N QWVYYL+G
Sbjct: 2470 PDDGIGIPHILLDCSTKDIQPGEKALELG---KLPSLDEVLDGLGLGNHGPPIPPPASFSVIPYPVKRKPPPVAEF---GGQFLFIASSPDDPNVGVEEKPKDLDLDEEKSVTPDKIKEELT--TPTKS--KGKTDKQKVSGESKKERKSSADRKKV-NRRGSVQAVQSPPPGATTPVSDVDGQRCPEEKWHEKCVILTIFRWVVPANGETVLRLRFQSEELGQFDQTLNFEIVGTRRRYQLFCRGVCAFPTISREPRIVFPQRKKSKKSDEIVNKKYILMTEVFEFGPLLVGKSRDRYKEGKYPENMSTMTVLNTSPLEADVSFCYLNDSKGDTFLLEPPSMVLKPGESAPLTIWAYPKVPGRYDDSIVCCVRENPEPIIFKVSCDGFRPELELDKKQLHFDKVLLHRKDTKTIYLRNSTMLPVAWKLSGLENLGDDFSVAADSGVVEPMSEYPLHAYFRALKPVQT-SKKMIRLEISDKENIMGVVTTEAIQVIAEAYDVALDMSFPKGTDGGIDFGVIRVSEETKQVCTLKNKGKYEIQFQFVFENVDPNNPDISNLFSVIPSRGPLSSLDRPTQVQVIFKSQREVTIKDVPILKCHVIEPNLSDDGEIIATIPVKVSVKSVFSKFNILPMNDINFGSLLVNSKKTRTFSIENKGEFDFKYTI------QRMVKDAPTLNSHTRQNRPHEVKPALCKSKSYSFPFYVTFLVFFYRQDATTG--QSRLQLGMFTIFPAFGIILPNGHQTITVDCIAEQQGRSDEEISIDVTDRNPKSNPGGIPYKLLAEACIPSINAEDIGTIFEEHRICKNLSVW-QSTNQAESGGVYGEEEKKFVFNNVIVGRKAKARFKISNHNKVPCDVVFSLKPM-------SGKGALKQVEVFEVEPSRTQVPNHSHMYVTITFTPPSMQSFSAIFDASIEGLSQNQA-RGKNLTFEVCGEGNLPRISIAKPTVRNKRGQPLSLFRKTLLSRTEALPIVLHNDGTLPSKV--------SYFKLLRIK--------IKMKRAHTASVVVNVGEKATFECVFKPGHAQRYQGHIRLSVIDNQYEDSIVQLVGEGYEDDVTLDNIQSVTSDKIEPEQEEGNMADDDVAGRLAVIGHEIILA-QNLIFYLNRATVLQLKLKTVMFSMTNHNTSDCIRFQWPTHPE----------LKFVPQIGHLHGGCKKDIAVTFKASEPKTFTEEVVNCKVSKISFDKPMEQVA---DWDDRIRTVKWVD----NTTALERPGKMKVVEVENEPVFNEVPDTSRNLELLVSAVADYCQFKCKAEAINFKDTLMFQTRLYQVSMSNKGNVHLDFSWQVIMDS---FIPSLPRAVTFMSEGERPESRVDVVDTSYI--PFSIEPQYGSIAPKKKKSFTVKFSPLDVSDYKGRLVCSIPNLKDEEG-PIISLSGQSLMPYCHFELMDSDYISGARRNPELRGPGGAPPGTTLDPNTRVIEFQCVGVG---------VMAARTTKKLVKIKQTLFLPL-QILLQGIWSS---ESDKPDISAAFEFVSNQLGIVESFWRFVIPDQNISVPFLLVGNAREPDVSLDRSHLNFKALLIGREAIEKVNLYNNENVEFDFKFSEESCYSEGYSAKLGVQPNIGTIPPKSSIPIDLIFSPNSDKEVNFNLACKISRKILPVTLNVKAEGYSMMSSLFCEDSLGNNIELA-------EKGINQINFGEVEVNEEAIRNLFIINTGKFNFDFKWEILDKSDHR--DLVKISPMKGGVMFGEKQKCAISFCPLSRMSLRGYQMELKISNGPCYTLEVIGQGVTPGLHFSYLSYNFGNCFIHRAGLPEHSTVLTLTNKDKKE-----ISVDCLYEPTNHLNHTFDAGVIGPGKSLDITFKFYPRKAIKYTESVTFEINGLSKQTVEFTGVGSEMKIEVADPKMKIVNLGSKLVGEVVKKYIPIVNNSPAPITFNLALTPTSPGLQQSDILSIAPTSA--ITLPPRGGTCKVEVAFRPKKRIAPFTEEVMLECAGLFQPLFVVRGSCLGMEVSLDTEAIPFGAVIQKSQSTRKLVMSNTGDMNTKFRWDESKFKPDFSIRPVEGYITPGMEVTFDVTFHPQTLNQDIRYEKLKCSLDGSNKPIYLTLTGMCTGIPPVKETQHFATHVRQKETKHISIPNRTNQQWHLKPVIDGEYWSGPVTVIVEPQQNKSYELTYKPLTMTPEGKKHTGSIFFPLPDGTGLMYNLTGIAEPPKASGKITRDVPCKTSYTEILQVHNWLKKPQRFRVRVECLKVDKLDAGTTVKGIEYIDVPASSKKDYKQTFYAYKEGVSAVKVIFTNEQTGEYQFYEVTYRATRPGVTGTIELTSPVRQSVHHAITLENPLSYPVNFSLTCNVPEVLMPSQLNIQANSEGRLNLEYQPLRVGEVPGRIEFSCNDLGLYMYDLILKATPSGPEKALYFRTCLGQSQVQTAKFLNFAKQKTDYSCKIDNSDFHVDKTVAAAPGSTGGTEVAFDVSFEPSKLGEQKAVLTVSSQTGGEYIFPLNGSCIPPKPQGPCIIKAGSNTPITFRNVFNATTPFTFQVDNPLFHVSKQGESVRARKDHRIVVGFDGNDSNSKAAVMGKLIVSCASSAGGKTNAQWVYYLKG 4997          

HSP 2 Score: 1715.66 bits (4442), Expect = 0.000e+0
Identity = 947/2267 (41.77%), Postives = 1396/2267 (61.58%), Query Frame = 3
Query:  219 MTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLE--EDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPI---LAADLT-SKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTED---LLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYS-YTKAMRQTGTKNAI------KAP-------ILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSV--SEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQE--FGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQE-PHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRN--NGIAKES--SNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKK---PLNKAINKLF------------LPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPC---QENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRI-LXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLK-------RHMELDGAPQKSDKYNE--------APEASEIEQLENSIANKKDASQTFSKSAMSITN------SESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRS--EVFDME-DGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKT----------------DCNTYLLCSSPPPLAGPAMMKLNIQIP-GENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKK 6743
            +TPS FMF+MS++T +KL NT  M++P K ELLDMG+T+ QK + +++++P+FQP+PS ++F N DPH+ YE+PL LRNNDKVPRLVKV+ E+SPYF ++SP +V +KV  GLP +FKIQFTP +++DY+  LI  TEREKF+VP++ IG+RAILDFPD+I+FP +P+KYT T+TL IRNIG+  A F+I   G FSV P   VL VNESMQ+ V+FTP    D + E+I+H +TGED+Y  ++G+ Q+  VR++++ + IE TY+ +AN R IT++NRS V+ HF W+ F++Q  E+ D+E  L+ + LE  E  +++RF  D  L     DKLSI+ RS++N+K++       F DD+  I+P+EG+IWPH+S ++ V FKP EA++Y   A+C++TGRE+RL L+I G G+GP++EFS +TLDMG IFI + H YEI+L N GDIDA++ +    S    CF F P +G++ PS HQ +++ F S+  LG F + F  ++DG  E   + F G VIGPTF F+V K+KFG VS GF      ++ NT+LVPL + LRVP DG+ + I   + +D T S  S     +   P+EF I P++G +   +  KI + L +N+I KY   +V+DV GVGNE+ S+PI+A  +VP++ +    LD+ R FL++ +E + K+ N + LP KYE+L Q+E   D   + YSSS+   I++P S   +PI +   ++ E     +  IFGS++ PL + + CIGEGPVV++    +DWG I VL      + L+NES IPA F A MMK +SVF VEP+ G++   +   +K+ A L+DCVKF D++Q+H E S+T+ + LMA G GTTIE DPP+S+ ++LG +FS   LN  +++ N G+RHQQLVWS EG+   +KA R+    N +      + P       I  + P R DL+PGE   + ++G+V +P+ V+E ++CH+I+GRQGGKELI KVD++ +FISP+L+FS +S+ FR+DK  ++  ++  K +  +NVS L L+ +LT+ YPF+IL  +  SV  +  ++ L   +   + IQF+P +K D H R I + L +++ +HPH D I L GEV FPN++F++S I+F CILN +EV+++V + N SP+EV+Y WS L+ +QP I  H +          +   L   E D   E+S +E       QD N D   + EE    K     +E + ++E L+ G     ++ES               L+ N  L  LL+  +++ P+ +EEIFD+ PLYGTL+P   EQIT T++GH+D+   V A+CEVEGGP Y   L GEAS V+Y F   + DFG+++YD V   E+TL N GKVGF FT       L  +  P G PI+IP +G++E  S   I V +L G P +F  S  IQVAHF  +TI + G G F R+++DLPRN  +G   ES    +   L    V  ++  S      ET    +E  +E+    +  +  + AV +  +    P N A +KL             LP Y L+FG V++G V +  V   NTG FP++ ++ +  +   GF + L +VKNLP     E ++F + FDPR ANL LG VE+ + +NII GP V + L ANVTMPD+  S + + F++VK GE K++T+QLHN   V  EW++  S        +E K    +I +  +R    E  K   FEM+P  G L PGQ+++VQ+KFMP +EK Y HR+ + +  SS+RI++ C G GLEP++E + + +QFGP+LP +SG E+ ++IRNPC FPIE+Y+LEFD  YLE+E++LR + GYD +  LL+PPR   +KLP E ++YYD+ +K       + +E + A  KS++  E        AP A E      +    +D +           +      S + ++ ELE TPVS +IAR+LG++LTPEGKAAR  RGIAI++ G+PM+GKT  +  LA+ Y  A+LTVD ++ +A+++G+T A ++AR+LC +AAR+   E+   E + AE+K+      G L     SV+              RKTSTV+ +       A +    GA  T                     +  SSPPPL GP   +L++ +  G     ++C+LP++++ EIL+ERL L+DC +G+VFDGL+ LFSQ+   TA  IL +LNNRRF++F+TLK D+  +KE+E    E K+
Sbjct:    1 LTPSRFMFEMSMNTEQKLANTHVMKIPRKTELLDMGDTSLQKFSQINIDEPMFQPYPSEIYFQNYDPHQVYEVPLTLRNNDKVPRLVKVSCENSPYFKIISPHDVGNKVGPGLPTIFKIQFTPHEKKDYRHELICTTEREKFVVPVNAIGARAILDFPDKIHFPVSPVKYTNTRTLLIRNIGNLEAKFNIHAEGVFSVTPDIGVLGVNESMQVVVEFTPNKIGDHNSELILHLDTGEDIYIVLYGAAQDSNVRLDKNSIKIENTYISMANQRTITINNRSSVIAHFKWTQFATQ--EEEDQEKLLQQIDLERAERRDKDRFLDDCILDPTLRDKLSILERSFLNRKRIVAGDNMMFDDDVVKIEPVEGEIWPHSSYEVNVVFKPNEAKSYTRTAYCDITGRESRLPLRIKGDGMGPQLEFSIETLDMGNIFIGSVHSYEIVLANHGDIDAIYSVLPNASLFGPCFQFDPSEGIVMPSGHQAIRVTFCSQH-LGDFSEEFCFQIDGSPEQLKVKFSGSVIGPTFQFNVPKLKFGTVSYGFLHQVTCNMLNTALVPLTYHLRVPGDGSVESISSTIDSDATDSNRSEFGSLTSEPPKEFHIIPADGTIPPQSEIKITINLISNTIKKYDMKMVVDVEGVGNEILSLPISAKCVVPQIAVLTPVLDYGRCFLRHPFEYLAKLHNDNDLPAKYEVLPQSEIGIDDASITYSSSIPRGIIAPRSVCSVPIIIAPQSLEEQDVTCYINIFGSTELPLPIHLTCIGEGPVVHVQPDIVDWGLIPVLTPTDRYVMLTNESLIPAKFEAYMMKPKSVFYVEPKEGVIPPESQFKVKISAYLDDCVKFQDKLQIHFEESRTQQITLMAYGQGTTIESDPPLSNFLDLGPNFSNRPLNMKFKLTNSGRRHQQLVWSTEGFGPISKARREMAAYNPLDMKFKDRPPPVEPARAIFRLTPSRMDLAPGECIQMNLEGFVSEPKPVEERLLCHAILGRQGGKELIMKVDIQADFISPLLDFSTKSVFFRVDKLPEDELKVQCKELIISNVSTLPLSTELTLQYPFSILADDGTSVLNTVGEVHLPVGEQYFLMIQFDPAYKDDQHIRTIDEVLHIAYKQHPHKDYIALRGEVYFPNIEFEKSNIDFGCILNDTEVTRYVNLTNNSPMEVKYRWSFLIENQPLIRHHPK----------RSQPLTIEEVDEVQEESQEEPQVEVVVQDDNED---LAEEEVRPKTEREKDETQEEVERLEIGSRMSRDVESA--------------LKSNRALSALLEQPDDLTPISVEEIFDILPLYGTLQPGDTEQITLTFYGHADIWGQVKALCEVEGGPNYELTLTGEASLVEYSFDTKDIDFGKLMYDNVGSAEITLINTGKVGFNFTGLNMDPSLAKHPKP-GHPIMIPHTGYIEPLSEQKIVVKFLPGVPEKFHKSFQIQVAHFEPDTIHVYGEGVFSRISLDLPRNTVDGGYYESMMKEAKQRLNRGNVTEESGSS------ETVPSELELQLEVERLAVRDHAIESAVASTYRSIDTPPNTADSKLTDKKHRKTKVRTKLPEYLLDFGYVVLGTVKTHVVSATNTGWFPVSFQVERENLHSLGFHVELDRVKNLPGAPDHELVDFMVKFDPRGANLPLGPVETVVPINIINGPQVNIRLKANVTMPDMLISDDTINFDDVKCGECKVVTVQLHNYQNVRCEWSSLPS-------GKELKQANKKIPMHLRRKMKMERKKAQHFEMMPPCGSLMPGQRMDVQVKFMPTEEKFYEHRIPLRIVQSSQRILLFCRGQGLEPRIELERNLVQFGPILPHSSGDEQEVTIRNPCSFPIEVYNLEFDNTYLEEEKVLRLMKGYDEYNTLLLPPRDTNEKLPTELLQYYDDQMKRLEEEERQRLEAEEAENKSEQVTEDGTVDNDTAPGALESGPAIVTTVPSRDGTPRQPVPQPPPQDEHEEEASSNTSVGELEITPVSASIARHLGIDLTPEGKAARNRRGIAIIIHGAPMAGKTSAAVTLAKHYETAILTVDGVVSDAISNGNTQAGRQARELCAEAARKKAEEIRGSELEEAERKNA-GAAPGALIGAAPSVIS------------GRKTSTVTELKAKHASLAGTKTTAGAVNTSSVDGATGSQVREIVISTMAVVPSSSPPPLVGPIARRLSVSVSTGGEEGFMSCVLPEDLLTEILAERLQLNDCHRGVVFDGLDTLFSQNYQSTANAILKALNNRRFIFFLTLKLDYNVLKEQERKDLEEKE 2210          
BLAST of Hydin_ADK domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|25038674 (tr|C3ZBW1|C3ZBW1_BRAFL Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_117689 PE=4 SV=1)

HSP 1 Score: 2006.49 bits (5197), Expect = 0.000e+0
Identity = 1133/2827 (40.08%), Postives = 1662/2827 (58.79%), Query Frame = 3
Query: 7113 RPDSHMTEMSNEADDLXXXXXXXXXXXXXXXIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRA----HPPIKPNQVPVEQHGENVNEENSTNPLKRVGRT--------------TVFNKRSKDHGANSGQVPPHTPVHDEN-PEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDED----------KPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNL------------SNFXXXXXXXXXXXXXXLTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNI-------KSGKPFQNLAGPLPNSNK---ETGQKDSIAIQKSKQNENI---LVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDT--ITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAF---------WVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWID-----VPADN-----------SISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLD--NSDIFTPRSSRPNTA-----RQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINP--GKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADG--GPVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            RP+SH T+ S+E D+  KKK     K      D  +KES  ++ E        +E  L  +FK ++   K+IS I+  WDR     H P  P +       E  + ++   P  + GR                   ++ K      G   P + +  E  P  + +      +E  GVP++I++ S        +++      +LP VDE+L+GLGLG  GPPIPPPATFS+V YP++R++P  +++     HY F+   +D  +      + + + D          KP EK    +   T T+   R K+ +      + KDR+ S  +               +      +   ++     T I     K+ T RW+I    ++ LRLRF S++LGQFDQ  NFEI+ TRR+YQ++CRGICAFP IS+EPR+VFPHRK++K+ +EI+HKKY+L  E+ EFGPLL  K + R   GRYPENME++ I N+SP+ A+I F F  DA    + LDPPSM L+P ESQ+L +WA+P+    FED ++CCV+ENPEPV+++ISC GV P +E+D K + FE+VLLHRKD KT+YLRN T LPV WRI+G+E+LGD+FS + + G ID  SE  L+A+FRAMKP   NTKK IRLE+SDV+ + G++  E +Q+ AEAYDVALDMSFPKGA+ GLD G ++V DETKQ +TLKN+G YEI Y+F  + S+     + +LF++ P  G + P ++  QVQ+ + ++ EV IKD+ IL+C VIEP++ DQGE IA IPI++S RS +S+Y I P+ DI+FG++ V +RK+R I IEN GEFDF+++I        +  P + L  P+P   +     G     +I K K+ E++   +   +QSR   G FT++P  GL+       V VDC+ + PG+ + ++ I+I+DR+P+  P G+ YRL  EA +PSI+++++ +IFEEHRI      + +  +L QL SGG+Y + +N+F+F NV+VG K  A+F++ N N VPCD++ S+KPL           S   GD+F+VEP+R  I      YV V FSP  MQ +  +F+  +EGLPS +L +++ LSFE+ GEG LPRV + +P L NK+   L L+++ LLG  Q+  + L NDG LPC+V ID++DP+  F          +     ++ E     SKQ H + + ++ G +  FDVLF+P    +Y   I ++V++NQYE+T IQLIGEGYE+ +T ENLP ++      AP++ VT    ++      +E I+A   N L FGDC I EP  +SF++ NHS+    RFTWP   + T          FSP  GHLHP     +    +S  PK  +   + CK+ +I +       +  +WDD  + +KW+D     VP +               +  + +KKV ET  EP  T V  + R L+L ++A  ++ K K K   I F+DT++F++RIY  ++ N+G +   + W +  D  +  +    + RP TA     R      +     E+    +PFSI P  G + A +KQ F V F+P+++  Y+A + C I NL+     P +++ GR L PYCHFEL DSDY I+ RR+P MRGP G+PPG  ++PNTRVIE    G++ +  + F ++NPT  D+ + W  ED    K      C  + G ++AG+K + GFQF +Q +GV ESFW F IPE+ I+VPFL+ G  +EP V  D+SH  F  LL+GH +VET+ + N + + + F F + S H+ GH+ +L I PM G +P      I + F+ T  +  NFN+ C V +KT  L +NVKAEGY+ +++V  ED+ G  V LTP       +  N ++ G++++ E+  R I +VN+G+F +DFNW  + + +P+    ++++P  G+V +G   +C L        TLQ     L I  G +Y L        P L FSF  +DFG CFV+  GM      L +TN+DSK+     +SV CL  +       FE  ++ P  S  + I+FLPR   KY   L FEING+S++ V++ G   E+ +E  D     + LG + VG  V K V++ N +  P+T  LV +P+   LQ   V  I+P  Q I + P  GK NA   ++ F+P  RI +FTEEV  E+ G + P+F++ G CQ  +++ D ESI FG V  GS  T+++ M N GDIG +F+W    F PDFSI P+ GYIS GME+ F + F P K + DIRY++L+C  EG K + L LTG+C +   +KE+LNF+  VRQ+D K++ I N TN TW L PVI+GE W+G ETF+V+PQQ K YEL +KPL MT +GKKH G+VF  +PDG+G+LYNL+G AEPPKAIS ITREVP +  ++ELL V NWLK PQRF+V  +++KP++ + S  LKG +Y+DVPG G + YKL   A +EG +  KV F  ++TGE+QFY +  KA  P + + + L+TPVRQS  H+V +EN  +  I +       ++    QF V +QS+    FE+ PL+  E+  +L + S +     YDL L   P+ PE+ L F   +G+ QT  AH  N++K K ++ CK+DN+ FH +K++  AP      E  ++V +EP+KLG+S+  LT+S+ V GE+ FPLVG    PKPQGP+ I+ GS+ SI F+N+F     F F +D+T F + K  E I++ K H +++ F+G+  G   P MGKLVV+CP +  G +N+ W +Y++G
Sbjct: 2470 RPESHETDKSDEKDEGGKKKKGKDGKGRPVSTDVTAKESSATVGEEPVPEPPPEEVQLSNRFKAYEHTQKEISPILEFWDRTQLIVHRPTTPEE-------EKESADDQPPPSAKRGRAKDKEKERLEKEKQEKERLEKEKLERLKEGAGTPTSQLGGEPFPADSDKGGEEQAKEELGVPHIILDASDPDDPCGPRLLTSG---QLPPVDEILDGLGLGPGGPPIPPPATFSVVPYPVKRKSPPGTDVAS---HYIFVAASQDDPNVAPEDRLPDVEPDTESVTPDKSTKP-EKASTGMEEHTATSSRGRSKERDKRSGTDSVKDRRKSASRKGRRSSLSAPSPPPGAATPGSEADGQSTIGDTSTAIEHKSPKLSTFRWVIPAGGDVTLRLRFTSEDLGQFDQTLNFEIVGTRRRYQLYCRGICAFPTISREPRVVFPHRKKSKKSDEIIHKKYVLGTEIMEFGPLLCGKTRDRYKEGRYPENMEKLTIMNTSPLEADITFCFQQDAQATTYLLDPPSMLLKPTESQELTIWAYPKTPGYFEDCLVCCVRENPEPVVFRISCHGVKPEIEMDRKQLFFEKVLLHRKDTKTIYLRNPTLLPVAWRISGVENLGDDFSLSAEQGVIDPKSELALHAHFRAMKP--TNTKKIIRLEVSDVDNIMGLVDVENIQVHAEAYDVALDMSFPKGADGGLDFGVIRVMDETKQTLTLKNKGRYEIGYEFMFETSDPNLPEVGSLFSVLPQHGSLLPTDRPTQVQVIFRSRYEVNIKDQPILRCKVIEPSLGDQGETIASIPIKLSVRSVFSRYIIYPEKDIHFGAMMVNSRKSRTITIENKGEFDFKYSIIRYIKETAAQSPQKRL--PVPGKARTKSRDGSSSGKSITKPKKAESVRQEVTQANQSRLMLGMFTVYPGFGLIQPGGHQQVQVDCLGEQPGREEVDIAIEISDRDPEDHPGGIPYRLVAEACIPSINTSDIGAIFEEHRIVQNSQASEMLSQL-QLESGGMYVEEDNKFVFNNVMVGRKARARFQITNTNKVPCDVAFSVKPL------SIKPSSKLHGDVFDVEPSRVAIPTHSHMYVVVSFSPSTMQSFTGLFEATVEGLPS-TLAKARNLSFELVGEGTLPRVTLVQPALFNKQGMPLLLYRRLLLGHTQALPMVLKNDGTLPCKVDIDLLDPERGFSLRLKRGSKAIQANGVDSDEEDEPQSKQAHTMSVIVENGVQVEFDVLFKPGAVQQYKGTIHLSVMDNQYEETNIQLIGEGYEEEVTIENLPALD------APLAGVTTEALQA------QEEIQAVHGNHLDFGDCAIGEPHQLSFTITNHSKQDVYRFTWPEHAALT----------FSPQTGHLHPKCTKDITIVFKSDEPKPLSRAAVACKICKILLKQTPDQVQ--DWDDRLRVIKWVDGETIQVPQEGDKKTTKDQPTPGSGTARLSRKKVTETAEEPGHTVVENSTRDLELQVSATCDFAKLKWKTESIGFKDTLMFQSRIYEFTLNNKGTVSAHFNWQLVTDGLHKSVSFAAADRPPTAPTPDLRPSSRMMLSPPPGEDLTTPSPFSISPETGTVPAGKKQTFSVKFSPMDIRQYEAKLVCSIPNLEEGKQAPVLAVRGRGLLPYCHFELEDSDY-INARRNPQMRGPRGAPPGATLDPNTRVIEFAATGISVKTSRSFFILNPTNKDYSFLWNNEDQSDSKLPSPFTCQTSRGHIQAGRKTKVGFQFCTQQLGVVESFWCFTIPELSISVPFLLTGSASEPKVVMDRSHLNFKPLLLGHSAVETIGLCNKEPRSFAFEFLESSLHSEGHAAALTITPMAGTVPPNASFPIDVAFSPTEEKQDNFNVVCHVQQKTETLVLNVKAEGYTTNASVQCEDSAGKKVTLTP-------QGLNQVSFGQVQIYEKAVRTIHIVNNGKFTFDFNWLKEQQRNPE---TVIISPEIGSVPVGAHKKCMLTFCPTTRMTLQDCQLALQITNGPTYDLKALGSGVTPGLHFSFLNYDFGPCFVHHAGMPVRKVALKVTNKDSKE-----VSVNCLFTNTTHLEVQFEPTILSPKESCEVHISFLPRHCVKYFDVLPFEINGLSQTNVEIRGEGTEMTVEVADKRQKIVQLGALLVGTTVKKVVSLVNKSLAPITFNLVCTPSSHLLQDSRVLSISPY-QSITLKPRGGKVNA---EVTFSPRTRIPQFTEEVMMESEGFSQPLFVLMGSCQGIEVQLDQESIPFGAVVMGSSSTRRMVMRNVGDIGTKFQWKVRQFAPDFSINPSEGYISPGMEVAFNVVFHPTKVSQDIRYEDLECVTEGRKKILLTLTGMCVSTPALKEVLNFSTHVRQKDTKTVTISNRTNQTWELHPVIDGEFWAGLETFLVDPQQNKAYELVYKPLCMTAEGKKHTGTVFFPLPDGTGLLYNLTGTAEPPKAISNITREVPCKTGYTELLTVSNWLKHPQRFRVSIDMVKPDRLDQSTSLKGLDYIDVPGLGKRDYKLNFFAHREGTVTSKVVFREDTTGEYQFYFVTFKATPPGTISTLYLTTPVRQSASHTVTVENPLAVPITFSTDCKVADVSLPPQFVVPAQSEGSMMFEYLPLKAGETNGRLALYSSELGHYTYDLVLRALPAGPERALHFKASLGANQTQTAHLTNFSKQKVEYLCKVDNSDFHVEKTVNAAPGSQGGTEVGIDVTYEPSKLGQSRATLTVSSAVGGEYTFPLVGNCLAPKPQGPYTIRAGSTASIPFKNIFPHTTAFTFTVDNTAFSV-KAGETIRAKKTHSIIVGFEGNTSGSKAPKMGKLVVSCPRSAGGEHNVTWTFYVKG 5225          

