GCR014

Overview
NameGCR014
Smed IDSMED30026106
Length (bp)1524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of GCR014 (SMED30026106) t-SNE clustered cells

Violin plots show distribution of expression levels for GCR014 (SMED30026106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of GCR014 (SMED30026106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for GCR014 (SMED30026106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30026106SMESG000031038.1 SmedASXL_007663SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30026106SMESG000031038.1 dd_Smed_v6_46101_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of GCR014 vs. Ensembl Human
Match: DRD2 (dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:3023])

HSP 1 Score: 154.451 bits (389), Expect = 3.082e-41
Identity = 113/409 (27.63%), Postives = 195/409 (47.68%), Query Frame = 2
Query:  161 VIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSS-SHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR-----------AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            V GN+++ + +S  + L+TT N LI +LA++D+L+A  V+P  +  +  G W F    C+I++  DV+ CTAS+ +L  I+ DRYTA   P+ Y +  S  RR    I +VW LS  I  P + G                    N++ Q +C + N P +V+YS++ SF +P I+   VYI+I+ ++ +++         NT  +  ++       LK     + +   E   ++S P+   +T  S +                     +  LP  P      ST +S   P ++            ++ +   N   R           ++++E +AT+++ +++ +FI+CW+PF I +++   C  +I PV   L    TW GY NS++NPI+YT  N EFR +F
Sbjct:   49 VFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISIVWVLSFTISCPLLFGL-------------------NNADQNECIIAN-PAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRV------NTKRSSRAFRAHLRAPLKEAARRAQELEMEMLSSTSPPE---RTRYSPIPPSHH----------------QLTLPD-PSHHGLHSTPDSPAKPEKNGHAKDHPKIAKIFEIQTMPNGKTRTSLKTMSRRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPV---LYSAFTWLGYVNSAVNPIIYTTFNIEFRKAF 408          
BLAST of GCR014 vs. Ensembl Human
Match: ADRA2A (adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC:281])

HSP 1 Score: 153.68 bits (387), Expect = 1.472e-40
Identity = 116/425 (27.29%), Postives = 192/425 (45.18%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTH-----------TETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEK---------RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
             ++ L TV GN+++II +  +R L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C I+L  DVL+CT+S+  L  I+ DRY +    I Y      RR K  II VW +S++I  P +I           I+          +   +C++ ++ +YVI S +GSF  P +IM  VY+RI+ I  ++  +     ++   D  ++   P  T  +P  +   ++            T+ +    +P  +    T  L    SS S    +                    K     S++ P +   R    +              V A K         RE R T ++ +++ +F++CW PF   Y + A+     C V R L     WFGY NSS+NP++YTI N +FR +F+
Sbjct:   56 GLLMLLTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIITVWVISAVISFPPLIS----------IEKKGGGGGPQPAEP-RCEINDQKWYVISSCIGSFFAPCLIMILVYVRIYQIAKRRTRV---PPSRRGPDAVAA--PPGGTERRPNGLGPERSAGPGGAEAEPLPTQLNGAPGEPAPAGPRDTDALDLEESSSSDHAERPPGPRRPERGPR-------GKGKARASQVKPGDSLPRRGPGATGIGTPAAGPGEERVGAAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAVG----CSVPRTLFKFFFWFGYCNSSLNPVIYTIFNHDFRRAFK 453          
BLAST of GCR014 vs. Ensembl Human
Match: HTR1A (5-hydroxytryptamine receptor 1A [Source:HGNC Symbol;Acc:HGNC:5286])