HSP 2 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 498/1255 (39.68%), Postives = 733/1255 (58.41%), Query Frame = 3
Query:   96 GKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQP--------REFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQT-EKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEI---------------------------------------------------PAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTG-----TKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRR 3665
            G  G + GT        + Y SKVVAP+NP+L+R   P  KMTPS+F+ +M LDT  KL NT  M LP  +ELLDM  TT+QK + V++++ +FQPFPS + F N + H+TYE+PL LRNND VPRLVKV   DSPYF ++SP NV  KVA G+   F+I FTP +++DY   L+ +TEREKF+VP+HCIG+RAILDFPD + F   P+K+T T+TL +RNIG+  A FS++   PFSV P   VL V ESMQ+ V+FT     D   ++++ Y+TGE V+  +HG      VR+++S + IE TY+ +AN R I + NRSDV++H++W  F++   E   R  +   L  EE  E+ERF  +        DK+S++TR+Y N++++       F DD+F I+P+EG+IWP+ S +++V FKP EA+TYQ  A+ ++TGRE RL L++ G G+GP V+FSF+ LDMG IF+ + H YE++L NKGDIDA+F I    +    CFTF P +G++ P  HQ +QI F+S   LG F + F + +DG  +   + F+G VIGPTF FDV ++ FG VS GF  ++  ++ NT+LVP+ F L VP DGT +  + + L   +    + S HQP        +EF I PS G + + +  K+ V L +N++ KY + LV+DV GVG  +  +PI A  IVP + +    LDF R FL + YE  IK+ N + LP KY+I+ Q  +    L Y SS    I+ P++  EIP+      + E    V+  IFGS   P+ + + C+GEGPVV++    LDWG I+VL D    +QLSNES I                                                   PA F A MM+  SV+RVEP+ G++   +   L + A+L+DC++F D++ +   +S+ + + + A G GTTI  +PPI+  ++LG HFS +     +++ N+G+RHQQL W  EG+   +  R T             PI  + PHR +L+PG++  ++++G   KPQV++E ++CH+IIG+  GKE I  +D+ V FI+P+L+ S R+++FR+DK +                                +L +NE              T  + +QF+P + SD+HSR     L +S+ EHP  D+++L  EV+FPNL F++  I+F CILN +EV++++ + N SP+ V+Y WS L+ D    I   R
Sbjct:   10 GTEGRLAGTAGDM--PRLNYQSKVVAPRNPRLVRGELPPPKMTPSKFLHEMGLDTAGKLANTHEMHLPQIVELLDMAETTHQKFSQVNIDEAMFQPFPSEIRFQNYESHQTYEVPLQLRNNDGVPRLVKVYQTDSPYFKIISPNNVGDKVAPGMASTFRILFTPLEKKDYVHELLCITEREKFVVPVHCIGARAILDFPDYVNFSAWPVKHTATQTLLVRNIGNKDATFSLAAQRPFSVSPSCGVLPVGESMQVTVEFTAPTTGDHVADLVLTYDTGEQVFVELHGVAVNANVRLDKSSLRIENTYISMANQRTINIVNRSDVIVHYHWKLFATVEEESQQRTHYTSELSHEESVERERFLEECITDPTLRDKMSLLTRTYENRRRIVSGDSMLFADDVFQIEPLEGEIWPNQSAEVSVIFKPQEAKTYQQVAYLDITGREARLPLRLRGDGVGPNVQFSFEQLDMGNIFVGSIHTYEVVLANKGDIDAIFSILPNNTHFGLCFTFNPTEGIVLPDGHQAIQITFRSAT-LGDFQEDFYIAIDGSPQRLKLSFRGCVIGPTFHFDVPRLNFGVVSYGFQHTQTCTIVNTALVPMTFSLHVPGDGTGERSICSLL--DLEDGTHASDHQPNQSVSSALQEFIIVPSSGTIPAQSQVKVQVTLVSNTVKKYDSMLVVDVQGVGQGILMLPIVAKCIVPTLAVVTPVLDFGRCFLGFPYEHSIKILNDTELPAKYDIIPQAVDDASTLTYQSSQWRGILQPHTVTEIPLTCTAQQLNEAEEVVYIHIFGSQDPPMQVHVCCVGEGPVVHVAPTELDWGDIRVLTDVHRTVQLSNESLIPAPFSAQMQVHVCCVGEGPVVHVAPTELDWGDIRVLTDVHRTVQLSNESLIPAPFSAQMMRPGSVWRVEPQKGVIPPESAQELVLTAHLDDCIRFKDKLYIQYPSSQPRTIVVQAYGHGTTIVANPPITPAVHLGPHFSDSPCQYHFQLTNKGRRHQQLFWHTEGFPMYRIRRATSNNNNNQNGPTSEPIFHLKPHRMELNPGQTIDVMLEGLTKKPQVLRERMLCHAIIGQSSGKEHIMTMDINVEFIAPLLDLSTRNINFRIDKEL--------------------------------VLAINE--------------TIMLQVQFDPAYCSDAHSRTEISNLNISYKEHPSKDKVQLCAEVHFPNLTFEKMDIDFGCILNDTEVTRYLDVTNESPMPVKYRWSFLLDDPTQAIKFSR 1213          

HSP 3 Score: 572.007 bits (1473), Expect = 5.168e-159
Identity = 359/986 (36.41%), Postives = 541/986 (54.87%), Query Frame = 3
Query: 3921 SIVLKTHEKLEINEKLKTL-----LDTENEIIPL--GIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTD----------KSFSEYYQE----TKKEFVEKNIEL-SEEELMTYLE-----DLAVTNQPK----------KPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPC---QENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILR------------HISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGT----------QGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNI--QIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITL 6686
            S+V +T E+  + E+ + L     L  E+  + L  GIEE+FD+ PLYG L P   ++++FT++GHS +  + +AICEVEGGPTY   L GEAS ++Y+   L+ D+G+ L+DQVA  E+ L N GKV FEF +     ML  N  P G P+L+P +G V A+S   + + +L G+P +F     IQVAHF  + I++ G G FPRL+ DLPR   +  E  + +  +   R     +          ++ SE   +    T++ FV    EL SE +L   +E       A +  PK          K L K +    LP Y L FG V++G V    V++ NTG+ P++    +  +   GF + L  + +LP     E ++F++ FDPR ANL+LG VE+ + L+I GGP++ + L A VTMP+++ S EV++F  V+ G+ ++IT+QL+N   V  EW++   E  +  K   H     R    ++       KP  FE++P++G L PGQ+VNVQ+KFMP +E  Y  RL + LA SS+R+V+  +G G EP+LEF  S ++FGP+LP +SG E+ I +RNP  FPIE+YSLEFD+ YL++E+ L+             I+ + S  +L +P  A G  L       + + +   M+ +G                 E  E +I                        + ELE TPVS +IAR+LG++L+PEGKAAR  RGIAI+V G+P+SGKT T+  LA+ Y AA+LT+D I++EA++SG+TP+  +AR++C  AAR +   D    A+K +   G+              A      V +         S+ +KTS VS   +    +A  N   G  +         SSPPP A P   +L++   + GE   L++C+LP+E+++EIL+ER  L+DC +G+V DGLE LFS SQ+     +L + NNR+++YFITL
Sbjct: 1383 SVVSRTAERPTLEERREVLPPLPWLQKEDPTLQLSTGIEEVFDILPLYGILHPGETQRVSFTFYGHSGIGCNATAICEVEGGPTYEVTLKGEASLLEYRLEGLDIDYGKQLFDQVAEAEIVLYNTGKVDFEFAALNMDPML-QNSPPPGMPVLVPHTGQVAANSQQTLTLKFLPGAPEKFHKKFQIQVAHFEPDIITVHGEGIFPRLSFDLPR---LPDEDGHYTSLMVQAREALTVEHKVQKQEPVSRAQSELSLQPAGGTEEVFVPAEPELPSELDLQMEVERRILHQHATSVHPKLKLAQPPNVQKKLRKQLTHTELPHYLLHFGYVVLGEVRIHIVRVTNTGYVPVSFSADQSRLHHSGFHIGLHHIHSLPGYPHHETMDFQVTFDPRGANLDLGEVEATVPLHIQGGPTIMLCLRATVTMPEMQVSEEVLDFGTVQCGQCQVITVQLYNHKQVRCEWSSVPQEKQKKGKVARHVPMHLR----RQMWPDNKPKPRHFEIMPSSGVLLPGQRVNVQVKFMPTEETLYHQRLPIQLAQSSRRLVLLVSGQGQEPRLEFSSSLLEFGPILPHSSGDEQEIMLRNPAAFPIEVYSLEFDQQYLDEEKDLKERGRMEQVVWRCRITPHPSPPSLQLP--APGLTLTAPLTWSHHQRMSPWMQANG-----------------ENQEAAIV----------------------GVGELEITPVSASIARHLGIDLSPEGKAARNRRGIAIVVHGAPLSGKTGTAVTLAKTYGAAMLTIDGIVLEAISSGNTPSGLRAREMCAAAARENAARDESTDADKSTAVPGSLSVDALTAHTAAAGAAAGSGSVSLAGGAAPSIISNVKKTSIVSGAQKAGGSKAGGNISTG--EASSQPAGGTSSPPP-AAPIQRRLSVSASVAGEE-GLMSCVLPEELLVEILAERFQLNDCHQGVVMDGLETLFSPSQTAAGLAVLKAFNNRKYMYFITL 2315          

HSP 4 Score: 92.4337 bits (228), Expect = 3.906e-14
Identity = 64/245 (26.12%), Postives = 120/245 (48.98%), Query Frame = 3
Query: 2475 PVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRH-QQLVWSNEGYS-YTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDK 3203
            P +  + + +D+G I    + +  L ++NES +P  +  + + D      +P   I     T   +V+           E Q+  E++K ++ P     FG T+  +                          RG++  ++  +  EG   Y + +R+ G  +    PI  + PHR +L+PG++  ++++G   KPQV++E ++CH+IIG+  GKE I  +D+ V FI+P+L+ S R+++FR+DK
Sbjct: 1160 PNLTFEKMDIDFGCILNDTEVTRYLDVTNESPMPVKYRWSFLLD------DPTQAIKFSRQTEEGEVV-----------EQQVLPEHTKLQLHPEEEEEFGETVAME------------------------TGRGEKEPEKDDFDLEGDDKYDEMVRENGPTSE---PIFHLKPHRMELNPGQTIDVMLEGLTKKPQVLRERMLCHAIIGQSSGKEHIMTMDINVEFIAPLLDLSTRNINFRIDK 1360          
BLAST of Hydin_ADK domain-containing protein vs. TrEMBL
Match: gnl|BL_ORD_ID|23915589 (tr|K1QL99|K1QL99_CRAGI Hydrocephalus-inducing-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10023182 PE=4 SV=1)

HSP 1 Score: 1945.63 bits (5039), Expect = 0.000e+0
Identity = 1051/2505 (41.96%), Postives = 1523/2505 (60.80%), Query Frame = 3
Query: 8109 KVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNI---KSGKPFQNLAG----PLPNSNK----ETGQKDSIAIQKSKQNENIL---VGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKID-PNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQL----CSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVS--TGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAP-PEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPI----NWDDTKKTMKWIDVPADNSISS--GAV-------HKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDN-------SDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIV-PGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXX---IANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEG--------WKNLSLVLTGVCQTVTPVKEI-LNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQ-QTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPK--AISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPE-KSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPF----------------------------------------TFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKN-KSDFSCKIDNTKFHCDKSITVAPNV----EAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADG--GPVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            ++   RWII  + E+ +RLRF+S+ELGQFDQ  NFEI+ TRR+YQ++CRG+CAFP+IS+EPRIVFP+RK+NK+ +EIVHKKYIL  E FEFGPL   K +  + +GR+PE ME+I + N+SP+ A+I+F +L D+  E F LDPPSM L+P ESQ L +WA+PR    +ED I+CC++ENPEPV++K+ C    P +ELD KV HF+ VLLHRKD KT+Y+RN+T LPV W+ITG E+LGD+F+ A+D G ++ LSE  L+AYFRAMKP  +  KK IRLE+SD++E+ G+   E +Q++AEAYDVALD+SF KG + GLD GT+KVG E K    LKN+G +EI+Y F  D  + +  N  +LFT+ PS+  ++  ++   V +++ + +EV IK++ ILKC VIEP + D GEVIA IPI++SA + ++KY I+P +DINFG++ V  +K +Q  I N G+++F++ I   +  K  Q   G    P    NK      G     ++ K K+ +++    VGG QSR QF  FTL PA G++   +S  + V+C ++  G+ DE L IDITDR+P    P+G+ YR+  E   PSI+ +++ SIFEEHRI   + +              GG+YG+ + +F+F NV++G K +A+F++ N N VPCDI  S+K +         +G+  + DIFEVEP RAQI      Y +V F+P +MQ + AIF+  IEG+ +N   R K L+FEV G+G LPR+ + KPT+RNK+ Q L LFKK+L+   ++  + L NDG LP +V ID++D D  F +    G     +     +K+PH   + + VG   SF V ++P    +  A+I + VV+NQYED++IQ++GEGY+D IT +N             + SV  G      +    E+ + A K N++ FGDC+INEP+++SFS++NHS+   +RF WP              +KFSP VGHLHP  A  +  T +S  PKT  E PI CK+ +I         KP+    +WDD  +T+KWID+P     SS  GA         KKKVIETETEP  TE  +++R+++LL++A  ++CKY+CK+  I+F+DT++F++R+Y  S+ N+G IKM Y W + ++N       +  F     RP    + + E              PFSI P  G I   +KQ F V   PL+V  Y+  + C I NL+     P + L G+SL PYCHFEL DSDY+   RR+P M+GP G+PPG+ ++PNTRVIE + IG+  ++ K F +VNPT   + + W CED +  K     +CL+  G V  GKK Q  F+FTSQ + + ESFWRF IPE  I+VPFL+VGQ  EP+++ D+SH  F ALLIGHE+VETV ++N ++QP+ F F++ S H+ G +  L + PM   IP+  ++ I + F    ++ +NFNL C+V +K  P+++NVKAEGY+++  +  ED+ G + E          +  N I  G +EV E+Q R +T++N G+FN+D+ W++   +  K   M+ + P++G V  G+++ C L       TTL+    VL I +G +Y++++      P L FSF  ++FG+CF+ + G+   T  L + N+D K+     ISVECL  +ND   H FE+ + + PG S  +  TF PR+ KKY +++ FEING+S+  V ++G+  ELK+E  D  +  ++LG  +V +   K      I N +  PVT  L  +P    LQ  G   I+P    I + PG      +++ F  N RI +F+EEV  E  G    +F++ G C   ++  D  +I F  V KGS  ++KL M N GD+ A+FKW+   F+PDFS+ P  G I+ GM++ FE+ F P +   DIRYDNL+C +E            ++L LTG C      KE+  +F+ PVR  D K+L I N TN  W LKP+I+ E+WSG  TF VEPQ   K Y +++ PLTMT +GKKH G+VF  +PDG+G+L+ +SG AEPPK    +KI  ++P ++P+ E L V NWLKRPQRF V  E+L+ + + + S  +KG  ++DVP  G+K YKL + A KE  + +KV F N+ TGE+Q+YE+Q K  K  +   I+L+TPVRQS    + LEN T     + + +   EI   N F V  QS   F                                        T E+ PL+V ES+ ++E+ S D  S  Y+L+L  TP+RPE+ L F  G+G     +A F N+AK  K+D++CK+DN  FH +K++  AP      E  L+V FEP+KLGE + LLTIS+   GE++FPL G   PPKPQGP+++K GS+ SI FRNVF +   F FQ+D+  FH+ K SENIK  K++++V+ FDG+  G    VMGKL++TCP++  G  N+QWVYYL+G
Sbjct: 2872 RLSIFRWIIPSNGEVVIRLRFQSEELGQFDQTLNFEIVGTRRRYQLYCRGVCAFPSISREPRIVFPNRKKNKKSDEIVHKKYILATETFEFGPLSPGKSRADMKSGRFPETMEKITMCNTSPLEADISFCYLEDSKGETFILDPPSMVLKPGESQPLTIWAYPRHEGHYEDKIVCCIRENPEPVVFKVCCDAFLPALELDKKVFHFDSVLLHRKDTKTIYMRNNTQLPVKWKITGWENLGDDFTLAEDNGVVEPLSEVPLHAYFRAMKPV-STIKKMIRLEVSDLQEITGLFTNEAIQVMAEAYDVALDVSFQKGNDGGLDFGTVKVGQEEKLTCHLKNKGKFEIQYNFVFDNCDPKNPNPWDLFTVNPSKMTLNMNDRPQPVTVSFKSNKEVHIKEQPILKCQVIEPRLGDGGEVIANIPIKVSAEAEFAKYSISPVSDINFGALLVNNKKQKQFTIYNHGKYEFKYTITLMQKDKDNQQGQGRGNRPPVKDNKRSRSRDGSSSGRSVAKPKKTDSVRQEGVGG-QSRLQFKIFTLSPAYGIIYPDHSQQILVECAAEMQGRFDEELSIDITDRDPSDHYPHGISYRIIAETCTPSINVDDIGSIFEEHRIVKNLALWQHHSQNAENTTMDGGVYGEDDKKFIFNNVIIGRKAKARFKISNTNKVPCDILFSVKAVQ-------TKGTRQLQDIFEVEPVRAQIMNHSHVYATVTFTPTSMQTFNAIFEAAIEGVATNQA-RGKNLTFEVSGDGNLPRINIQKPTVRNKRGQALMLFKKNLVNHSETMLLVLVNDGTLPSKVDIDLIDQDGVFQLKPVEGTNAVMDDDYEDTKRPHTASVIVGVGETASFTVTYKPTAVQRSQAHIHLMVVDNQYEDSVIQVVGEGYQDDITLDN-------------IHSVDNGTELDFEEGNMAEDDVAAAKPNLIRFGDCFINEPRTLSFSMRNHSKTDCLRFAWPDHPQ----------LKFSPQVGHLHPNTAKDMTVTFKSDQPKTLKENPINCKVTKITFD------KPLDKVSDWDDRIRTVKWIDIPTSPQPSSEGGAKAPLSSRPAKKKVIETETEPTHTEQADSSRNVELLVSAAADFCKYECKIESIHFKDTLMFQSRVYEFSISNKGNIKMDYSWQVVMENMPPPPQRAVTFVSEGDRP----ESRMEVPDASYI-------PFSIEPEFGTIAGGKKQSFIVKMAPLDVSDYEGRLICTIPNLEKDQQGPVVGLKGKSLMPYCHFELEDSDYISGARRNPEMKGPNGAPPGSTLDPNTRVIEFSCIGIGVKNTKTFAIVNPTSQPYSFEWTCEDEDDAKKPSAFKCLSPKGSVRCGKKFQVSFEFTSQELTLVESFWRFHIPEQNISVPFLLVGQAREPDISMDRSHMNFKALLIGHEAVETVYLLNNEDQPFFFQFEEDSCHSAGFAAHLGVSPMSATIPAKSRMPIELYFVPNSDKEVNFNLVCRVKRKVLPVTLNVKAEGYAMNCQLLCEDSQGVNKEFV-------SDGINIIRFGEVEVNEKQLRNLTILNTGKFNFDYQWELHMSN--KKKEMVTIEPMTGGVENGKRVNCKLTFCPPCRTTLKDTQIVLKISHGPTYVISLEGLGVTPGLGFSFPAYNFGNCFIIKPGIPPKTKVLTLINKDKKE-----ISVECLYPNNDYLRHTFESGICIPPGKSYDMTFTFCPREAKKYVETVQFEINGLSKQSVQISGTGTELKVEVADPRHRIVDLGATEVTKNAPKKKKYIPIINNSPAPVTFNLALTPETPALQSTGALTISPTNT-ITLEPG--GMCKVEVAFASNSRIPQFSEEVTMEFAGQYETLFVVKGQCLGMEVSLDTTAIPFPTVVKGSSSSRKLIMSNTGDMTAKFKWDLKKFRPDFSVYPVEGCITPGMDVTFEVIFEPKEAVADIRYDNLRCFLEDPVTKKPGVHPPVTLTLTGGCTAQPTTKEVPQHFSCPVRSTDSKTLSITNKTNALWTLKPIIDAEYWSGPLTFTVEPQTMNKGYPISYHPLTMTQEGKKHTGTVFFPLPDGTGLLFTVSGTAEPPKMNGGAKIQNDIPCKVPYVEHLPVENWLKRPQRFSVKWEILRQDTRQDMSTDIKGMSFIDVPANGTKDYKLNVFAYKETTLPLKVVFTNDKTGEYQWYELQYKFIKGGTIETIELTTPVRQSAFKKIKLENTTKQATTFNVQNNIAEILMPNTFSVPPQSTSAFKKIKLENTTKQATTFNVQNNIAEILMPNTFSVPPQSTYECTIEYQPLKVGESLQRIEMVSNDLGSYVYELKLKATPARPEKALYFRAGLGQSHIQVAKFLNFAKQAKADYTCKVDNNDFHTEKTVAAAPGAPGGTEVALDVTFEPSKLGEQRALLTISSPQGGEYVFPLFGTCVPPKPQGPYVVKAGSTTSIPFRNVFHQQTAFTFQVDNPAFHLTKQSENIKHRKEYKIVVGFDGNDSGTKAGVMGKLIITCPKSAGG-QNIQWVYYLKG 5308          

HSP 2 Score: 1112.83 bits (2877), Expect = 0.000e+0
Identity = 551/1215 (45.35%), Postives = 797/1215 (65.60%), Query Frame = 3
Query:   87 MPIGKFGEVIGTMNTF---GEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAAD-----LTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEIL-RQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYS-YTKAMRQTGTKNAI-------------KAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHR 3662
            MP+G FGEV+GT  T    G     Y SKV+AP+NPKLL+      KMTPS+F+F M ++T +KL NT  M +P KIELLDM +T+ QK + V++++P+FQPFPS ++F N +P+E YE+PLILRNNDKVPRLVKVT  DSPYF ++SP +V HKV  GLP  FK+QF PE+++DY   L+ +TEREKFIVP+  IG+RAILDFPD I+FP  P+K+T +KTL +RNIG++ A F++S   PFSV P    L V +SMQ+ V+FTP+   D + ++++HY+TGEDV   ++G  Q+  VR++++ + IE TY+ +AN R +T+HNRSD++ HF W+ F+++  ED  + T    L LEE ++ ++F  +        DKLSI+ R++ N++K+ +  K  F DD+  I+P+EGD+WP++S ++ V FKP EA      AFC++TGRE+RL L+I G GIGP V+FS++TLDMG IFI + H YEIIL+NKGDIDA++ +  T +    CF+F P +G++ P  HQ +QI F S  +LG F + F  ++DG  +   + F G VIGPTF F+V K+KFG +S GF +++   LQNTSLVP++F LRVP DGT+  I   D      T + SP        P+EF I PS G L   +  KI V   +N+I KY   LV+DV  VG ++ S+PI+A  +VP V +    LD+ R FL++ YE  +K+ N S LP KYE+L +Q  +   ++YSS     +V P+S  +IP+ ++   + E     +F IFGS   PL + I CIGEGPVV++    LDWG + VL      + LSNES IPA F A M++ +S F V+P  G +    +L++KVIA+L+D V+F D++QL  + S+ + +PL   G GTTI  DPP++  +NLG +FS   L +++++ N+G+RHQQLVWS +G+    KA +     N +               PI +++P+RFDL PG S  + I+G+V+ PQ V+E ++CH+IIGRQGGKELI +VD+  +FISP+LEFS +S++FR DK+  +S   + + +   NVS L L   L +  PF I+  +   VSE ++ L   K   + ++F+P +K D H R I + L +++ EHPH+D I L GEV FPNL F++S ++F CILN +EV+++V + N SP+EVRY WS L+GD+P  + +R
Sbjct:    1 MPLGPFGEVVGTTGTLEALGPDASNYKSKVIAPRNPKLLKDHEEGHKMTPSKFLFDMQMNTEQKLANTHIMRIPKKIELLDMADTSLQKFSQVNIDEPMFQPFPSEIYFQNFEPYEVYEVPLILRNNDKVPRLVKVTQADSPYFEIISPHDVGHKVGPGLPTTFKLQFRPEEKKDYNHELVCITEREKFIVPVRAIGARAILDFPDNIHFPAGPVKHTRSKTLLVRNIGNSEAKFTLSAEAPFSVTPEIGTLAVQDSMQVTVEFTPQKVGDCNSDLVLHYDTGEDVLISLYGGAQDANVRLDKNSIRIENTYISMANQRTVTIHNRSDIIAHFRWTQFATKEEEDQQKMTMTTRLSLEEKQDSDKFLDECVQDPTLRDKLSILNRTFQNRRKLVENDKMLFNDDVIQIEPVEGDVWPNSSFEVNVIFKPREAEICMKTAFCDITGRESRLPLRIRGDGIGPNVQFSYETLDMGNIFIGSKHYYEIILINKGDIDAIYSVMPTKTIFGPCFSFNPAEGIVMPGGHQAIQISFSSP-YLGDFLEEFAFQVDGQPQQLKVSFTGSVIGPTFQFNVPKLKFGTISYGFLNTQTCKLQNTSLVPMKFHLRVPGDGTTPSICCTDDLDNSSTDRASPTPGAG--PPKEFEIVPSTGTLQPQSEQKITVKFISNTIKKYELNLVVDVEKVGEDVLSLPISAKCVVPPVTVLSPILDYGRCFLRHPYEHSVKLHNDSDLPAKYELLPQQINEDTPIVYSSPKAKGVVEPHSLCDIPLLIEAQMLEEEDIVAYFSIFGSPDPPLGVHISCIGEGPVVHITPSDLDWGVVPVLTSIPMVITLSNESLIPARFTANMVRPRSAFSVDPVEGEIPAERSLDIKVIAHLDDAVRFQDKLQLSFQESQVRYIPLTGYGQGTTIVSDPPLTPQLNLGPNFSNRPLKKSFKLTNKGRRHQQLVWSMDGFGPVGKARKDLAAYNPLDMKYRNVPPPPQPPKPIFSLNPNRFDLPPGASFEMFIEGFVESPQYVKERMLCHAIIGRQGGKELIMRVDVSADFISPLLEFSTKSVYFRFDKNPKDSLTKMIRDLKMMNVSTLPLTTGLKLQQPFQIVLDDGSRVSETEIHLDIGKEYILRVEFDPAYKDDLHIRTIDEVLHIAYKEHPHIDYIALRGEVYFPNLDFEKSVVDFGCILNDTEVTRYVNITNNSPMEVRYKWSFLIGDEPCTVINR 1212          

HSP 3 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 400/1047 (38.20%), Postives = 580/1047 (55.40%), Query Frame = 3
Query: 3915 SISIVLKTHEKLEINEKLKTLLDTENE-IIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRN---NGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAV------------------------TNQPKKPLNKAINKLF-----LPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPC---QENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAP--------------QKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMS-----------------ITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAAR-RSEVFDMEDGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHG---ADKTDCNTYLL-------------------------------CSSPPPLAGPAMMKL-----------------NIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDF 6698
            S+   +   + L+ N  L  LL+ E E + P+GIEE+FD+ PLYGTL P   EQ+T T++GH+D+     AICEVEGGPTY   L GEAS V+YKF     D+G  +YD VA  E+TL N GKVGFEFT             P G PI++P +G++E  S   + V YL G P  F+ S  IQVAHF  + I I G G FPR+++DLPRN   +G   E   S+ +  +         +        + E   +  EL   E+   LE LAV                        +N+ ++  +  + K       LP YQL+FG+ ++G V +  V+  NTG FP++ ++ +  + ++GF + L +V+NLP     E ++F ++FDPR ANL LG +E+ + +NI+ GP + V L ANVTMPD+  S + ++F +VK GE K+IT+QL N   V  EW +  +E  E+ K+ +H     R    ++ K K+ +KP  FE++P  G L PGQ++NVQ+KFMP +EK Y  R+ + +  SS+RI++ C G GLEP+LEF  + ++FGP+LP +SG E+ I ++NP  FPIE Y+LEFD  YLE+E+ILR + GYD +  +L+PPR  G+KLP E +EYY+E +K+  E +                 +  +   E+ E  E + +   +      S+  SK+  +                    + S  + ELE TPVS AIAR+LG++LTPEGKAAR  RG+AI+V G+PMSGKT T+  LA+KY AA+LTVDQ+I++A++SG+T +  +AR++C +AAR R+E   + +G E     E   GGL        G TA+        NRKTSTVS+V      +   +K HG   A KT  NT  +                                  PPP  G    K+                 +  + GE   L++C+LP+++I+EI+SERL L+DC +G+VFDGLE LF+Q+   TA  IL +LNNRRF+YF+T+K D+
Sbjct: 1343 SLKEAIPEEDPLKSNRALSRLLEQEREELSPIGIEEVFDILPLYGTLMPGDTEQVTMTFYGHADIWGQAKAICEVEGGPTYEILLKGEASLVEYKFDTKEIDYGMQMYDHVASAEITLVNSGKVGFEFTGVGMDPAQAKKPQP-GVPIMVPHTGYIEPLSQQKLTVKYLPGVPEDFSKSFKIQVAHFEPDEIRICGAGVFPRISLDLPRNVDPDGNYIELETSARENLAKVEKKVVVVAERPGCAHVQGEMSTQPQEL---EIQMELERLAVKHFALDHQAQMLARPDLYDVTPPDSNESRETCDSKVPKKKKVKPRLPEYQLDFGHRVLGTVCTHIVRATNTGVFPVSFQVERDDVHRYGFHVELDRVRNLPGAPDHETVDFVVSFDPRGANLPLGPIETVVPINILNGPVIQVRLKANVTMPDMEISDDTLDFADVKCGECKVITVQLFNQQQVKCEWNSLPTE-KELRKAEKHVPMHLR----RKQKDKDKSKPRHFEIMPPTGVLMPGQRINVQVKFMPTEEKFYEQRIPIRIYQSSQRILLLCRGQGLEPRLEFDRNLVEFGPILPHSSGDEQEIIVKNPSSFPIEFYNLEFDSSYLEEEKILRIMKGYDEYNTILLPPRGTGEKLPPELMEYYEEQMKKLEESERTRKEAEEAALAAKRELEDQNGEGESDEGKEDDSVRTDLPPGTIDSRPGSKAGTAEPLDLEGRLKKEEMEDGDDTTSSIGVGELEITPVSAAIARHLGIDLTPEGKAARNRRGLAIIVHGAPMSGKTATAITLAKKYEAAILTVDQMILDAISSGNTTSGLRAREMCQEAARKRAEELKLMEGEEA----EKKPGGL-------TGPTAVPQTQSIISNRKTSTVSDV------KGLKDKHHGSMAAGKTGVNTSSIDGATGSQQTSSKTLTTLQAVPGHGHPPDKGGAGHPPPTKGAHAEKVPSSPPPLAAPIARRLSVSASVAGEE-GLMSCVLPEDLIVEIISERLQLNDCHRGVVFDGLENLFAQNLYITAHAILRALNNRRFIYFVTMKLDY 2362          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Cavefish
Match: hydin (HYDIN axonemal central pair apparatus protein [Source:ZFIN;Acc:ZDB-GENE-050419-219])

HSP 1 Score: 1592.02 bits (4121), Expect = 0.000e+0
Identity = 874/2404 (36.36%), Postives = 1365/2404 (56.78%), Query Frame = 3
Query: 8148 EINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIA------IQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPIN----WDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEP-QQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAP-----NVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVM--GKLVVTCPEAENGLNNLQWVYYLRG 15305
            E+ LR+ F S   G F+Q  +FE++ T+R YQ+  RGIC +P+ISK+ + VF H K+  +  + + K YI+   +++FGP+L  K++ R    +YPEN E+++I N+SP+ AE+NF F HD     F LDPPSM L+P+E ++L + A+P      ED+++CC+KENPEPVI++  C GV P +E++ + +HF++ LLHR++ +++ LRN TALPV W+++GLE LGDEFS +QD G I   SEF LN YF+A+K    + KK I LE+SDV  + G++ TE +Q++AEAYDVALD  FP+G   GLD G++KVG+E K    LKN+G YEI  K  +DG      NL+++FT+ P +G + P ++   VQ  +C   EV I+D+ ILKC VIEPN+   G ++A+IPI +SA+  +SKY ITP   +NFG++   +RKTR + +EN+GEF+ RF I      +   GP P   +  G   S        ++++   +   V  +Q R   G FT+ P  GL+P     +++VDC++++ G   E L +DITDR+P   P G+ Y L  +  VP I S +++SIFEEHR+C    +++ E ++  +  I+ + EN+F+F NVLVG   +A+ RL NP  VPC++SL +K +         + S    D FEV PTR  I      +V++ F P AMQ Y+ +F+  +EG    S Y SK L F++ G+G LP + V KP  R  + Q +  F + L+G  Q+  + + N   +P ++  D++D    F + +       P   ++   H   L++  G +  F+V F P ++  + A++++ V +N YE  ++QL+GEGY D I+ +N+    S    +                          ++N+L FGDC+++   + +F++ NHS    +RF WP          ++  ++FSP +GHLH G    V  +  S  P   + + ++CKL RI         +P++    WDD + T+KW+D  AD         KKKV+ET+ EP  T V   +R L+L ++A  +Y K++C+   I+F+DT L++TR++           +    ++ L N D+                               PFS+ P  G+IK    + F V F PL +  Y+A + C I NL       TI+ SG SL PYCHF L DSDYL   RR P +R              T+V+E +  G+ +     F++VNPT   + + W CED+      K   CL     ++ GKKV+  F+F  Q + + ESFW F IPE  ++VPFL+VG   EP V  D +H    +LLIG E+  TV ++N ++QP++F+  D+S  +    +SL +E M G +    K+ + I FT T    + FNL   V  +  PL++N+KAEGYS++++V  +D          C           +N  ++E+ E  T    + N G+F+ D  +++    D  L   L + P +  V +G + RC L     +   L+ +   + +  G ++  ++      P LEFSF K++FG  F+Y  GM   T  LVI+N+      +K ISV CL  +      +F   V+ PG S  +  TF PR+  +Y + ++FEIN  ++  V++ G    +K++  D  +  + LG ++VG+K  K + + N +   +T  L+F+PT   L   GVF + P  +  V  PG+     +++VFTP +R++ F+EE+  + +G   P+ ++ G C   ++  D   + FG V +    T+++ + N GDIGARF+W+  SF PDFSI PA GYI+ GMEL  E++F+PV+   ++RYDNL CSIEG K +++ L G C    P + +LNF   VR Q  +SL + N +N +W L+PV+EGE+WS +  FVVEP QQ K YE+T++P+TMTTDGKKH GSVF A PDG+G+LY L G  EPPKA+  I+ EVP +  ++E++ V NWL +PQRF+V+ E++ P++ ++++ LKG +Y+DVP    + YK++  + KEG    KVTF NE TGE+ FY +  KA  P   + +++   VRQ+    V +EN     + + +   SP+I   +Q  V + SK+   FE+ PL + ES  +L + + +  S  Y+L L   P+ PE+PL F   +GS Q L A F ++++ K++++CK D   F  +K+++ A        +  ++V FEP++LGE +GLLT+S+ + G+++FPL G  TPPKPQGP  I  GS V+I F+NVF +AA F FQ+++  F + K ++ I+S K H +V++F+G  +G   +  GKL ++ P  +     + WVYYL+G
Sbjct: 2166 EVTLRICFNSTAKGSFEQTLSFEVMGTKRCYQLCLRGICDYPSISKDHKTVFAHCKKVLQPEDGLQKTYIVRSGLYDFGPVLCGKNRDRYKE-KYPENTERLVIHNNSPLEAEVNFLFQHDTKATTFFLDPPSMVLKPKEKKELTVLAYPTSPGLIEDSVVCCIKENPEPVIFRFVCRGVRPELEVERRQLHFDKTLLHRRETRSLCLRNPTALPVAWKLSGLEVLGDEFSVSQDHGVIMPQSEFSLNMYFKAVK--SISLKKTIHLEVSDVGNILGLVHTENIQVIAEAYDVALDTGFPQG---GLDFGSVKVGEEVKISTHLKNKGKYEI--KKSIDGIIWSIFNLNSVFTITPQRGSLLPSDRPTTVQFIFCHNREVSIRDQPILKCQVIEPNV---GGIVAVIPINVSAQCLFSKYSITPPNSVNFGALVYGSRKTRNLTVENLGEFEIRFTIS-----RTSKGP-PGPAQRNGDSQSAKPFPPNKLRRADSVQKDTVVSTQGRMSMGVFTVSPCLGLLPPGGKQLISVDCVAEHVGFWHECLAVDITDRDPSDSPGGIPYSLVADICVPEIASKDIASIFEEHRLCQNSNMLHCEQYR-NAVSIFIQEENKFVFNNVLVGQLAKARLRLTNPGKVPCELSLQVKSV-------LAKTSERRSDAFEVTPTRLSIASYSHDFVTITFCPQAMQTYLGVFEATLEG---ASGYVSKVLVFDLLGDGNLPSITVVKPVQRTSQGQPVLQFNRLLVGSRQTLPLVIKNISSVPAQISFDLLDKMGVFGLRSA------PNTTSTLMAHVASLTLKAGQQAEFEVQFCPEVAQSFNASLRLVVQDNHYEVILVQLLGEGYHDIISLDNISNKVSCTFYL--------------------------ESNLLNFGDCHVSRLYNETFTMSNHSNIEVIRFEWPP---------DVPQLRFSPRIGHLHAGCTKEVTVSFISEQPVVLSTQVVKCKLSRITF------QQPVDQVPDWDDRRHTIKWVD--ADRQALPQQPAKKKVVETDPEPDHTVVDNCSRELELTVSAVCDYAKFECQAKPIHFKDTTLYQTRVFH---------SLASVSALLLGNPDL------------------------------PPFSVEPSVGIIKPGATETFCVRFCPLEIAEYEARLHCSIPNLKEGQGL-TITASGLSLLPYCHFHLKDSDYLSGNRRSPDLRVALDPN--------TKVVEFSSTGINT-----FSIVNPTNKPYSFLWKCEDT----RTKPFTCLTPKNTIQPGKKVEVSFKFHPQELDLVESFWTFLIPEHKLSVPFLLVGTANEPVVYIDHAHLNLGSLLIGQETRRTVYMVNGEDQPFSFSILDVSCRSEPLGDSLLLETMEGTVSPRDKLPLVISFTPTQEGAVMFNLLVTVTGRVQPLTLNIKAEGYSMNASVHCKDVQ--------CMLLKTIASVCFVNSVQVELSETSTCSFVVYNPGKFSLDVRYELTGPTD--LQRHLQVDPKTAIVPVGRQDRCILSFFPLQNCILKDMRFSIRVINGATFCCSLLGAATAPGLEFSFLKYNFGMNFIYSAGMVPATHTLVISNK-----GEKGISVNCLFSNTPSLKASFTPEVLPPGGSMEVLFTFYPREAVQYHEKVVFEINKCAKQVVEILGQGIAMKIDVEDPQHKVVKLGALQVGQKCRKLIPLINNSDSYLTFSLLFTPTAHALLDPGVFSMRP--EREVTLPGRGGRCKVEVVFTPQQRMAPFSEELQLKCLGTVCPLLVLKGCCHGVEVTLDQGYLRFGAVCRNCKATRRIILQNTGDIGARFEWDVQSFAPDFSICPAKGYITPGMELPLEVTFAPVEVKQNVRYDNLCCSIEGGKPVTITLAGSC---IPPQVVLNFACQVRSQCTQSLSLSNPSNQSWNLQPVLEGEYWSAAPFFVVEPYQQNKAYEITYEPMTMTTDGKKHLGSVFFAFPDGAGMLYTLQGTTEPPKAVGTISGEVPCKTLYTEMIPVQNWLHKPQRFRVLMEMVNPDRPDNTVSLKGLDYMDVPALAKRDYKISFFSYKEGQYNAKVTFKNEVTGEYLFYNLSFKATPPGVMSTVEMVASVRQTTSACVEVENPLPTNVVFSVECRSPDISVQSQLSVSALSKVGLDFEYQPLCIGESTTRLTLQNSELGSFHYELLLRALPAPPEKPLYFKAPLGSSQYLTAKFTSYSRVKTEYTCKTDCPDFFVEKTVSAAAAGSQTGSDVSVKVHFEPSQLGEVRGLLTVSSSLGGDYLFPLYGTCTPPKPQGPLTIYAGSHVTIPFKNVFPQAAAFSFQVNNPAFTV-KGADTIQSKKTHNIVVSFEGPPEGSKTLCTGKLTISSPRTDGHGQAIFWVYYLKG 4414          

HSP 2 Score: 828.55 bits (2139), Expect = 0.000e+0
Identity = 442/1155 (38.27%), Postives = 680/1155 (58.87%), Query Frame = 3
Query:  246 MSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTS-DPILAADLTSKVSPREYCS----RHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEIL--RQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYS--YTKAMRQTGT-KNA----------IKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEV---NEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQ 3641
            MS  T ++L NT  M  P  +ELLDM  TT+QK +++ ++ PLFQP+PS + F N  P E Y++PL+LRNNDK+PRLVKV  EDS YF V+S  +V  KVA GL   F + FTP++ +DY   LI VTERE F VPI  IG RAILDFPD+++FPP P+K    KTL +RNIG+  ANF +ST  PFSVEP    L    SMQ+ + F P +  D S ++++HY TGEDVY  ++G+  ++ VR++R+ V +E+TY+ +AN R++ + NRSD ++H+ W +F+++     D E F   LQ EED E E+  ++ +  L   D L    R  +++  +       F D    ++P EGDIWP  + +I + FKP EAR YQ   +C++TGRE RL L+I   GIGPK++F+F  LDM  +FI + +CYE+++ NKG IDA +++    + +  CF+F P +G++ P +   +++ F S   LG F + F   ++G  +P  + F+G VIGPTF F   +         FP +    L NTSLVP+ F +R+P DG   D + +++  S+ +   +        +P+EF + P  G + +++   I V   +N++ +Y   LV+DV GVG E+ ++PI A  +VP+V L    L+F   F+ Y Y+K + + N S LP  +  L  ++ E+   LL+SS     ++ P S +EIP+ L+   +G+L     F + G    PL L + CIG+GP ++L +  L +G I VL D   +L+LSN S +PA FHA M   +S +RVEP  G +     + L+++A+L+D + F D +QL I++S+T+ V + A G GTTI  D P +  ++LG HFS       +RV NRG+R  QL WS EG+   + K++    T +N           + AP+ T+ P    L PGESA ++++G+ D P+VV+E ++C + +  +  K+ I  VD+   FI+PVL+ S + L F ++K  D     L + +   + S L L+ +LT+  PF + +    N F+ S+ +++          ++F+P ++SD  SR+ +  L+V +  HP  D + L GEV+FPN+ F  S ++F C+LNH+E  Q + M N SPL V Y W+ L+  Q
Sbjct:    1 MSQTTEERLANTYEMHPPRILELLDMSITTHQKFSSLDVDQPLFQPYPSEIVFQNFLPSEMYKVPLVLRNNDKIPRLVKVVVEDSLYFKVISTEDVGSKVAPGLTCTFTVLFTPQENKDYIHRLICVTERETFEVPIRAIGVRAILDFPDQVHFPPCPVKGLTQKTLLVRNIGNGEANFQLSTQRPFSVEPAVGTLGGGHSMQVTIDFLPRVTGDHSQQLLLHYHTGEDVYISLYGTSIDVSVRLDRNSVLVEKTYITMANQRRVAILNRSDTIVHYQWKSFATE-----DEEEFCSELQPEEDNEMEQILTEGDTDLTLRDHLFQQRRRQLHQDSLV------FSDQHIIMEPQEGDIWPKQTAEINIIFKPQEARLYQEIVYCDITGREARLPLRIKAEGIGPKLQFNFVELDMKNVFIGSKNCYEVLVSNKGLIDAPYRLVPPSTAMGLCFSFNPAEGMVPPGACHALEVCFSSDN-LGIFSEEFYFMVEGNPQPLSLTFRGCVIGPTFHFSDDQC--------FPQTLTCRLSNTSLVPMSFGMRIPGDGMGKDSVTSSEQVSQFNRNNWRPGDRVAERPQEFKVTPRSGAIRALSHKDIQVTFCSNTVQEYSMSLVVDVEGVGEEVLALPIKARCLVPEVHLERRLLEFQNCFMNYPYQKSVTLINVSDLPAYHVCLCVQEYEENPSLLFSSPQPRGVIEPCSRVEIPLVLQAKALGQLHHTAFFALLGQQGPPLELLLSCIGQGPAISLSATKLHFGNIPVLTDVPRSLRLSNHSPVPACFHAQMAGSRSQWRVEPAEGKVAPDGHVELRLVAHLDDTLPFQDTLQLVIQDSQTQTVDVSATGTGTTIITDRPFAPSLDLGGHFSSRPCQYHFRVTNRGRRLHQLFWSTEGFPQFHRKSLPLKNTSRNGKAKSPLVTPLLDAPVFTLTPIWLKLDPGESADMLLEGFADTPKVVRERLVCLANVEHETAKKRIMTVDITCQFIAPVLDISSQQLSFYVEKVPDMPLVPLYERLLLKSTSTLPLSMELTLAEPFGLCDHTGDNTFATSKIELW----------VRFDPSYQSDLVSRVAEVVLEVQYSGHPKRDYVALRGEVHFPNVHFSSSVLDFGCVLNHTEAQQQITMTNCSPLPVSYHWTFLLDQQ 1125          

HSP 3 Score: 533.487 bits (1373), Expect = 7.396e-151
Identity = 326/928 (35.13%), Postives = 504/928 (54.31%), Query Frame = 3
Query: 4005 LGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKK----------PLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGT--QGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINL------VNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEE 6734
            L   ++FD+ P++G L+P   + +TF++FG+ D+ A V A+C+VE GPTY   L GEAS V Y     + + G  L+D+V+  E+T+ N G+VGF+F++      L       GQP++IPS G +EA++ + + V YL G P  F  +  +QVA F  E I++ G G FPR+ +DLPR+ G            F   +L   D +     +     F +  +++  E L+  +++ A+T +  +            +K   K  LP Y L+FG VI G + +  V++ NTG  P++ +     +   GF   L +VKNLP  E   FE+ FDP  ANL LG + + L + ++GGP V V L A VTMP L  S++V++F+N++ G  +++T+QLHNP  V  EW+    E       ++ K N P  LR+K    +  + P VFEM+P+ G L PG +VNVQ+KF P + ++Y  +LV+ +A S++RI++   G G EP+LEF  S ++ GPVLP+++G E  + +RN C FPIE YSL+FD  YLE+E+ILR + GYD+   LL+PPRA G  LP E ++YY E+  +  +L                                S    K   +++     ++ +LE  PVS+AIAR++G++L+P+G+AAR  RGIAI+V G+P+SGK+  +  LA++Y AA L +D ++ EA++SG + AA +AR+LC              G     L +GT  + G A  K               +H+R T T             SNK+        N Y +          A ++   + P E+++L      ++ +LPD+++IEILSERL LSDC  G+V D LE L+  S S   Q++L + NNR+ +Y I L  ++ + K EE  + E
Sbjct: 1170 LSFSQVFDISPIFGVLRPGESQLVTFSFFGNPDISAEVLALCQVEHGPTYEIILRGEASLVTYALDTTDINLGYQLFDRVSEAEVTIKNTGRVGFDFSALLDDEQLSSENPLPGQPLVIPSKGHIEANTEMRLTVYYLPGIPEVFEKTFLLQVAFFEPEVITLRGEGIFPRVVLDLPRDLGKG----------FVTVILLTMDMTPDLREKILHTVFYDALLQMEVERLL--VKEHAITTEKSQRDTRLSETSISSSKWYKKFVLPEYVLDFGFVIHGSIHTHIVKVTNTGPAPVSFRAKLHLLAGTGFSTELDRVKNLPYCETETFEVKFDPLGANLELGEITTILPIQVLGGPMVQVRLRAVVTMPSLTVSTDVLQFDNIQCGLCQVVTVQLHNPEQVPCEWSFRVEE----QPKKKPKKNVPLRLRQKARFEQLPS-PAVFEMLPSKGVLYPGDRVNVQVKFSPTEGRAYKEKLVVAVAQSTQRILLLAQGHGEEPQLEFSTSLLELGPVLPYSAGEEAEVVVRNLCHFPIEFYSLDFDTQYLEEEKILRMMKGYDAQNMLLLPPRAPGQPLPAELLDYYKEHQSQEPDL-------------------------------LSIILFKEGGTVS-----SVGDLEMDPVSRAIARHVGIDLSPDGQAARNRRGIAIIVHGAPLSGKSSLAVSLAKQYGAACLNIDGVVQEAVSSGVSTAAMQARELC--------------GTATVELTQGTLDERGEAFLK---------------AHHRNTLT-----------KKSNKE------KLNIYTIHFILLAYLQAAQVQ---RRPSESVSLMGEMAAISSLLPDDLLIEILSERLQLSDCHCGVVIDSLETLYCCSPSSVLQIVLKAFNNRKHIYVIDLNNNYHAFKAEERARVE 1995          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001803.1 (pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1 gene:ENSPMAG00000001615.1 transcript:ENSPMAT00000001803.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1723.75 bits (4463), Expect = 0.000e+0
Identity = 977/2770 (35.27%), Postives = 1549/2770 (55.92%), Query Frame = 3
Query: 7257 DPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAH-----PPIKPNQVPVEQHGEN-----------------VNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESP-GVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRA--PNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXD--RKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISDDGLKVQTH-------RWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPK--GANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIK-------SGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENI---LVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAF--WVSTGDQ------NATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLP---------IIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDN--SDIFTPRSS-----RPNTARQGKYETIKKXXXXXXDLNN-PFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGL-TSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILE--FSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVP-GSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQT-KNYELTFKPLTM---TTDGKKH-QGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIP---FTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNV----EAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRG 15305
            DP  E++ L  ++FK ++   K + +++  WDR       PP    +  VE   E                    E       ++  R  +   RS + G  S       P         +     G  ++  G+P+V +EV+   +   E+++ ++L   LP VDEVL+GLGLG  GPPIPPP T S+V +P +R+   P   E       + F+  +E+   ++   +     E +P  K+   + ++   T P+ P K     K  ++++  R    K +  S     G  + A     +     + L  +T        RW++   S++ L + F +++  QFD+  N E+L TRR+YQ++CRG+C FP IS+ PRIVFPHRK++ + NEIVHK+++L  +VFEFGPLL  K ++R   GRYPENME++ I+NSSPMLA + F F +DA    F LDPP+MTLQP++ Q L LWA+P     FED ++CCV ENPEP ++++ C G+ P +EL+ K +HF+++LLHRKD +T+ L+N+T  PV W ++GL+SLGDEFS   D G +   S+  L+AYFRA+KP   N KK IRLEISDVE + GI+ TE +Q++AEAYDVALD++ PK  G++ GLD G ++V +E KQ  T+KN+G YEI + F L+ +     ++S LF++ P +G + P E+   V I +  K EV I ++ IL+C VIEP++   GE IA IP+++SA + YSKY I P  DINFG + V TRKT    IEN G+FDF+++I+       +    + +A     +++  G       QK K N  I       +++R   G FT+FP  G +      +VTV+C  +  G   E L +DI++R+P   P G+ Y LF +A +PSI  N+  +IFEE  +C + T+           G + + E+RF+F   +VG +  A+F++ N   VPCD+   +KP+         + +A +GDIF VEP RA +      Y  V F P AMQ Y   F+ N+EGLPS  + R + L F+VCGEG LP V V +P LR K+   L LF++ LLGR Q+  + L ND  LP ++++D++D   AF   V  G +         E     +K+ H   L +  G     +V   P   G    + ++TV++N Y  T+++L+GEGY D +T +N P           E+S  P     +V  G  +         +  A +   L FGDC+I  P  ++F++ NHS   +VRF WP FD        +  +KFSP VGHLH      V AT  + +P   +   + C+L R+ + +        +WDD   T++W+D  A          + +V+ETE EP  T +    + L L ++A  + C+ +CK   ++F+DT++F+TRIY + ++N G + + + W ++ ++  S+   P+       RP +   G    +      +    + PFS+ P  G +     Q+ ++ F+PL+V  ++A + C I NL   + +P++S+SG  L P+CHFE+ DSDYL  GRR+P + G  G+PPG+ + P+TRVIE++ +G+ T    + F ++NP+ N + + W  ED   P       C    G++EAG+K Q  F+F    + + ESFW+FE+ E G++VPFL+VGQ  EP V+ D+SH    +LL+G +++E V++ N +++ ++F+F++ S H+ G + SL ++PM G I +  ++ I + F  +    +NFNL C+V +K++ L++NVKAEGYS+ +++  E   G    L+  +        N++ +G++E+     R + + N+G F+++F W+++      L   + ++P SG+V   ++ RC L     RP  L+ V   L I  G +++  +      P +   FS +  DFG CF+++ GM   +  L I+N + +D     IS+ECL +       +F+  ++V  G +  + ITF PR+  +Y+  ++F +NG+S+  +++ G   E+K+E  +     +NLG ++VG+   KTV + N +  P+T  L    +   LQ   V  ++P G E+ + P +     +++ F+P  R+  FT EV  E+ GV  PVF++ G CQ  ++  D E + FG V   S  T++L + N GD+GA F W+     PDFS++PA GY + GM++  +++F P     DIRY+ ++CS+EG   L L LTG C    P +E+LNF  PVR +  +++ + N TN  WVL+PV++GEHW+G+++ +VE QQ  + YE+T++PL         K H QGS+F  +PDG G+LY L G AEPP+    ITR+VP +  ++ELL V NWL +PQRF++  E+++PE+ + S  LKG +Y+DVPG  +  YKLT  + KEG    KVTF NE+T EF FY + ++A    S   ++L TPVR+S +  V +EN     +++ +    P+I    Q  V   +K      T E+ PLRV ES  +L + S +  +  +DL+L   P+  E+PL F   +G+     A F N+++ K++++CKI + +FH +K++T AP      E  ++V +EP+ LG+++ LLT+S+   GE+  PLVGV + P+PQGPF ++ GSSVS+ F+NVF + A F   +DS  F +    E ++  +   +V+ F+G+    PV  +L V+CP+         W +YLRG
Sbjct: 2481 DPSDEKKEL-ERRFKAYEQSQKDVQKLLDFWDRTQGTLVLPPTPETEDIVEAEDEKPPPSGKKSKRERERERLERERERVEQREKAERERLEKLRSDEKGEPS-------PAPGSADSDRVAQERPGLRKAALGIPHVALEVTDPREPIAERLLAKEL---LPSVDEVLDGLGLGPSGPPIPPPVTLSVVPFPGKRKGLPPKPIE------RFQFVEAVEETGTDEKDPNGEVEPEPEPCIKVLTSM-VRDIRTSPLHPGKGRGKDKLDSAREKVRSPQRKSATRSPPQPLGRPASAQVDGEMGSTQGEALAAETRGTRLKTFRWVVDAGSQVELHVSFSANDADQFDETLNLEVLGTRRRYQLYCRGVCTFPGISQNPRIVFPHRKKSVQPNEIVHKQFVLSTDVFEFGPLLCGKTRERYKDGRYPENMERLNIQNSSPMLANVTFCFQNDAKATTFLLDPPTMTLQPKQEQTLTLWAYPTSPGCFEDVLVCCVHENPEPAMFRVRCHGMRPELELERKQLHFDKLLLHRKDTRTLTLKNNTLAPVAWHVSGLDSLGDEFSLDADQGIVPPRSQHTLHAYFRALKP--VNIKKMIRLEISDVENIMGIVHTENIQVIAEAYDVALDLTLPKAPGSDGGLDFGVIRVSEEAKQTFTMKNKGKYEISFSFGLEAAAAGVPDVSTLFSVQPQKGSLLPTERHTPVTIMFHGKREVSITEQPILRCQVIEPSVG-HGEAIASIPVKLSACAVYSKYAICPANDINFGPLVVNTRKTCTFTIENRGDFDFKYSIQKLALDPPAAPQRKGMAAKRVKAHETHGLGRLGNKQKLKLNPTISKSCARVTKARLSLGMFTVFPGFGTLLPGGQQIVTVECAPEYAGSTSETLALDISERDPSDHPAGIPYSLFADACIPSIVINDFEAIFEEQHMCRSATLSQVLASAQSGSGAFVEDESRFVFHGTIVGHRATARFKILNCKRVPCDVVFYVKPV-------SSKAAARIGDIFSVEPARACVPSHSHMYAEVSFIPQAMQSYQCTFEANVEGLPSG-VPRPRGLIFDVCGEGTLPHVSVLRPALRCKQGAPLMLFQRLLLGRAQTLPLSLCNDSTLPAQINVDLLDEMGAFKLKVKPGTKCLYPLDKEEEANEEPAKRAHAASLVVRPGESADLEVRCSPGRVGPCRGSARLTVLDNPYAVTMVRLVGEGYSDTVTLDNFPSPPAASPDNTEETSSDPDDVQGTVEDGHGRV-------HVFSAARAEHLNFGDCHIGRPYQLTFTMSNHSTSEAVRFEWP-FD--------LPQLKFSPQVGHLHASCTKDVTATFLAHAPGGPHRHALHCRLWRMVLQERPDSVP--DWDDRLHTVRWVDAIAAAPPKGNMELRGQVVETEREPPHTLLDSVPQELVLTVSAVADLCRPQCKTEPVHFRDTLMFQTRIYQLELENTGLVSLPFSWHVQAEDGRSNQDEPQEHQRTEVRPASRAGGLVNAVLAYGTVDVAQEDLPFSVEPPSGSVPPGATQQLQLRFSPLDVGEFRARLVCSIPNLGGQAAEPSVSVSGCGLMPWCHFEVADSDYLSGGRRNPELPGRLGAPPGSTLPPDTRVIEMHALGVHTGHTCRSFYILNPSSNAYSFSWQSEDP--PGTLTPFTCRTPGGVLEAGRKSQVVFEFAPTQLNLAESFWKFEVAEHGMSVPFLLVGQAREPAVSLDRSHLNLHSLLVGQQAMEVVDLCNIESEAFSFSFREESCHSEGRTASLAVQPMEGTIQANSRIPIQVSFKPSQEGPVNFNLQCRVKRKSHVLTLNVKAEGYSLGASLRAETPQGERSTLSATA-------VNDLALGQVELHSSTYRLLDIDNEGAFDFNFEWELQTTRR-DLRACVTMSPNSGSVQRSQRTRCTLTFQPTRPCVLRDVQLHLKIQNGPTFVCTLNGSGEAPSISVNFSMTTFDFGPCFIHQAGMDPHSTLLRISNGEDRD-----ISLECLFKDAQHLKVDFKPTMLVARGDAIDVPITFYPRRATRYRDDIIFVVNGVSQHTLEVRGEGTEMKIEVANPKWKVVNLGALRVGQTSKKTVPLVNNSRAPLTFSLALQSSQPALQDPKVLILSPSG-EVTLRP-RDGTCAVEVSFSPCARVPAFTAEVCVESAGVRRPVFLLKGCCQGLEMVLDQEQLPFGAVVLRSQATRRLLLHNMGDVGASFSWDVKHLAPDFSVSPARGYAAAGMDVPLDVTFHPRALGSDIRYEGVKCSVEGSPPLLLTLTGSCIDQLPSREVLNFRCPVRSRQTQTISLANRTNQRWVLRPVLKGEHWTGADSVIVEAQQQGRPYEVTYEPLIRQEHQARAKHHTQGSIFFPLPDGLGLLYPLQGIAEPPRPTDTITRDVPCKTTYTELLPVANWLHKPQRFRMTLEMVRPERLDPSTTLKGLDYIDVPGSATHDYKLTFHSHKEGQFTAKVTFCNEATQEFLFYVVTMRATPGGSLGTVELCTPVRRSTEGRVRVENPLPTPVSFSVECRVPDISLPPQISVPPNAKKDEGWLTLEYLPLRVGESSGRLVLQSAELGAFTWDLQLRSLPAAHEKPLHFRASLGASHVQAARFVNYSRQKTEYACKITSGEFHVEKTVTAAPGAAGGTEVSVDVLYEPSHLGDTRALLTLSSPQGGEYTIPLVGVCSAPRPQGPFTVRAGSSVSVPFKNVFAQTASFMAAVDSPAFSVRAAGEAVRPKRTITIVVGFEGAPGAAPVTARLTVSCPQQPAS----SWTFYLRG 5182          

HSP 2 Score: 1523.84 bits (3944), Expect = 0.000e+0
Identity = 855/2340 (36.54%), Postives = 1326/2340 (56.67%), Query Frame = 3
Query:   87 MPIGKFGEVIGTMNTFGEQEI--TYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEI-LRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKA------MRQTGTKN------AIKAP-----ILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNIL-------EVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKS---TQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEM---KLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRN----------------NGIAKESS---NSSDDLFSMRVLFDTDKSFSEYYQ-ETKKEFVEKNIELSEEELMTYLEDLAVTNQ---PKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWT-----TATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHME----------------------LDGAPQKSDKYNEAPEASEIE------------------QLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMED-------GAEKKSLFEGTQGGL---AIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAM----------MKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKK 6743
            MP+G+    I  +  +   ++   + S+VVAP+NPKL+ +     K+TPS+FM +M+L T +KL  T  M LP  I+LLDM  TT+QK + V ++  +FQPFPS + F N +P ETYE+PL LRNND+VPRLVKV+ EDSPYF ++SP +V  KVA G+   F+I FTPEQ++DY   ++ VTEREKF+VP+  IGSRAILDFPD + F   P+K    +TL +RN+G+  ANFS+ T  PFSVEP    L + ESMQ+ V FTP+   D S E+ IHY+TGED+   +HG+  ++ VR++++ V +E T++ +A+ R + L NR D + HF W  +++   E+  +  F   L  EE  E+  F S+  +     D+LSI+TRS+  ++ M K     F  D+ +I+P+EGDIWP++S +ITV FKP EAR YQ  A+C+VTGRETRL L+I G GIGP + F+   LD+G +F+ + H YE+IL NKG+ID +F ++ T S   RCFT  P +G++ P  HQ + I FQS+  +G F +     +DG  E   +   G VIGPTF+FDV  + FG+VS GFP +++ +L NTSLV +EF LRVP DG   P +++     ++ R+  +  QPREFSI PS G L       I V L +N++  Y   LV+DV GVG E+ ++PI+A  +VP+++ S  ELDF R FL+YSY + + + N+SSLP +Y++ L+  ++   + + S     ++ P S+ E+P+ +    +GE +   +  +FGS + P+ + + C+G+GPVV++    + WG + VL++ +  L+LSN+S IPA F     +  S++RV P  G +     + L V   L+D V F D++ + +E  +  IVPL A+G GTTI   PPI+  +NLG HFS +       + N G+R  QL W +E +   ++       R TG          +  P       ++HP R +L+PGES  +++QG+ D P+VV E ++CH+IIG+Q GKE I ++++   FI P+LE S R + F ++K  +++ +   + +   NVS L L   L++ +PF+I+       + +    + + + L   + + +++ F P ++ D+ SR+    L +    HPH D + L+G  +FPNL FD + I+F C+LNH+EV + + M N SPL V + WS L  D   I   R L+   +         DA  +  T   S   +QE  T +  + + T     ++ +      I E+   +  L+SLD      + E      +  V  + E    N   +  +  E ++   G++E+FD+ PLYG L+P   + +T ++FGH+ + A  +A+C V GGPTY   L GEA+ + Y+ S    D+G++L+D+VA  E+TL N G VGF FT    +  + G    +G P + P +GFV A++  ++ V  L G P  F  +  +++AHF  E + + G G FP + +DLPRN                 G   E+S   + S    S+R     +       Q E ++  + ++  L    L T     + T++   P +   K ++++ LP Y L+F +VI+G V +  V+I N G FP++ ++ +  +   GF   L ++KN P  E   FE+ FDPR A+L LG V+  L + ++GGP V + L A VTMPDL  SSE +EF +V+ G+  ++ +QLHN   V  EWT     T++ + D  + +   +         +         P VFE++P +G L PGQ++NVQ+KF P  EK Y  RL + +A SS+R+++   G GLEP+LE   + ++F P+LP ++G    +++RNPC FPIE YSLEFD  YLE+E+ILRH+ GY   G LL+PPR  G+KLP E ++ Y+E L++  E                      LDGA + + +   A +   ++                  Q   S  + +       K   ++    +  + ELE TPV+ A+AR+LG++L+PEG+AA+  RGIAI+V G+P SGKT  + +LA +Y AA LT+D ++++ L+SG+T A  +AR LC DAA R  V + E+            S   G+ GGL   A+ K S  G   M + +  +  R   +  ++ RH  K ++      A+     T  L S PP    P++          + ++  + GE+  L++C+LP+E++I+IL+ERL LSDC +G+V DGLE L++ + +  A ++L +LNNRRF++ + LK+D  S+  E N+Q  LKK
Sbjct:    1 MPLGREQAAISCLQ-YSPSKLPEGFQSRVVAPRNPKLVPREEFPSKVTPSDFMKEMALTTEEKLAGTHEMHLPKIIQLLDMNETTHQKYSLVDIDQAMFQPFPSEITFQNFEPCETYEVPLNLRNNDRVPRLVKVSQEDSPYFKIISPNDVGTKVAPGMASTFRIVFTPEQKKDYTHQVVCVTEREKFMVPVRAIGSRAILDFPDVVAFSQRPVKLRSERTLLVRNVGNRHANFSLQTERPFSVEPVYGALVIGESMQVTVAFTPQTTGDHSAELWIHYDTGEDICVDLHGAAVDVNVRLDKNSVVMERTFISMASQRSVLLSNRMDAIAHFQWRPYATAEEEEQQKLRFCSELSAEEARERNSFLSEYAVEPGLRDRLSILTRSFQQRRHMIKSNPMHFSSDVISIEPLEGDIWPNSSAEITVIFKPQEARVYQHTAYCDVTGRETRLPLRIRGEGIGPCLLFNCDQLDIGNVFMSSQHSYEVILANKGEIDGIFSLDSTLSLFGRCFTLEPFEGIVLPGGHQAIVISFQSQA-IGNFSEDLLFTVDGSSEKIKLTISGRVIGPTFNFDVPSLDFGDVSFGFPGTQQCTLINTSLVAMEFALRVPGDGAGSPSVSSHGKEHMT-RQGLTSRQPREFSITPSSGKLQPQERIVIQVTLCSNTVTLYEGALVVDVKGVGEEVLALPISANCVVPQIDPSEGELDFGRCFLRYSYRRKLLLTNASSLPARYDLQLQSPDEVHGITFGSPSAFGVLEPASQTELPLLVHAQQLGEQSVTANIVVFGSKEPPVRVRLLCMGQGPVVHVTPADVSWGPVSVLDEHTRTLKLSNQSPIPAHFSVKTARANSLWRVVPAKGSVPPEGVVELAVAVRLDDTVAFRDKLHIVVEEGQPCIVPLQAVGIGTTIVARPPITPTVNLGHHFSSSPCQFHLTLTNMGRRAHQLYWMSESFPAPRSNAKKLGHRATGRGGWAHDGTTVGPPPSTRAAFSLHPTRMELAPGESIDVLLQGFSDVPKVVSEQMVCHAIIGKQSGKERIMRMNIRCEFIQPLLELSSRQISFVVEKRPEDTLQPQYEQLKLKNVSSLPLAMNLSLEFPFSIILPEDCPADPSATRAACQALKLGIGEEQEVTVAFEPGYRDDAASRVATGLLTIEHAHHPHRDHVALLGHTHFPNLSFDHTSIDFGCVLNHTEVERRITMVNCSPLPVYFCWSFLQHD--GITPIRCLNMRPKPYSRPLGESDA--RPCTQWHSLAPSQEIHTIRCHIVMLT-----DMNHHDSFKFILELLKERSSLQSLDGDNVNQDEEEVNTRHMEGVNTSAESGVSN---RLTVPDEGKVPSTGLQEVFDILPLYGQLQPGESQAVTVSFFGHAGLRARATALCRVVGGPTYEISLLGEAADMSYQLSTTEVDYGKVLFDRVAEVEITLRNTGSVGFWFTGPGEAQGMEG--LASGVPYISPHTGFVGAATEQIVRVLLLPGVPEPFQHAVALRIAHFEPEVLKVYGEGVFPIVHLDLPRNMDGYERFQAFLKEADKGGAECETSQEEHPSRPGTSLREQQPDESCLCHGMQLELERFIISEHARLQASLLGTQPSPASSTSEHTLPGRQSWKKLSRVRLPEYILDFKHVILGNVRTHIVKISNPGCFPVSFQVERNALAHTGFSAELYRMKNFPPSETETFEVRFDPRGASLGLGPVDVLLNIQVVGGPIVGLRLRAIVTMPDLEASSEELEFGDVQCGQCHIVNVQLHNKQAVTCEWTFTPPDTSSKQADTPVAALLRRK-------VRATAPPPPEPPRVFELLPASGTLTPGQRMNVQVKFTPTQEKRYCKRLALRIAQSSRRVLLVALGRGLEPRLELSATVLEFTPMLPQSTGDTHHVTVRNPCPFPIEFYSLEFDTQYLEEEKILRHVKGYHD-GVLLLPPRLPGEKLPPEILQAYEEKLRKKGEAAADTQLPNGETTWPSTGAAAMLDGATESTSRQTRAHDQISVQWRLHVWQHCERRMKFGHSQPNQSCPSLRTNKIPQRKQREALKGRANGGVGELELTPVAAALARHLGIDLSPEGRAAQNRRGIAIVVHGAPSSGKTSAAVWLARRYGAARLTLDGVVLDCLSSGTTVAGLRARQLCADAAHRKAVREAEEDPSAPSRATPALSTVGGSMGGLSMEAVAKHSAYG---MESGVGGADIRTAPSSISI-RH--KGSTIAGKSRAEAHSVATRQLPSEPPGSQAPSVSMVGAPLQRRLSVSASVAGED-GLLSCVLPEELLIDILAERLQLSDCHRGVVLDGLETLYAATIASAAHVVLKALNNRRFIFLVDLKQDLASL--EANEQATLKK 2306          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000565.1 (pep scaffold:Pmarinus_7.0:GL479095:8203:37245:-1 gene:ENSPMAG00000000501.1 transcript:ENSPMAT00000000565.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 1.292e-12
Identity = 76/310 (24.52%), Postives = 131/310 (42.26%), Query Frame = 3
Query: 1980 PREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYS---IPITATAIVPKVELSCDELDF------SRTFLQYS-------YEKVIKMFNSSSLPIKYEILRQTEKTEDL-LYSSSLDTAIVSPNSELEIPIELKVYTIGELTTK-VHFKIFGS-SKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLN 2852
            P  FS+EP++GVL+     +I   + A   G Y+    +     G  L S   + + A A  P++ +S  + D       S+  L +         EK + + N SS+   +++   T   +   L+   +    V+P     +P+     T+G  TT+ +H  + G+  K  + LT  C  +GP V +    L +  + V E     L+L N S +PAIF   +  + SVF +E   G +  HAT+ L+V       + +   +   +       V L+  G G+T+E  P +      G H  +   N
Sbjct:  102 PPPFSMEPAQGVLSPNASLRITASVHATEAGPYY---AMATCRYGEALSSSSVVELQAIAQYPRLVVSAGDTDTQHRQYDSQQVLNFGNVEAGAISEKWLHIQNLSSVKASFQVEITTPNPQRRNLFGCRIQQGWVNPQGSARVPVRFSPVTVGCCTTQYLHVVMAGNLPKCIVKLTGSC--QGPSVTMSETLLVFDRLLVGEVGVRTLELRNSSAVPAIFQFALDTESSVFGLERVCGELPPHATVQLRVTFTPQQPINYYRRVACLVHQQAPVHVELL--GAGSTVETTPAVLR----GEHVQRCHTN 400          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Nematostella
Match: EDO47363 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RML2])

HSP 1 Score: 212.616 bits (540), Expect = 1.664e-62
Identity = 102/188 (54.26%), Postives = 136/188 (72.34%), Query Frame = 3
Query:  225 PSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSI 788
            PS +M +M L T ++L+ T  M +P  IELLDM   T QK T + +++P+FQPFPS + F N +P++T+E+PL LRN DKV RLVKVT  DSPYF ++SP +V HKVA G+   F IQFTP++++DY   LI +TEREKF+VP+  IG+RAILDFPD+I F   P+K T TKTL +RNIG+  A F +
Sbjct:    1 PSAYMAEMQLTTDERLKLTYEMRVPQIIELLDMSEQTLQKFTTMDIQEPIFQPFPSDIVFQNFEPYQTHEVPLQLRNRDKVARLVKVTQTDSPYFKIISPHDVGHKVAPGMDTTFIIQFTPDEKKDYTHELICITEREKFLVPVKAIGARAILDFPDDINFGGAPVKSTTTKTLLVRNIGNKEARFQL 188          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Nematostella
Match: EDO27261 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9R2])

HSP 1 Score: 179.104 bits (453), Expect = 1.280e-48
Identity = 119/367 (32.43%), Postives = 191/367 (52.04%), Query Frame = 3
Query:  729 TETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDR-ETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVG 1826
            T TKTL +RNIG+  A F +    PF V P +  L + ES+QI V F      D +  + +  +    +   +  +     +    +L++I       AN   I +  R+    H +         ED D    F   L+++E  E++ F  +    L   D+LS+++R Y N+ ++  + K  F DDI T+DP+EGDIWP++  +I + FKP E+ +Y    +C+V+GRE+RL L++ G GIGP+V+FSF TLD+G +F+ + H YE   +N+  I +         P++          LI+ +S  +  I F S   LG F + F   ++G  E   ++ +G VIGPTF F+V K++FG +S G
Sbjct:    1 TTTKTLLVRNIGNKEARFQLLVEEPFFVTPESGRLPIGESLQIHVDFKAMQTGDHNTNMFLTKKKLGAILFSLKLNTINKYISNSYTLINIS------ANHTTICVFARNPPQ-HAWQRYVCVHQDEDPDMVPLFYMDLRMQEGTERDIFLEECLSDLTIRDQLSVISRKYKNQVQVLNDDKLLFDDDIITVDPVEGDIWPNSQAEIEIIFKPQESHSYARTLYCDVSGRESRLPLRVRGEGIGPRVQFSFDTLDIGNVFVNSKHSYECSCLNRSSIRSFL---NPSIPLAMLLVSMLFLLLITRNSLVMPAIHFCSP-ILGDFDELFSFAIEGSPEKLKLNIRGSVIGPTFHFNVPKLRFGTISYG 356          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Nematostella
Match: EDO26992 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAH9])

HSP 1 Score: 100.523 bits (249), Expect = 9.143e-25
Identity = 45/80 (56.25%), Postives = 61/80 (76.25%), Query Frame = 3
Query: 5388 SYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEI 5627
            SYS R+V+ +A S+ R ++  TG G EPK+EF  S I+FGPVLP + G E+ + IRNPC FP+EIYSLEFDK YL++E++
Sbjct:    1 SYSQRVVIRIAQSASRHMINATGQGSEPKVEFSSSLIEFGPVLPHSLGDEQEVVIRNPCRFPVEIYSLEFDKQYLDEEKV 80          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Nematostella
Match: EDO32807 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STZ6])

HSP 1 Score: 68.1662 bits (165), Expect = 1.201e-10
Identity = 79/423 (18.68%), Postives = 155/423 (36.64%), Query Frame = 3
Query: 13755 VKPAPDIRYDNLQCSI--EGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFL---------------------------NESTGEFQ---------------FYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKN----------WAKNKSDFSCKIDNT 14861
            ++ A DIR   ++C++  EG  +L L         +P  + +  +VPV    V +  I N +   W L  ++EGE + G    V +   T +Y L F+P     +G  H     I   D +  +YNL G  E P A+  +  E  +R   +  L+VPN   +    KV+ ++           + G   V V    + ++ +T+   + G  +  ++F+                           N ST +                 +Y ++++A  PP    ++++     ++   + + N T   +  ++      ++      V  + +  +  +F P  + +    +    P     +YDL L  T   P    I    IG     +   +N          +  N  +F  ++D +
Sbjct:  619 LRSAHDIRVYQVECTVSPEG-SSLELEFN------SPTHQSVTQDVPV----VSARNIVNHSKQDWQLTAILEGEGFYGPPVLVAKALTTTHYPLMFRPFY---EGPTHGKLTLINTNDTTEQVYNLRGTGERPLALDNVLIECEARKTITRTLQVPNMTSKKLTLKVMTDLDI---------VSGASTVTVLPSQTAEHVITVSPWRRGEFKGVISFVATHENIASSSRPQDSDSDEDEPPAPNGNSSTRDSSSGGTKSEHHSQPYRIWYSLEVQASAPPPEKTLEVTCAAHSAVSVEIGVSNPTREKVVIEVLHEGMGVYGDPSITVHPRQQAVYRLKFSPTSIGDMSGSVIFQCPSLGEFWYDLALKATAPSPSHVPIMQCEIGKSTYQMVRLQNPTEEALVLTPYISNPRNFRLELDQS 1018          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Nematostella
Match: EDO41855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3B1])

HSP 1 Score: 60.077 bits (144), Expect = 2.405e-8
Identity = 74/336 (22.02%), Postives = 129/336 (38.39%), Query Frame = 3
Query: 13023 SNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNH---------------------TLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVT-FPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQT--VTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKP 13958
            +  VF  N     I  G S TI   F P KP  Y + L+  +      +VDL G+C   +++    P+                      T++ G V +    TK + + N +  PV +         E     VF  +     +    G  +A  I+I ++P+    +  + +   A+G T   +    G C+  ++  D + + F +V  G  I +   ++N   + A F++  D  +  F +    G I  G        F+P KP     Y  L C ++    L + L G C T  V P         P+R++ ++  +I N + G   + P
Sbjct:  452 AQSVFKLNSTCGCIPGGESKTIIAYFTPAKPINYYRQLVCLVQNQDPLFVDLIGTCHTEQVKPGKFPHLIVSRSPGAKAFSENEDRTGQVTVDFGSVPIQTTKTKWIELQNVS--PVNAPFQILQPSYEGNIDTVFTCSHYHGVV----GANSATKIKISYSPHTPSQQSVDYLEVVALGATNCSLIKCKGTCKGPEVCLDTDCLDFTVVESGKQIARTFKVVNNSAVPAAFQFLIDCAQSVFKLNSTCGCIPGGESKTIIAYFTPAKPIN--YYRQLVCLVQNQDPLFVDLIGTCHTEQVKP--------APLRKKHLERFRI-NESRGLTRIPP 770          

HSP 2 Score: 52.373 bits (124), Expect = 5.499e-6
Identity = 35/149 (23.49%), Postives = 63/149 (42.28%), Query Frame = 3
Query: 13407 GKANAIPIQIVFTPNRRISKFTEEVHCEAVGVT-FPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQT 13850
            G  +A  I+I ++P+    +  + +   A+G T   +    G C+  ++  D + + F +V  G  I +   ++N   + A F++  D  +  F +    G I  G        F+P KP     Y  L C ++    L + L G C T
Sbjct:  363 GANSATKIKISYSPHTPSQQSVDYLEVVALGATNCSLIKCKGTCKGPEVCLDTDCLDFTVVESGKQIARTFKVVNNSAVPAAFQFLIDCAQSVFKLNSTCGCIPGGESKTIIAYFTPAKPIN--YYRQLVCLVQNQDPLFVDLIGTCHT 509          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016246.2 (pep primary_assembly:ASM223467v1:6:24744336:24775564:-1 gene:ENSORLG00000012964.2 transcript:ENSORLT00000016246.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 446.047 bits (1146), Expect = 3.491e-136
Identity = 243/634 (38.33%), Postives = 373/634 (58.83%), Query Frame = 3
Query:  219 MTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLT----SKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIG 2108
            +TPS F+  M   T ++L NT  +  P  +E  DM NT +QK + + ME PLFQPFPS + F N  P +TY+LPLIL NNDKV R VK+  ++S  F VV P N   KVA G+ I F + FTP++ +DY+  LI VTERE+F +P+  IG RAILDF DEI+FP   +K    KT  +RNIG++ A F + T  PFSV+P    L+V ES+Q+ V F P    D  +++++HY TGEDV+  + GS +E+ + +E   V ++ TY+GL N+  ++L N SD  + + W+ +  Q  E+ +      +L  EE EE+ +        L   +  S     Y + +    ++    I+  +     +G+IWP+T+   ++ FKP EA+ YQ   +C+VTGRE+ L L ITG G+GP++E S+  +DM  +FI     Y++ + N G I+ALF+     +   RCF+ +P +G++ P + Q V++ FQS   LG F +   + ++G   P  + F+G VIGPTF F+V ++ FG+V+ GFP++   +L NTS VP+ F LRV  DG+    +++       S  + + + +R +P EF+I P+ G + +M+   I V L +N++  Y   LV+DV G
Sbjct:   21 VTPSAFIQNMLQSTEERLNNTTEVNPPRILEWFDMSNTLHQKFSLIHMERPLFQPFPSELVFQNFTPLQTYKLPLILLNNDKVLRHVKLEQQESEDFFVVGPVNSGSKVAPGMSITFTVGFTPKENKDYEGRLICVTERERFEIPVRAIGPRAILDFRDEIFFPICLVKAFTQKTHLLRNIGNSQAKFKLHTQRPFSVKPSFGTLDVGESLQVTVSFHPLTVGDHREDLLLHYHTGEDVFISLCGSCEELDIHLEPECVTLKRTYIGLTNVHTVSLTNSSDTTLQYCWTMWPIQEVEEKN-----SVLLQEEKEEESKGQR-----LFECESSSTAAHHY-SVQSGALQENGTTINCFYIFVVQKGEIWPNTTAQFSIVFKPEEAKIYQHTVYCDVTGRESNLPLTITGEGLGPELELSYSLMDMNNVFIGDKDQYDVQMSNVGFIEALFRFSVPDTTFGRCFSISPVEGVVPPGASQNVKVTFQSSN-LGTFSEDLLLNVNGQPHPHTLTFRGCVIGPTFHFNVFELNFGDVAFGFPATLTCTLFNTSFVPMNFSLRVLGDGSGSQSVSSSSQVSNLSHKNWKGHAARVRPVEFTIIPAAGSVRAMSDVNIKVTLCSNTVKVYRLALVVDVEG 642          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000029260.1 (pep primary_assembly:ASM223467v1:6:24717100:24742635:-1 gene:ENSORLG00000029147.1 transcript:ENSORLT00000029260.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 3.105e-36
Identity = 81/238 (34.03%), Postives = 133/238 (55.88%), Query Frame = 3
Query: 2970 PILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVN--EFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVG-DQPNIIF-HRRLH 3671
            P+ ++ P R +L PG SA +V+    D PQVV+E ++CH IIGRQG +E+I  VDL   F++PVL    + L+F + K          + +   NVS L L+ +L +  PF + + +  + S ++K + L   K   + + FNP    D  SR++ ++L + +  HP  D ++L  EV+FPNL F  + ++F C+ N +E  + + + N S L V Y W+ L   +QP I + + R+H
Sbjct:   82 PMFSLSPSRVELFPGCSADMVLTATSDSPQVVRERLVCHGIIGRQGSQEIIMTVDLTCRFVAPVLSIPTKKLNFFMKKLPLL-----FEKLLLKNVSSLSLSIELKLGEPFFLCDASGEQSSATKKSLVLGDGKQAELWVCFNPSFCQDRQSRVVDEYLDIIYLGHPQQDVVELHAEVHFPNLHFSSTMVDFGCVFNGTETHKVLTVTNCSLLPVSYHWAFLDNHEQPKIRYIYTRIH 314          

HSP 2 Score: 73.9442 bits (180), Expect = 2.364e-12
Identity = 34/102 (33.33%), Postives = 58/102 (56.86%), Query Frame = 3
Query: 4017 EIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSML 4322
            ++FD+ P++G L+P   + +TF++FGH ++   V A C V+ GPTY  +L GEAS +++       DFG ++  +     + +  L  V   FT   +S+ML
Sbjct:  341 QVFDILPMFGDLQPGDEQFVTFSFFGHENISREVVAQCRVKDGPTYEVQLRGEASEIRFSLDSTCLDFGLLVGRRDCHHGVVIDGLQSV---FTHSASSTML 439          

HSP 3 Score: 53.1434 bits (126), Expect = 7.724e-6
Identity = 21/59 (35.59%), Postives = 38/59 (64.41%), Query Frame = 3
Query: 6564 DCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELK 6740
            DC  G+V DGL+ +F+ S S T  ++L +L+NR+ +Y + L   + ++KE E  Q +++
Sbjct:  416 DCHHGVVIDGLQSVFTHSASSTMLVVLKALSNRKHIYVVNLSDSYDAVKERERQQRQVE 474          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Medaka
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:101155890])

HSP 1 Score: 58.151 bits (139), Expect = 1.831e-7
Identity = 58/202 (28.71%), Postives = 87/202 (43.07%), Query Frame = 3
Query:  348 TNVSMEDP-LFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSP--PNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREK-FIVPIHCIGSRAILDFP---DEIYFPPTPLKYTETKTLFIRNIGSAIANFSI-------------------STSGPFSVEPCASVLEVNESMQIDVQFTP 875
            TN+S + P +F   PS + F        YE  L LRN     R ++V   +SP+F +     P+    +A G+   + ++F P+  +DYK  L+V T+ E+  +VPI       IL  P   D  Y     LKY E      +N+G +   F I                   S   PF+V P    LE  ++  I+V F+P
Sbjct:  211 TNLSGDPPPIFIAKPSVVTFTGYKVGHIYETTLELRNVTSSSRHIRVLPPNSPHFSIGLGRFPSEEGTIAPGMSCKYSLRFIPDSLEDYKDFLVVETQAEQVLLVPIEAQRPPPILTLPKVLDCGYCLVGGLKYVE---FLCQNVGQSSGTFCIIPKSQWPFSNLRSLSRTYFSEQPPFAVGPSLFQLEPGDTTVIEVVFSP 409          
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Medaka
Match: DLEC1 (DLEC1 cilia and flagella associated protein [Source:NCBI gene;Acc:101155890])

HSP 1 Score: 56.225 bits (134), Expect = 7.029e-7
Identity = 55/194 (28.35%), Postives = 82/194 (42.27%), Query Frame = 3
Query:  369 PLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSP--PNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREK-FIVPIHCIGSRAILDFP---DEIYFPPTPLKYTETKTLFIRNIGSAIANFSI-------------------STSGPFSVEPCASVLEVNESMQIDVQFTP 875
            P+F   PS + F        YE  L LRN     R ++V   +SP+F +     P+    +A G+   + ++F P+  +DYK  L+V T+ E+  +VPI       IL  P   D  Y     LKY E      +N+G +   F I                   S   PF+V P    LE  ++  I+V F+P
Sbjct:  155 PIFIAKPSVVTFTGYKVGHIYETTLELRNVTSSSRHIRVLPPNSPHFSIGLGRFPSEEGTIAPGMSCKYSLRFIPDSLEDYKDFLVVETQAEQVLLVPIEAQRPPPILTLPKVLDCGYCLVGGLKYVE---FLCQNVGQSSGTFCIIPKSQWPFSNLRSLSRTYFSEQPPFAVGPSLFQLEPGDTTVIEVVFSP 345          
BLAST of Hydin_ADK domain-containing protein vs. Planmine SMEST
Match: SMESG000016228.1 (SMESG000016228.1)

HSP 1 Score: 9907.7 bits (25709), Expect = 0.000e+0
Identity = 5077/5077 (100.00%), Postives = 5077/5077 (100.00%), Query Frame = 3
Query:   87 MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVLKAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNDXXXXXXXXXXXXXEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLXXXXXXXXXXXXXXXIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 15317
            MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINKKKMFKEKKSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHEPIEKPESKEIILDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILRKKRNKAKENAKPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVLKAKQEQEELMWMQEMTEEEYEMLDEETKRKIEEKRTRPRKEKMKQEKEERERERLLLEQEAELQRLTNDKAKPKAGKKPAPAEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLKKKKTKVMDKKSVGKIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTLEDKDDEKGLKDIIERDEDKPFEKIKEDLNIQTPTTKPMRPKKSEVVVKEKNSKDRKSSGKKSNLSNFIRRGSQSGASASSILTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVIAIIPIRISARSFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHGGRSSIGGRGSASVGDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKEEEEEEDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRGPGGSPPGNGINPNTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMVKVGEKVTKTVTIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD
Sbjct:    1 MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINKKKMFKEKKSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHEPIEKPESKEIILDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILRKKRNKAKENAKPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVLKAKQEQEELMWMQEMTEEEYEMLDEETKRKIEEKRTRPRKEKMKQEKEERERERLLLEQEAELQRLTNDKAKPKAGKKPAPAEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLKKKKTKVMDKKSVGKIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTLEDKDDEKGLKDIIERDEDKPFEKIKEDLNIQTPTTKPMRPKKSEVVVKEKNSKDRKSSGKKSNLSNFIRRGSQSGASASSILTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVIAIIPIRISARSFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHGGRSSIGGRGSASVGDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKEEEEEEDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRGPGGSPPGNGINPNTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMVKVGEKVTKTVTIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 5077          
BLAST of Hydin_ADK domain-containing protein vs. Planmine SMEST
Match: SMESG000016228.1 (SMESG000016228.1)

HSP 1 Score: 9890.37 bits (25664), Expect = 0.000e+0
Identity = 5070/5077 (99.86%), Postives = 5070/5077 (99.86%), Query Frame = 3
Query:   87 MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINXXXXXXXXXSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHXXXXXXXXXXXXLDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILXXXXXXXXXXXXPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVLKAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTNDXXXXXXXXXXXXXEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLXXXXXXXXXXXXXXXIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTXXXXXXXXXXXXXXXRDEDKPFEKIKEDLNIQTPTTKPMRPXXXXXXXXXXXXXDRKSSGKKSNLSNFXXXXXXXXXXXXXXLTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVXXXXXXXXXXXXFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHXXXXXXXXXXXXXXXDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKXXXXXXDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRXXXXXXXXXXXXXXTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMXXXXXXXXXXXXIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 15317
            MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINKKKMFKEKKSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHEPIEKPESKEIILDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILRKKRNKAKENAKPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQG       SVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVLKAKQEQEELMWMQEMTEEEYEMLDEETKRKIEEKRTRPRKEKMKQEKEERERERLLLEQEAELQRLTNDKAKPKAGKKPAPAEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLKKKKTKVMDKKSVGKIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTLEDKDDEKGLKDIIERDEDKPFEKIKEDLNIQTPTTKPMRPKKSEVVVKEKNSKDRKSSGKKSNLSNFIRRGSQSGASASSILTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVIAIIPIRISARSFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHGGRSSIGGRGSASVGDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKEEEEEEDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRGPGGSPPGNGINPNTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMVKVGEKVTKTVTIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD
Sbjct:    1 MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEFMFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPFPSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVSHKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILDFPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLEVNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIERSLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLKILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINKKKMFKEKKSRFIDDIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLKITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTGSPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCMEPSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFRLRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMCKINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDELDFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIVSPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVNLDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRSGIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTIEFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAMRQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCHSIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTKTINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQFNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRINFDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHEPIEKPESKEIILDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIALIEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDTENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEVEGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVGFEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGRFTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLFSMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKKPLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPMQQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGGPSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEWTTATSEIDEVLKSREHKSNEPRILRKKRNKAKENAKPLVFEMIPNAGQLRPGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFKESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRHISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYNEAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQAIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAALLTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEGTQG-------SVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDHGADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIEILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITLKKDFKSIKEEENDQEELKKVLKAKQEQEELMWMQEMTEEEYEMLDEETKRKIEEKRTRPRKEKMKQEKEERERERLLLEQEAELQRLTNDKAKPKAGKKPAPAEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTEMSNEADDLKKKKTKVMDKKSVGKIDEISKESQESMDEIMKDPKKEQEWLLHQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNPLKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESPGVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPPPATFSIVQYPIRRRAPNISEMLGENGHYNFMGTLEDKDDEKGLKDIIERDEDKPFEKIKEDLNIQTPTTKPMRPKKSEVVVKEKNSKDRKSSGKKSNLSNFIRRGSQSGASASSILTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDELGQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNEIVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAEINFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICCVKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTALPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKKNIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLKVGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSPGEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVIAIIPIRISARSFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPFQNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPAAGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFVEAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLFTNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHGGRSSIGGRGSASVGDIFEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSKALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFNDGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGSRKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENLPIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINEPKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQAISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMKWIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYCKYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTPRSSRPNTARQGKYETIKKEEEEEEDLNNPFSILPFEGVIKASEKQRFEVSFNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYLISGRRDPTMRGPGGSPPGNGINPNTRVIEINVIGLTSRDMKHFNVVNPTRNDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVTESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETVEIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFTATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELTPCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDDPKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNSYLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDSNQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSLLFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMVKVGEKVTKTVTIANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQIVFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLVTKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVFEISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQLSTPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFTFEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGSCQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPNKLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRNVFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGKLVVTCPEAENGLNNLQWVYYLRGSQKD 5070          
BLAST of Hydin_ADK domain-containing protein vs. Planmine SMEST
Match: SMESG000060264.1 (SMESG000060264.1)

HSP 1 Score: 55.0694 bits (131), Expect = 2.234e-6
Identity = 50/210 (23.81%), Postives = 88/210 (41.90%), Query Frame = 3
Query: 13755 VKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNVPVRQQDVKSLKIGNTTNGTWVLKPVIEG--EHWSGSETFVVEPQQTKNYELTFKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPSRIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGGSKQYKLTIVAQKEG 14378
            +K   D+R   ++C++    NLS +   +     P++E+L  N+P          I N T   W LK  I G    +SG +  + +      Y L FKP+    +GK +         DGS  ++ L G  E P A+  +  E       ++ L++PN  ++   F V        +S+    + G + + +  G S  Y + I  ++ G
Sbjct: 2442 IKGPDDVRLFRIECTVTPEGNLSQIYFKI-----PLQEVLAQNIP----------IVNKTKQDWPLKATITGTSAAFSGPDFIMAKALSVSQYPLQFKPVK---EGKVNAKLTLFNEADGSEHVFELYGEGESPLALESLYFECTVGENITKTLQIPNLTRKKHFFTV--------ESDLDWMIVGDDTISILPGRSCSYDIAINPKRSG 2625          
The following BLAST results are available for this feature:
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HYDIN0.000e+036.24HYDIN axonemal central pair apparatus protein [Sou... [more]
HYDIN0.000e+036.24HYDIN axonemal central pair apparatus protein [Sou... [more]
HYDIN0.000e+041.05HYDIN axonemal central pair apparatus protein [Sou... [more]
HYDIN0.000e+041.05HYDIN axonemal central pair apparatus protein [Sou... [more]
HYDIN0.000e+042.83HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hydin0.000e+036.97HYDIN axonemal central pair apparatus protein [Sou... [more]
hydin3.320e-15740.21HYDIN axonemal central pair apparatus protein [Sou... [more]
BX571975.17.201e-3934.80pep chromosome:GRCz11:CHR_ALT_CTG18_1_23:21320032:... [more]
si:ch1073-349o24.25.724e-722.15si:ch1073-349o24.2 [Source:ZFIN;Acc:ZDB-GENE-08110... [more]
dlec13.262e-623.46DLEC1 cilia and flagella associated protein [Sourc... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
maob7.703e-16737.00monoamine oxidase B [Source:Xenbase;Acc:XB-GENE-94... [more]
DLEC12.723e-1120.07DLEC1, cilia and flagella associated protein [Sour... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Hydin0.000e+035.93HYDIN, axonemal central pair apparatus protein [So... [more]
Dlec13.074e-1225.53deleted in lung and esophageal cancer 1 [Source:MG... [more]
Dlec11.281e-1126.03deleted in lung and esophageal cancer 1 [Source:MG... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4G0P3|HYDIN_HUMAN0.000e+036.24Hydrocephalus-inducing protein homolog OS=Homo sap... [more]
sp|Q80W93|HYDIN_MOUSE0.000e+035.93Hydrocephalus-inducing protein OS=Mus musculus OX=... [more]
sp|Q9Y238|DLEC1_HUMAN5.344e-1222.88Deleted in lung and esophageal cancer protein 1 OS... [more]
sp|A8JFU2|CFA65_CHLRE2.526e-819.81Cilia- and flagella-associated protein 65 (Fragmen... [more]
sp|F1P4W9|CFA65_CHICK1.055e-623.32Cilia- and flagella-associated protein 65 OS=Gallu... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|235106814.360e-11641.93tr|A0A210QFE7|A0A210QFE7_MIZYE Hydrocephalus-induc... [more]
gnl|BL_ORD_ID|203027590.000e+043.25tr|A0A1S3J5T2|A0A1S3J5T2_LINUN hydrocephalus-induc... [more]
gnl|BL_ORD_ID|238423340.000e+042.46tr|V4BQE4|V4BQE4_LOTGI Uncharacterized protein (Fr... [more]
gnl|BL_ORD_ID|250386745.168e-15940.08tr|C3ZBW1|C3ZBW1_BRAFL Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|239155890.000e+041.96tr|K1QL99|K1QL99_CRAGI Hydrocephalus-inducing-like... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hydin7.396e-15136.36HYDIN axonemal central pair apparatus protein [Sou... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000001803.10.000e+035.27pep scaffold:Pmarinus_7.0:GL476330:20174:144478:-1... [more]
ENSPMAT00000000565.11.292e-1224.52pep scaffold:Pmarinus_7.0:GL479095:8203:37245:-1 g... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO473631.664e-6254.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272611.280e-4832.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269929.143e-2556.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328071.201e-1018.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418552.405e-822.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000016246.23.491e-13638.33pep primary_assembly:ASM223467v1:6:24744336:247755... [more]
ENSORLT00000029260.13.105e-3634.03pep primary_assembly:ASM223467v1:6:24717100:247426... [more]
DLEC11.831e-728.71DLEC1 cilia and flagella associated protein [Sourc... [more]
DLEC17.029e-728.35DLEC1 cilia and flagella associated protein [Sourc... [more]
back to top
BLAST of Hydin_ADK domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000016228.10.000e+0100.00SMESG000016228.1[more]
SMESG000016228.10.000e+099.86SMESG000016228.1[more]
SMESG000060264.12.234e-623.81SMESG000060264.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026109 ID=SMED30026109|Name=Hydin_ADK domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=15435bp
ATTTTAATTAAAAAAATATTGTATTTTTTTTAATTGCATCAAAATATTAT
CAACATTTATTCTATTTGCGAATCAACTAATACAAAATGCCTATTGGGAA
ATTCGGTGAAGTCATTGGAACTATGAATACTTTTGGGGAGCAAGAAATCA
CATATGACAGCAAGGTGGTCGCTCCAAAAAATCCAAAACTGTTGCGCCAG
AGAGCACCATACATTAAGATGACCCCCTCCGAATTCATGTTTCAAATGTC
TCTGGACACGAGAAAGAAATTGCAGAACACAAAGACGATGGAATTACCTG
CGAAAATAGAACTGCTGGATATGGGCAACACAACTTATCAAAAGACAACT
AACGTCAGTATGGAAGATCCATTATTTCAACCTTTTCCATCGTCAATGTT
CTTTGTCAATTGTGATCCGCATGAAACGTACGAGTTGCCGCTCATTCTCA
GAAATAACGACAAAGTGCCCAGATTGGTCAAGGTCACCCATGAGGATTCG
CCGTATTTTCATGTGGTCTCCCCGCCGAATGTCAGCCATAAAGTGGCCGC
TGGACTACCTATCGTGTTCAAGATTCAATTCACTCCGGAACAGCGGCAGG
ACTACAAACTCAACCTCATTGTCGTGACGGAGCGTGAGAAATTCATCGTT
CCCATCCATTGCATCGGATCTCGAGCGATTCTTGATTTCCCGGATGAAAT
ATATTTCCCTCCGACTCCTCTGAAATATACCGAAACCAAAACTCTATTTA
TCCGAAATATTGGCAGCGCAATTGCCAATTTCTCAATATCGACTTCAGGG
CCGTTCTCAGTTGAACCGTGTGCATCGGTTTTGGAAGTGAACGAATCAAT
GCAAATAGACGTCCAATTTACCCCAGAGCTTCCGAAGGATTTCTCAGATG
AAATCATTATTCATTACGAAACTGGTGAAGACGTCTACACCCGTATTCAC
GGATCTGGCCAGGAGATCCCAGTGAGAATAGAGCGGTCGCTTGTGCACAT
TGAGGAGACCTACGTCGGATTAGCAAATTTAAGGAAAATTACCCTCCACA
ATCGCAGTGACGTAATGATTCATTTCTATTGGAGTAATTTCTCGAGTCAA
GTTGCCGAAGACCTGGATAGAGAAACGTTTTTGAAGATCCTTCAATTGGA
AGAGGACGAAGAACAGGAAAGATTTAACTCTGACGATAATTTGGGATTGC
TGTCATCTGATAAGCTGTCAATTGTCACTCGCAGTTATATCAACAAAAAG
AAAATGTTTAAAGAAAAGAAATCTAGATTTATTGACGATATTTTCACCAT
TGATCCAATAGAAGGTGACATTTGGCCACACACGAGCCTTGATATAACTG
TGGCGTTCAAGCCCATAGAGGCTAGAACTTACCAATCGTTTGCGTTCTGT
GAAGTAACCGGAAGAGAAACCAGGCTATCCTTAAAGATAACTGGGGTTGG
TATCGGTCCAAAAGTCGAATTCTCATTCAAAACCCTTGATATGGGATACA
TCTTTATCCAAGCTCACCACTGCTATGAAATCATTCTTGTCAACAAAGGC
GACATTGATGCGTTATTTAAAATTGAAGGTACCGGATCTCCAGTTAGTAG
ATGCTTTACATTCACACCGGATGACGGCCTCATCAGTCCTAGTAGCCACC
AAGTCGTCCAAATACAGTTCCAAAGCAAAGAGTTCCTTGGTGCTTTCCAT
CAACCATTCAAAGTGAAAATGGACGGTTGCATGGAACCTTCTATTATTGA
TTTCAAGGGAATAGTCATTGGGCCCACATTTTCATTCGATGTGCAAAAAA
TCAAGTTTGGAGAGGTTTCTGTTGGATTTCCAAGTTCAGAAGAGATTAGT
TTACAAAATACATCACTAGTTCCTTTGGAGTTTCGGTTGAGAGTGCCAAC
CGATGGGACAAGTGATCCAATATTAGCGGCAGATTTAACAAGCAAAGTGT
CACCAAGGGAATACTGTTCCAGACACCAGCCGAGAGAATTCTCTATAGAA
CCTTCAGAAGGTGTGTTGGCCTCAATGACGATGTGCAAGATCAATGTCGT
TCTCACTGCTAACAGCATCGGCAAATATCACACAGGATTGGTTCTCGACG
TGATCGGAGTAGGAAATGAGTTGTATTCCATTCCAATTACCGCAACTGCA
ATCGTTCCGAAAGTGGAATTGTCATGTGATGAATTGGATTTCAGTCGGAC
TTTCCTCCAATACTCTTATGAGAAGGTCATCAAGATGTTCAATTCGTCCA
GTTTGCCGATCAAATACGAGATTCTCAGACAGACAGAGAAGACAGAAGAT
TTGTTGTATTCCAGCTCGTTGGATACGGCAATCGTCAGTCCTAATTCTGA
GCTGGAGATTCCTATTGAACTCAAAGTATACACTATTGGGGAATTGACAA
CAAAGGTTCATTTCAAAATATTCGGATCCTCAAAAGAACCATTAGCCCTT
ACAATAAAATGCATAGGAGAAGGCCCTGTTGTCAATCTGGATTCGGTTTC
CTTAGATTGGGGCACGATAAAAGTGCTGGAAGATAAGTCTTTCAATCTTC
AATTATCCAATGAATCTGAAATTCCGGCCATTTTCCATGCAACCATGATG
AAAGACCAGTCTGTATTCCGAGTGGAGCCCAGATCGGGTATAATGGAGCG
CCACGCAACACTCAATTTGAAGGTCATAGCTAATTTAAATGACTGCGTGA
AATTTACAGACGAAATGCAACTTCACATTGAGAATAGTAAAACAAAGATT
GTGCCACTGATGGCTATTGGATTCGGAACGACGATCGAATTTGATCCGCC
CATTTCTTCAATCATGAATCTTGGATCTCATTTTAGTAAAACTCAACTGA
ATGAGACATATAGAGTGATTAACAGGGGCAAGAGACATCAGCAACTGGTG
TGGTCAAATGAAGGGTATTCCTACACCAAGGCCATGCGCCAGACAGGAAC
AAAAAATGCCATCAAAGCTCCCATACTGACAGTTCATCCTCACAGATTTG
ATTTGAGCCCAGGAGAATCGGCAAGTCTAGTAATCCAAGGTTATGTTGAC
AAGCCGCAAGTTGTCCAGGAGCACATTATGTGCCATTCCATAATTGGCAG
ACAAGGGGGCAAAGAGCTCATTAAAAAGGTAGACTTGGAAGTGAATTTCA
TTTCCCCTGTTTTGGAATTTTCAGATAGATCTCTGCACTTTCGACTCGAC
AAAAGCATAGATAATTCATTCGAAATTCTCACAAAAACCATCAACTTTAC
CAATGTTTCCGGACTGGACCTTAATGCAAAATTAACCGTTCCATATCCAT
TCAATATCCTAGAGGTGAATGAATTCTCTGTATCCGAGAAGCAAATGTTT
CTTCATGGCAATAAGACCGAGACAATTAGCATCCAATTCAATCCGTTACA
CAAATCAGATTCACATAGCAGAATTATTCAAGACTTTTTGAAGGTTTCAT
TCGATGAACATCCTCACGTAGATGAAATCAAACTGATCGGGGAAGTCAAC
TTTCCAAACCTTCAATTTGACAGATCAAGAATCAACTTTGACTGTATTTT
GAATCACTCGGAAGTCAGCCAATTTGTTATGATGCATAATATTTCACCGT
TAGAAGTTCGTTATTCCTGGAGTCTTTTAGTAGGAGACCAACCAAATATA
ATCTTTCATCGTCGGCTCCATGAACCAATCGAAAAGCCGGAAAGTAAAGA
GATCATTTTAGATGCCACGGAAAAAGATACCACGACGGAAAAGTCTACCC
AAGAGTTCGGTACATCGAAGCAAGATCTCAATTTGGATACATTAAGGATT
GGCGAAGAACTCCAATATTCCAAAGACATTGCTTTAATTGAGGAAATGAA
GCTTGATCTTGAATCATTAGACAAAGGGCAAGAACCTCACAATTTAGAAT
CAACAAAGAAACCTTCAATATCAATTGTTCTAAAGACGCATGAGAAATTG
GAAATAAATGAAAAATTAAAAACGTTGCTGGATACTGAAAACGAAATCAT
ACCGTTGGGTATTGAAGAAATCTTTGACGTGAAACCTCTATATGGAACCT
TGAAACCAAATTCTTTCGAGCAAATCACGTTTACCTATTTCGGCCACTCA
GACGTCGAAGCCCATGTAAGTGCCATTTGTGAAGTTGAAGGTGGGCCAAC
ATACCGATTTGAATTACATGGAGAGGCGTCTACAGTGAAGTATAAATTCA
GCGATTTGAATTTCGATTTCGGTCAAATACTCTACGATCAAGTGGCATTC
AAAGAACTGACTCTTAGTAATCTCGGAAAGGTCGGATTTGAATTCACATC
AAAAAAGGCGTCGTCAATGTTACCAGGAAACCAATACCCAACTGGTCAAC
CAATTTTAATACCTTCCTCCGGTTTTGTCGAGGCTTCCAGTCACATTATG
ATAAATGTCGGCTATCTATGTGGATCTCCAGGAAGGTTTACCGATTCCTG
TGATATTCAAGTAGCCCATTTTCCAATGGAAACCATCTCTATATCTGGCC
ATGGTACATTTCCTAGGCTTACTGTCGACCTTCCGAGGAACAACGGTATC
GCAAAGGAATCATCAAACTCCAGCGACGACCTCTTTTCAATGAGAGTACT
TTTTGATACAGATAAATCCTTTTCCGAGTACTATCAAGAAACTAAAAAAG
AATTCGTTGAAAAGAATATCGAACTGTCTGAAGAAGAACTGATGACTTAT
TTAGAGGACCTCGCCGTGACCAATCAACCGAAAAAACCTCTGAACAAAGC
AATAAACAAACTCTTTTTACCCGGCTATCAGTTGGAGTTTGGAAACGTCA
TTATGGGGGGTGTTGTATCTAAGGCTGTACAAATCAAAAATACGGGTCAT
TTTCCTATCAATATGAAGCTTTTAAAAGGCCCAATGCAACAGTTTGGCTT
TTTTATGAACCTACAGCAAGTAAAGAACCTTCCATGCCAAGAAAACTTGG
AATTTGAAATAAATTTTGATCCAAGAGCGGCAAATTTGAATTTAGGAATT
GTTGAAAGTTTCCTCATTTTAAACATCATCGGGGGGCCATCGGTTCCAGT
TATACTAAATGCAAATGTTACCATGCCGGATCTGAGAACGAGTTCAGAAG
TAGTGGAATTTGAAAATGTCAAACTTGGAGAAGCAAAGTTAATCACGATC
CAGTTACACAATCCAACACCGGTACTAACAGAATGGACAACGGCAACCTC
TGAAATAGATGAAGTGCTCAAATCCCGGGAGCATAAGTCTAACGAACCAA
GGATTTTGCGAAAGAAAAGAAATAAAGCAAAGGAAAACGCTAAACCTTTG
GTATTTGAAATGATTCCAAACGCGGGACAGTTGAGACCGGGACAGAAAGT
CAACGTACAAATAAAATTCATGCCCCTTGACGAAAAATCCTATTCTCATC
GGCTTGTTATGATGCTTGCGCACAGCAGTAAACGGATCGTGGTTAAATGC
ACTGGAACTGGACTTGAGCCGAAACTGGAGTTCAAAGAAAGCTATATTCA
GTTTGGACCGGTTTTGCCTTTCACAAGTGGATGTGAAAAAATTATTAGTA
TTAGAAATCCTTGCGATTTCCCAATCGAAATTTACAGTTTGGAATTTGAT
AAATTCTATCTGGAAGACGAAGAAATTTTGCGCCATATCAGTGGCTATGA
CAGCTTCGGCAATTTGCTGATGCCTCCAAGAGCTGCAGGAGACAAATTGC
CTCAGGAGTTCATCGAATATTACGATGAATACCTGAAACGGCACATGGAA
CTTGATGGGGCTCCGCAAAAGTCAGACAAATATAATGAAGCCCCAGAAGC
TTCAGAAATAGAACAGCTAGAAAACAGTATTGCAAATAAAAAGGATGCCT
CACAAACCTTTTCCAAATCTGCAATGTCAATCACAAATTCTGAATCCCCC
GCATTGGATGAATTGGAACAAACCCCAGTATCTCAAGCAATAGCAAGATA
CCTAGGACTTGAGCTCACTCCTGAAGGCAAGGCTGCTCGTCGAAACAGAG
GAATAGCAATCCTAGTCATTGGTAGTCCCATGTCTGGCAAGACAGATACG
TCACAATATCTAGCGGAGAAATATTCCGCTGCTCTTTTAACAGTTGATCA
AATCATCATGGAAGCCCTAGCTAGTGGCTCGACACCTGCAGCAAAAAAGG
CCAGAGATCTATGTTTGGATGCTGCTCGAAGAAGCGAAGTTTTCGACATG
GAAGACGGCGCAGAAAAGAAATCTTTATTTGAAGGGACGCAAGGAGGTTT
GGCCATCTTCAAGCGTTCCGTTGTAGGAATAACCGCAATGCATAACATGA
TGCAAGCGTCACATAACAGAAAGACAAGTACCGTTTCCAATGTCGGCCGC
CATATACCAAAGCAGGCTAGTTCCAATAAGGATCATGGGGCGGATAAGAC
AGATTGCAATACCTATCTTCTTTGCTCAAGTCCGCCTCCATTGGCAGGCC
CCGCAATGATGAAATTGAACATTCAAATACCTGGGGAGAACATTAATCTA
GTGAACTGTATTCTACCCGACGAAGTGATAATAGAGATTCTCAGTGAAAG
ATTAATGCTCAGCGATTGCCAAAAAGGAATCGTATTCGACGGACTAGAAT
GCCTTTTCAGTCAAAGTCAGTCATGCACAGCACAGCTGATTCTCCACTCG
TTGAATAACAGACGATTCTTGTATTTTATTACTCTGAAAAAGGATTTCAA
GTCTATCAAAGAAGAAGAAAACGATCAAGAAGAATTGAAGAAGGTTTTGA
AAGCAAAGCAAGAACAAGAAGAGCTTATGTGGATGCAAGAGATGACGGAA
GAGGAATACGAAATGCTAGACGAAGAAACAAAGCGAAAAATTGAAGAAAA
ACGCACAAGACCTCGAAAAGAGAAAATGAAACAAGAAAAGGAAGAAAGAG
AACGAGAACGTTTGTTACTGGAACAAGAAGCCGAATTGCAAAGACTTACT
AACGACAAAGCAAAACCAAAAGCTGGCAAAAAGCCAGCTCCAGCCGAAGA
CCGTGGGAAATCGAAAGCCGGAAAGGAGACATCAATGGGTAAAAGCACAC
GCGAAAATACAACATTAACCAAGGAGCCCGTCGTAGCTACGATGGACAAA
CACGTTCCAGAACGGCCGGACTCACACATGACAGAGATGTCGAATGAAGC
GGATGACCTAAAGAAAAAGAAAACCAAAGTCATGGACAAAAAGTCAGTGG
GGAAGATCGATGAAATATCAAAAGAATCTCAGGAGTCCATGGACGAAATA
ATGAAAGACCCTAAAAAAGAGCAGGAATGGCTTCTTCATCAAAAATTTAA
GACCTTTGATACGGAATACAAGCAGATCAGTGAAATTGTCTCATTGTGGG
ATCGAGCCCACCCACCAATCAAGCCGAATCAAGTCCCAGTAGAGCAGCAT
GGAGAAAACGTTAATGAAGAAAATTCTACCAATCCTTTGAAACGTGTAGG
TCGGACAACAGTATTCAATAAAAGAAGTAAAGATCATGGAGCTAATTCAG
GCCAAGTTCCACCCCATACCCCTGTCCATGATGAGAATCCAGAACATAAT
ATCGAAACCATCAACAGTGGTCCAGAGGAATCGCCAGGTGTTCCAAATGT
AATTATAGAAGTGTCGAAAAAATCCAAATCTGATCGAGAGAAGATAATTC
AACAAAAATTAGAAACTGAATTACCAAAGGTCGATGAAGTACTAGAAGGT
CTTGGTCTTGGTGACAAAGGTCCTCCTATCCCACCACCAGCAACCTTTAG
TATCGTTCAGTATCCAATTAGAAGACGAGCTCCCAATATATCTGAAATGC
TAGGAGAAAATGGACATTATAACTTTATGGGTACATTAGAGGACAAAGAT
GACGAAAAGGGCTTGAAAGACATAATAGAAAGAGACGAAGATAAACCTTT
TGAAAAAATAAAAGAAGATTTGAATATCCAGACACCAACGACCAAGCCAA
TGCGTCCGAAGAAAAGCGAAGTTGTAGTTAAAGAAAAAAATTCCAAGGAT
AGAAAAAGTTCGGGTAAAAAGTCAAATTTGTCCAATTTTATCAGACGAGG
ATCTCAGTCCGGCGCATCCGCTAGCAGCATCCTTACTCCGATATCTGACG
ATGGACTCAAAGTGCAAACCCACAGATGGATCATTCAGCCAGACTCAGAG
ATCAATCTTCGACTCCGATTCAAATCCGACGAACTGGGCCAATTTGACCA
GCCGTTTAATTTTGAAATTCTCGACACTCGTAGAAAGTACCAAGTGTTTT
GTCGAGGTATTTGTGCTTTCCCGAACATCAGCAAAGAACCAAGAATCGTA
TTTCCACATAGAAAGCGAAACAAAGAGCATAATGAAATCGTACATAAAAA
ATACATTTTAGAAGAGGAAGTTTTTGAGTTTGGCCCTCTGTTAATACAAA
AGGATAAACAAAGAATCATGGCCGGAAGATATCCAGAAAACATGGAACAA
ATTCTAATAAAGAATTCATCTCCAATGCTGGCAGAAATCAACTTCAGCTT
CCTCCATGACGCAAACAATGAGCGGTTCTCATTAGACCCCCCAAGTATGA
CTTTGCAACCGGAAGAATCTCAAAAATTGAATCTGTGGGCTTTCCCAAGA
TTTGCCCAGAAGTTTGAAGATGCAATAATCTGCTGTGTGAAAGAAAACCC
TGAACCCGTAATCTACAAGATTTCCTGTCTCGGAGTGTCACCTTTTGTTG
AACTGGACACTAAGGTCATCCATTTCGAGAGAGTTCTCCTTCACAGGAAA
GATATGAAAACTGTATACTTACGAAATAGTACTGCTCTTCCAGTCCACTG
GAGAATTACCGGACTCGAGAGTCTTGGTGATGAATTCTCATTTGCTCAGG
ACGGGGGAACGATTGACGCTCTTTCCGAGTTTAAATTAAATGCATATTTC
CGTGCAATGAAACCGTATAAGGCGAATACAAAAAAGAATATTCGGCTCGA
AATATCGGACGTAGAGGAGTTGGCGGGAATCTTGCAGACAGAAACTGTGC
AAATACTTGCAGAAGCATATGATGTGGCACTGGATATGAGTTTTCCTAAA
GGAGCAAATAACGGGCTCGACATGGGAACATTGAAGGTTGGCGACGAGAC
CAAGCAAATGATCACCCTAAAAAACCGAGGCCCCTATGAAATTGAATACA
AGTTCGAGTTGGACGGCTCAGAGAATCGAAAGAATAACTTATCTAACCTG
TTTACATTGTGTCCGAGTCAGGGGAAAATGTCGCCTGGAGAAAAAGCTAT
CCAAGTCCAAATAACATATTGTGCCAAGGAGGAAGTAGTGATCAAAGACG
AGCAGATATTGAAGTGCCATGTCATAGAACCGAATATAGCAGACCAAGGA
GAGGTCATAGCAATAATTCCGATCAGAATCTCCGCCAGATCATTTTATAG
CAAGTACCAAATTACGCCAAAAGCTGATATAAACTTTGGATCCGTCACAG
TTCAAACTAGGAAAACCAGGCAAATTATTATTGAAAATATTGGCGAGTTT
GACTTCAGATTTAACATAAAAAGCGGAAAACCTTTTCAAAACCTCGCTGG
ACCTCTTCCAAACTCAAACAAAGAGACTGGCCAAAAAGATTCAATTGCAA
TTCAAAAATCAAAACAAAATGAAAATATCCTTGTCGGAGGGAGCCAAAGC
CGCCAACAATTCGGAAACTTTACCCTGTTTCCGGCGGCCGGGCTGGTTCC
TACAAAGAACTCGGTCATGGTTACCGTGGACTGCATCTCAGATAACCCTG
GCAAATGTGATGAGAATCTCATTATTGACATTACGGACCGGAACCCAAAG
ATCGACCCGAATGGTGTCCTGTATCGTCTGTTCGTCGAGGCGTTTGTGCC
CAGCATTGATTCCAATAATTTGAGCTCAATATTTGAGGAGCATCGAATAT
GTGACACAATCACCGTTATCAATAAAGAACTGCACCAGTTGTGCTCGGGA
GGCATTTATGGGAAATTGGAAAATAGATTCTTATTTACAAATGTTTTGGT
CGGGAGCAAAGTTGAAGCTAAATTCAGACTTGATAACCCAAATAATGTTC
CTTGCGACATAAGTTTGTCATTGAAACCTCTCCATGGAGGTCGGAGTTCT
ATTGGTGGAAGGGGATCAGCTTCTGTCGGAGACATATTTGAAGTAGAACC
AACAAGAGCTCAAATAGAACCGAGGGGATTTACTTATGTTTCTGTTATTT
TCAGCCCCCTTGCTATGCAGCAATATATCGCAATCTTTGATTGTAACATT
GAAGGACTACCCTCAAATAGCCTATACAGAAGCAAAGCTTTATCATTCGA
GGTTTGTGGAGAAGGATATTTACCAAGGGTTGTAGTAACCAAACCAACGT
TGCGTAACAAAAAGAGTCAGTTTCTATGTCTATTCAAAAAGTCTTTATTG
GGGAGACATCAATCACAGAATATAGATCTTTTCAATGACGGATGCTTACC
TTGCCGAGTCCACATTGACATGGTTGATCCTGACTCAGCGTTCTGGGTCA
GTACCGGTGACCAAAATGCCACGGAACCTGGCCCAGTGACAAGTAAACAA
CCTCACGATTTGGTGCTGTCCATGGATGTTGGCTCAAGGAAATCTTTTGA
TGTGCTGTTTAGACCGCGCCTTTCCGGTAAATATATTGCAAACATCAAAA
TTACAGTAGTGAATAATCAGTATGAAGACACAATAATACAACTGATCGGC
GAGGGATATGAAGATTTCATTACATTTGAGAACCTACCAATAATTGAGAG
CAGCATGGTTCCTATTGCTCCAGTTTCCTCTGTTACACAAGGTGGCACGA
AATCAGTTCCTCAGGCACCACCGGAAGAAATCATTGAGGCATGGAAAAAT
AACATTCTTACTTTCGGGGACTGTTACATTAATGAGCCTAAGTCAATTAG
TTTCTCATTAAAAAACCATTCCGAAGATGTCAGTGTACGATTTACATGGC
CAAGCTTTGATTCTTCGACAACTAATCAAGGAAATATCATTCCGGTGAAA
TTCTCTCCGTCGGTTGGCCACCTTCATCCTGGTCAAGCGATCTCAGTCAT
AGCCACGATCCAATCAATCTCCCCAAAAACCTGGAATGAAAAACCCATTC
AATGCAAACTCATCAGGATCAACATGACCGACCTCGAATCCGGAGCGAAA
CCTATAAACTGGGATGACACCAAGAAGACCATGAAATGGATTGATGTTCC
CGCGGACAACTCTATATCATCGGGTGCCGTGCATAAAAAGAAAGTGATCG
AAACCGAAACGGAACCGAAATTCACCGAAGTTCCAGAAACAGCAAGATCA
TTGGACCTGCTTATTACGGCCAACATCAACTACTGCAAATACAAATGCAA
GGTGACCGAGATCAACTTCCAAGATACAATGCTTTTTGAAACACGGATTT
ATGGGATTTCGGTGAAAAATGAAGGTCAGATCAAGATGAAATATCGGTGG
AGTATAAAGCTCGATAACAGTGACATATTTACACCAAGAAGCAGCCGACC
GAATACAGCACGTCAAGGCAAATATGAAACTATCAAGAAGGAGGAAGAGG
AAGAGGAGGATCTCAATAATCCGTTTTCAATCCTTCCATTTGAAGGTGTG
ATAAAGGCCAGTGAAAAACAGAGATTTGAGGTTTCCTTTAACCCTCTAAA
TGTTGACCTCTACAAAGCCACCATGACATGTGAAATTGAAAATCTCGATC
CCGCTTCCAATAAACCTACTATCTCTCTTTCGGGTCGATCCCTGCAGCCA
TATTGTCATTTTGAATTGACTGACTCAGATTATCTGATCAGCGGCAGACG
GGATCCAACTATGCGTGGTCCAGGAGGTTCTCCGCCAGGAAACGGCATCA
ATCCAAACACTAGAGTTATAGAAATCAACGTCATCGGTTTGACCTCCCGA
GATATGAAGCATTTTAACGTAGTCAACCCAACGAGAAACGATTTCGAATA
TTACTGGATCTGTGAGGATTCTGAGCTGCCTAAGAATAAGAAATTGATAC
AATGCTTGGCCACCAACGGAATCGTTGAAGCTGGGAAAAAGGTCCAATGT
GGTTTTCAATTTACTTCCCAATCAGTCGGCGTGACAGAATCATTCTGGCG
ATTCGAAATTCCGGAAATCGGAATCAACGTGCCTTTCCTCATAGTTGGCC
AGTGCACAGAACCAAACGTTACTTTCGATAAATCCCATTTCAAGTTCCCT
GCTCTTCTCATTGGTCATGAATCTGTGGAAACCGTTGAAATCATCAATTT
CGACAACCAGCCGTACAATTTCGCCTTCCAAGATATCAGTCGTCACGCTC
CAGGGCACAGCAACAGTTTGAAAATTGAACCGATGCATGGAATGATCCCG
AGTTGTGGGAAAGTCTCAATCTATATCGGATTTACTGCAACACTTAACCA
GACCCTTAATTTCAACTTAACCTGCCAAGTTGATAAGAAAACTTATCCTT
TGTCCGTTAATGTCAAGGCAGAGGGCTATTCGGTTGACAGCACAGTTTGG
TTTGAGGATACCACTGGTCACAGCGTCGAGTTGACCCCATGTTCCAAGAA
CGGTGATCATGAGGTCTACAACAACATAAATATAGGTCGTATGGAAGTCG
GTGAGCAACAAACGAGATGGATAACGTTAGTGAACGATGGAAGATTCAAT
TACGATTTCAACTGGGACATAAAATGGAAAGATGATCCAAAATTAAACAA
CATGCTTCTATTGACACCGATCTCGGGCACCGTAATTATAGGAGAGAAGC
TAAGATGTGACCTTCATATAATCGCAAACAGACCAACTACCTTGCAAAAG
GTTGTCGCTGTCTTAACTATAGGATATGGCAATAGTTACCTCTTGAACAT
CACTGCCGATATTCATCGGCCGATTTTGGAATTTTCGTTCTCCAAGCATG
ATTTCGGGCATTGCTTTGTATATCGGGTAGGCATGAAACAGTTGACAGCG
GAACTCGTCATAACCAATCGAGACTCAAAAGATTCGAATCAGAAACCCAT
TAGTGTTGAATGTCTCACCGAGTCAAATGATGTCTTTATGCATAATTTCG
AAGCTGCCGTCATTGTTCCTGGCTCATCTTCAACTATCCAAATCACATTT
CTTCCCCGAAAACCAAAAAAATATCAACAGTCTCTTTTGTTTGAAATCAA
CGGTATCTCAAGGAGTTGGGTGGATTTGACTGGATCCTGTGAGGAATTGA
AACTCGAGACCGTCGACCTTCCAAATCATACTCTCAACCTCGGAATGGTG
AAAGTAGGAGAAAAGGTCACCAAGACAGTCACCATTGCCAATACAACTCA
TGTGCCTGTCACATCGAAATTAGTATTTTCACCGACATGTGAGGAGCTGC
AACAACGAGGAGTCTTCAAAATTACCCCCTTAGGCCAGGAAATAGTAATT
AATCCAGGCAAGGCCAACGCCATTCCCATTCAAATAGTCTTTACTCCAAA
TCGGCGAATCTCAAAGTTTACTGAGGAGGTACACTGTGAGGCAGTTGGGG
TAACATTTCCGGTCTTCATGATAACTGGAGGGTGTCAGGCTCATGACATC
CGGTTTGATGTTGAATCCATCTCATTTGGACTAGTTACCAAAGGCAGTCA
CATTACAAAGAAGTTATCAATGATCAATTACGGAGATATTGGAGCCAGAT
TTAAATGGAACACTGACTCTTTTAAACCGGACTTTTCCATAACTCCTGCC
TCGGGTTACATTTCTCAGGGAATGGAACTTGTCTTTGAGATTTCTTTCTC
TCCAGTTAAACCAGCTCCAGATATTCGTTATGATAATTTACAATGTTCAA
TTGAAGGCTGGAAAAACCTTAGCCTAGTATTGACGGGAGTTTGTCAAACT
GTTACTCCTGTAAAGGAAATATTAAATTTTAATGTACCAGTTCGGCAACA
AGACGTGAAATCTCTCAAAATTGGCAACACTACAAATGGGACATGGGTCC
TAAAGCCTGTGATTGAAGGAGAACATTGGAGTGGATCTGAGACATTTGTG
GTGGAACCGCAACAAACTAAAAACTACGAATTAACATTCAAACCCCTTAC
AATGACTACAGATGGCAAAAAGCATCAAGGATCGGTATTTATTGCTATCC
CCGATGGAAGTGGCATTCTTTATAATCTTTCAGGAGGCGCAGAGCCTCCT
AAAGCTATCTCTAAGATAACCAGAGAAGTTCCTTCAAGGATTCCATTCTC
TGAATTGCTAGAAGTTCCTAACTGGTTAAAACGACCTCAGCGATTTAAAG
TGATTAAAGAAGTATTGAAACCAGAGAAAAGTGAATCCTCCTTGCAATTG
AAAGGATTTGAATATGTCGATGTTCCGGGTGGTGGATCTAAGCAATATAA
ATTGACAATTGTTGCACAAAAAGAAGGCTTGATACAAATAAAAGTGACAT
TTTTGAATGAATCCACGGGAGAGTTTCAGTTTTATGAGATACAAATCAAG
GCTTTTAAGCCTCCAAGTACTGCAGTGATCCAACTGTCAACTCCTGTAAG
GCAATCAATCCAGCACTCGGTTATACTGGAGAATGTTACTAGCGCAATGA
TCAACTATCAGATCAGCAGCACCTCTCCAGAGATTCATTGTGCCAATCAA
TTCCAGGTTCAGTCGCAATCAAAGATTCCCTTCACTTTTGAATTCTTTCC
GTTGCGAGTGGCTGAGTCTGTAGCTAAACTTGAGATTTCCTCGCCAGACT
CTAGTAGTATGTTTTATGACCTGGAACTATCTGGTACTCCTTCAAGGCCA
GAGCAACCTCTGATTTTCAACACCGGTATTGGGAGCTGTCAGACATTGTT
GGCTCATTTTAAAAATTGGGCGAAAAATAAATCAGATTTTTCATGCAAAA
TCGATAATACGAAATTCCATTGTGATAAGTCGATAACAGTAGCTCCGAAT
GTCGAGGCACAGCTGGAAGTGCAATTTGAACCAAACAAACTCGGTGAATC
AAAGGGCCTGCTAACAATTTCAAATCAAGTGGCCGGAGAATTTATATTCC
CATTGGTAGGGGTTGCAACTCCCCCTAAGCCACAAGGACCTTTCATCATC
AAGCCTGGATCAAGTGTTTCAATTAGCTTTAGAAATGTTTTTGTAGAAGC
AGCTCAGTTCTATTTCCAAATTGACAGTACTGAATTCCATATAAATAAGA
ATTCCGAAAATATCAAATCGCATAAGGATCACAGAATGGTAATTGCATTT
GATGGGTCAGCAGATGGAGGCCCGGTCATGGGCAAGCTCGTGGTCACATG
TCCTGAAGCAGAAAACGGACTGAACAATTTACAATGGGTTTACTACTTGC
GAGGTTCTCAGAAAGATTAATTTAGATGTTGCGTAGAGAATTGTGTGAAT
AATAATTATCAATGATTAAGTCATTGTTGATGACTTATCTACTTTCGTTC
TGTTATAATTTTATAATAAATCGGTTTTACATTGG
back to top

protein sequence of SMED30026109-orf-1

>SMED30026109-orf-1 ID=SMED30026109-orf-1|Name=SMED30026109-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=5078bp
MPIGKFGEVIGTMNTFGEQEITYDSKVVAPKNPKLLRQRAPYIKMTPSEF
MFQMSLDTRKKLQNTKTMELPAKIELLDMGNTTYQKTTNVSMEDPLFQPF
PSSMFFVNCDPHETYELPLILRNNDKVPRLVKVTHEDSPYFHVVSPPNVS
HKVAAGLPIVFKIQFTPEQRQDYKLNLIVVTEREKFIVPIHCIGSRAILD
FPDEIYFPPTPLKYTETKTLFIRNIGSAIANFSISTSGPFSVEPCASVLE
VNESMQIDVQFTPELPKDFSDEIIIHYETGEDVYTRIHGSGQEIPVRIER
SLVHIEETYVGLANLRKITLHNRSDVMIHFYWSNFSSQVAEDLDRETFLK
ILQLEEDEEQERFNSDDNLGLLSSDKLSIVTRSYINKKKMFKEKKSRFID
DIFTIDPIEGDIWPHTSLDITVAFKPIEARTYQSFAFCEVTGRETRLSLK
ITGVGIGPKVEFSFKTLDMGYIFIQAHHCYEIILVNKGDIDALFKIEGTG
SPVSRCFTFTPDDGLISPSSHQVVQIQFQSKEFLGAFHQPFKVKMDGCME
PSIIDFKGIVIGPTFSFDVQKIKFGEVSVGFPSSEEISLQNTSLVPLEFR
LRVPTDGTSDPILAADLTSKVSPREYCSRHQPREFSIEPSEGVLASMTMC
KINVVLTANSIGKYHTGLVLDVIGVGNELYSIPITATAIVPKVELSCDEL
DFSRTFLQYSYEKVIKMFNSSSLPIKYEILRQTEKTEDLLYSSSLDTAIV
SPNSELEIPIELKVYTIGELTTKVHFKIFGSSKEPLALTIKCIGEGPVVN
LDSVSLDWGTIKVLEDKSFNLQLSNESEIPAIFHATMMKDQSVFRVEPRS
GIMERHATLNLKVIANLNDCVKFTDEMQLHIENSKTKIVPLMAIGFGTTI
EFDPPISSIMNLGSHFSKTQLNETYRVINRGKRHQQLVWSNEGYSYTKAM
RQTGTKNAIKAPILTVHPHRFDLSPGESASLVIQGYVDKPQVVQEHIMCH
SIIGRQGGKELIKKVDLEVNFISPVLEFSDRSLHFRLDKSIDNSFEILTK
TINFTNVSGLDLNAKLTVPYPFNILEVNEFSVSEKQMFLHGNKTETISIQ
FNPLHKSDSHSRIIQDFLKVSFDEHPHVDEIKLIGEVNFPNLQFDRSRIN
FDCILNHSEVSQFVMMHNISPLEVRYSWSLLVGDQPNIIFHRRLHEPIEK
PESKEIILDATEKDTTTEKSTQEFGTSKQDLNLDTLRIGEELQYSKDIAL
IEEMKLDLESLDKGQEPHNLESTKKPSISIVLKTHEKLEINEKLKTLLDT
ENEIIPLGIEEIFDVKPLYGTLKPNSFEQITFTYFGHSDVEAHVSAICEV
EGGPTYRFELHGEASTVKYKFSDLNFDFGQILYDQVAFKELTLSNLGKVG
FEFTSKKASSMLPGNQYPTGQPILIPSSGFVEASSHIMINVGYLCGSPGR
FTDSCDIQVAHFPMETISISGHGTFPRLTVDLPRNNGIAKESSNSSDDLF
SMRVLFDTDKSFSEYYQETKKEFVEKNIELSEEELMTYLEDLAVTNQPKK
PLNKAINKLFLPGYQLEFGNVIMGGVVSKAVQIKNTGHFPINMKLLKGPM
QQFGFFMNLQQVKNLPCQENLEFEINFDPRAANLNLGIVESFLILNIIGG
PSVPVILNANVTMPDLRTSSEVVEFENVKLGEAKLITIQLHNPTPVLTEW
TTATSEIDEVLKSREHKSNEPRILRKKRNKAKENAKPLVFEMIPNAGQLR
PGQKVNVQIKFMPLDEKSYSHRLVMMLAHSSKRIVVKCTGTGLEPKLEFK
ESYIQFGPVLPFTSGCEKIISIRNPCDFPIEIYSLEFDKFYLEDEEILRH
ISGYDSFGNLLMPPRAAGDKLPQEFIEYYDEYLKRHMELDGAPQKSDKYN
EAPEASEIEQLENSIANKKDASQTFSKSAMSITNSESPALDELEQTPVSQ
AIARYLGLELTPEGKAARRNRGIAILVIGSPMSGKTDTSQYLAEKYSAAL
LTVDQIIMEALASGSTPAAKKARDLCLDAARRSEVFDMEDGAEKKSLFEG
TQGGLAIFKRSVVGITAMHNMMQASHNRKTSTVSNVGRHIPKQASSNKDH
GADKTDCNTYLLCSSPPPLAGPAMMKLNIQIPGENINLVNCILPDEVIIE
ILSERLMLSDCQKGIVFDGLECLFSQSQSCTAQLILHSLNNRRFLYFITL
KKDFKSIKEEENDQEELKKVLKAKQEQEELMWMQEMTEEEYEMLDEETKR
KIEEKRTRPRKEKMKQEKEERERERLLLEQEAELQRLTNDKAKPKAGKKP
APAEDRGKSKAGKETSMGKSTRENTTLTKEPVVATMDKHVPERPDSHMTE
MSNEADDLKKKKTKVMDKKSVGKIDEISKESQESMDEIMKDPKKEQEWLL
HQKFKTFDTEYKQISEIVSLWDRAHPPIKPNQVPVEQHGENVNEENSTNP
LKRVGRTTVFNKRSKDHGANSGQVPPHTPVHDENPEHNIETINSGPEESP
GVPNVIIEVSKKSKSDREKIIQQKLETELPKVDEVLEGLGLGDKGPPIPP
PATFSIVQYPIRRRAPNISEMLGENGHYNFMGTLEDKDDEKGLKDIIERD
EDKPFEKIKEDLNIQTPTTKPMRPKKSEVVVKEKNSKDRKSSGKKSNLSN
FIRRGSQSGASASSILTPISDDGLKVQTHRWIIQPDSEINLRLRFKSDEL
GQFDQPFNFEILDTRRKYQVFCRGICAFPNISKEPRIVFPHRKRNKEHNE
IVHKKYILEEEVFEFGPLLIQKDKQRIMAGRYPENMEQILIKNSSPMLAE
INFSFLHDANNERFSLDPPSMTLQPEESQKLNLWAFPRFAQKFEDAIICC
VKENPEPVIYKISCLGVSPFVELDTKVIHFERVLLHRKDMKTVYLRNSTA
LPVHWRITGLESLGDEFSFAQDGGTIDALSEFKLNAYFRAMKPYKANTKK
NIRLEISDVEELAGILQTETVQILAEAYDVALDMSFPKGANNGLDMGTLK
VGDETKQMITLKNRGPYEIEYKFELDGSENRKNNLSNLFTLCPSQGKMSP
GEKAIQVQITYCAKEEVVIKDEQILKCHVIEPNIADQGEVIAIIPIRISA
RSFYSKYQITPKADINFGSVTVQTRKTRQIIIENIGEFDFRFNIKSGKPF
QNLAGPLPNSNKETGQKDSIAIQKSKQNENILVGGSQSRQQFGNFTLFPA
AGLVPTKNSVMVTVDCISDNPGKCDENLIIDITDRNPKIDPNGVLYRLFV
EAFVPSIDSNNLSSIFEEHRICDTITVINKELHQLCSGGIYGKLENRFLF
TNVLVGSKVEAKFRLDNPNNVPCDISLSLKPLHGGRSSIGGRGSASVGDI
FEVEPTRAQIEPRGFTYVSVIFSPLAMQQYIAIFDCNIEGLPSNSLYRSK
ALSFEVCGEGYLPRVVVTKPTLRNKKSQFLCLFKKSLLGRHQSQNIDLFN
DGCLPCRVHIDMVDPDSAFWVSTGDQNATEPGPVTSKQPHDLVLSMDVGS
RKSFDVLFRPRLSGKYIANIKITVVNNQYEDTIIQLIGEGYEDFITFENL
PIIESSMVPIAPVSSVTQGGTKSVPQAPPEEIIEAWKNNILTFGDCYINE
PKSISFSLKNHSEDVSVRFTWPSFDSSTTNQGNIIPVKFSPSVGHLHPGQ
AISVIATIQSISPKTWNEKPIQCKLIRINMTDLESGAKPINWDDTKKTMK
WIDVPADNSISSGAVHKKKVIETETEPKFTEVPETARSLDLLITANINYC
KYKCKVTEINFQDTMLFETRIYGISVKNEGQIKMKYRWSIKLDNSDIFTP
RSSRPNTARQGKYETIKKEEEEEEDLNNPFSILPFEGVIKASEKQRFEVS
FNPLNVDLYKATMTCEIENLDPASNKPTISLSGRSLQPYCHFELTDSDYL
ISGRRDPTMRGPGGSPPGNGINPNTRVIEINVIGLTSRDMKHFNVVNPTR
NDFEYYWICEDSELPKNKKLIQCLATNGIVEAGKKVQCGFQFTSQSVGVT
ESFWRFEIPEIGINVPFLIVGQCTEPNVTFDKSHFKFPALLIGHESVETV
EIINFDNQPYNFAFQDISRHAPGHSNSLKIEPMHGMIPSCGKVSIYIGFT
ATLNQTLNFNLTCQVDKKTYPLSVNVKAEGYSVDSTVWFEDTTGHSVELT
PCSKNGDHEVYNNINIGRMEVGEQQTRWITLVNDGRFNYDFNWDIKWKDD
PKLNNMLLLTPISGTVIIGEKLRCDLHIIANRPTTLQKVVAVLTIGYGNS
YLLNITADIHRPILEFSFSKHDFGHCFVYRVGMKQLTAELVITNRDSKDS
NQKPISVECLTESNDVFMHNFEAAVIVPGSSSTIQITFLPRKPKKYQQSL
LFEINGISRSWVDLTGSCEELKLETVDLPNHTLNLGMVKVGEKVTKTVTI
ANTTHVPVTSKLVFSPTCEELQQRGVFKITPLGQEIVINPGKANAIPIQI
VFTPNRRISKFTEEVHCEAVGVTFPVFMITGGCQAHDIRFDVESISFGLV
TKGSHITKKLSMINYGDIGARFKWNTDSFKPDFSITPASGYISQGMELVF
EISFSPVKPAPDIRYDNLQCSIEGWKNLSLVLTGVCQTVTPVKEILNFNV
PVRQQDVKSLKIGNTTNGTWVLKPVIEGEHWSGSETFVVEPQQTKNYELT
FKPLTMTTDGKKHQGSVFIAIPDGSGILYNLSGGAEPPKAISKITREVPS
RIPFSELLEVPNWLKRPQRFKVIKEVLKPEKSESSLQLKGFEYVDVPGGG
SKQYKLTIVAQKEGLIQIKVTFLNESTGEFQFYEIQIKAFKPPSTAVIQL
STPVRQSIQHSVILENVTSAMINYQISSTSPEIHCANQFQVQSQSKIPFT
FEFFPLRVAESVAKLEISSPDSSSMFYDLELSGTPSRPEQPLIFNTGIGS
CQTLLAHFKNWAKNKSDFSCKIDNTKFHCDKSITVAPNVEAQLEVQFEPN
KLGESKGLLTISNQVAGEFIFPLVGVATPPKPQGPFIIKPGSSVSISFRN
VFVEAAQFYFQIDSTEFHINKNSENIKSHKDHRMVIAFDGSADGGPVMGK
LVVTCPEAENGLNNLQWVYYLRGSQKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005179hormone activity
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0003341cilium movement
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR013783Ig-like_fold
IPR033768Hydin_ADK
IPR033305Hydin-like
IPR027417P-loop_NTPase
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1521..1541
NoneNo IPR availableCOILSCoilCoilcoord: 2261..2290
NoneNo IPR availableCOILSCoilCoilcoord: 2348..2368
NoneNo IPR availableCOILSCoilCoilcoord: 2207..2230
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2432..2484
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2607..2655
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2285..2390
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2436..2455
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2335..2390
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2510..2528
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2509..2528
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2285..2317
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2255..2274
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2625..2644
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 2752..2866
e-value: 5.6E-8
score: 34.9
coord: 457..561
e-value: 1.3E-21
score: 78.8
coord: 4374..4482
e-value: 5.0E-9
score: 38.2
coord: 2989..3092
e-value: 2.8E-9
score: 39.0
coord: 4261..4369
e-value: 2.6E-9
score: 39.2
coord: 3295..3409
e-value: 2.5E-9
score: 39.2
coord: 2867..2968
e-value: 1.4E-9
score: 40.1
coord: 4483..4602
e-value: 6.9E-11
score: 44.2
coord: 795..896
e-value: 1.5E-11
score: 46.4
coord: 4021..4131
e-value: 4.0E-13
score: 51.4
coord: 689..794
e-value: 1.1E-12
score: 50.0
coord: 3585..3683
e-value: 6.7E-8
score: 34.6
coord: 4160..4260
e-value: 2.2E-5
score: 26.5
coord: 1658..1795
e-value: 1.1E-12
score: 50.0
coord: 562..688
e-value: 2.1E-18
score: 68.4
coord: 1365..1476
e-value: 3.2E-7
score: 32.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 97..194
e-value: 1.1E-5
score: 27.7
coord: 195..292
e-value: 2.9E-24
score: 87.3
IPR033768Hydin adenylate kinase-like domainPFAMPF17213Hydin_ADKcoord: 1974..2170
e-value: 1.3E-44
score: 152.8
IPR033305Hydrocephalus-inducing-likePANTHERPTHR23053DLEC1 DELETED IN LUNG AND ESOPHAGEAL CANCER 1coord: 53..4987