HSP 1 Score: 151.369 bits (381), Expect = 4.277e-40
Identity = 114/424 (26.89%), Postives = 184/424 (43.40%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQK-KNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFL--------LPQ----TPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            I S++   +    V+GN  ++  I+  R L+  AN LIG+LA++D++++  VLP+A +      W  G   C++++  DVL CT+S+  L  IA DRY A   PI Y +    RR    I + W +  +I IP ++GW     + P          ++ S    C +  +  Y IYS  G+F +PL++M  +Y RIF     + +    K +    D    +   P             K     +  S +    V++          ++ +      L  I V  +        LP     TP         N     N ++KR                     A  RE +  K + +IM  FILCW+PF I+ +V   C ES C +   L  I+ W GY+NS +NP++Y   N++F+N+F+
Sbjct:   38 ITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGW-----RTP----------EDRSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADTRHGASPAPQP-----------KKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGNSKEHLPLPSEAGPTPCAPASFERKNER---NAEAKRKM-------------------ALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFC-ESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFK 412          
BLAST of GCR014 vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 138.658 bits (348), Expect = 1.154e-35
Identity = 112/408 (27.45%), Postives = 188/408 (46.08%), Query Frame = 2
Query:  146 ITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGH-WPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYR---SSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ--KKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            + L  V GN ++ + +   R L+TT N L+ +LA++D+L+A  V+P  +  +  G  W F    C++++  DV+ CTAS+ +L  I+ DRYTA   P+ Y+     S  RR    I  VW L+  +  P + G+  +G  +P +   SN                 P +VIYS++ SF LP  +   VY RI+ ++ Q  +K + ++   QN+  N      P  TL        +K +    ++++      Q    ELK    + +          I+ +  L    L   +LST + +L P +                            RE +AT+++ +++  FI+CW+PF + +++   C    C V   L    TW GY NS++NP++YT  N EFR +F
Sbjct:   39 LILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTG--DPTVCSISN-----------------PDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTR---QNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPT-----IAPKLSLEVRKLSNGRLST-SLKLGPLQPRG----------------------VPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQT--CHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAF 394          
BLAST of GCR014 vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 138.658 bits (348), Expect = 1.154e-35
Identity = 112/408 (27.45%), Postives = 188/408 (46.08%), Query Frame = 2
Query:  146 ITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGH-WPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYR---SSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ--KKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            + L  V GN ++ + +   R L+TT N L+ +LA++D+L+A  V+P  +  +  G  W F    C++++  DV+ CTAS+ +L  I+ DRYTA   P+ Y+     S  RR    I  VW L+  +  P + G+  +G  +P +   SN                 P +VIYS++ SF LP  +   VY RI+ ++ Q  +K + ++   QN+  N      P  TL        +K +    ++++      Q    ELK    + +          I+ +  L    L   +LST + +L P +                            RE +AT+++ +++  FI+CW+PF + +++   C    C V   L    TW GY NS++NP++YT  N EFR +F
Sbjct:   39 LILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTG--DPTVCSISN-----------------PDFVIYSSVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTR---QNSQCNSVRPGFPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLSPT-----IAPKLSLEVRKLSNGRLST-SLKLGPLQPRG----------------------VPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQT--CHVSPELYSATTWLGYVNSALNPVIYTTFNIEFRKAF 394          
BLAST of GCR014 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 154.836 bits (390), Expect = 1.661e-41
Identity = 121/419 (28.88%), Postives = 191/419 (45.58%), Query Frame = 2
Query:  101 IPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCG-HWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            IP   L + +I   +I   TV+GN ++++ +   R L+   N  + +LA SD+ +A  V+PL +V    G  W  GV +C  +   D+L CT+S+ +L  IA DRY A   PI Y      +     I++VW LS +I +P IIGW           +  N+  D+      C L  E  +V++SA GSF LPL++M  VY++IF    Q+              N    +      +K   + S +T +   E +       QT  + L A ++        +  +               MK   N S     +D K        +   ++R   S+     +E RA K + +I+ +F  CW+PF + Y++R  C    C ++  ++   TW GY NSS+NP LY ILN EFR +F+
Sbjct:   52 IPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNN---------WQENMMEDS------CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRVGEKTPLVIADGQTTVTTLAAHSTDGGSLPKDETTK--------------HMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVA----KEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET--CKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFK 435          
BLAST of GCR014 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 154.066 bits (388), Expect = 1.938e-41
Identity = 120/419 (28.64%), Postives = 186/419 (44.39%), Query Frame = 2
Query:  101 IPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCG-HWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            IP   L + +I   +I   TV+GN ++++ +   R L+   N  + +LA SD+ +A  V+PL +V    G  W  GV +C  +   D+L CT+S+ +L  IA DRY A   PI Y      +     I++VW LS +I +P IIGW           +  N+  D+      C L  E  +V++SA GSF LPL++M  VY++IF    Q+              N    +      +K   + S +T + TD  S   D + +                                      MK   N S     +D K        +   ++R   S+     +E RA K + +I+ +F  CW+PF + Y++R  C    C ++  ++   TW GY NSS+NP LY ILN EFR +F+
Sbjct:   41 IPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNN---------WQENMMEDS------CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTK-------------------------------------HMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVA----KEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET--CKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFK 401          
BLAST of GCR014 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 154.066 bits (388), Expect = 2.008e-41
Identity = 120/419 (28.64%), Postives = 186/419 (44.39%), Query Frame = 2
Query:  101 IPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCG-HWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            IP   L + +I   +I   TV+GN ++++ +   R L+   N  + +LA SD+ +A  V+PL +V    G  W  GV +C  +   D+L CT+S+ +L  IA DRY A   PI Y      +     I++VW LS +I +P IIGW           +  N+  D+      C L  E  +V++SA GSF LPL++M  VY++IF    Q+              N    +      +K   + S +T + TD  S   D + +                                      MK   N S     +D K        +   ++R   S+     +E RA K + +I+ +F  CW+PF + Y++R  C    C ++  ++   TW GY NSS+NP LY ILN EFR +F+
Sbjct:   52 IPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNN---------WQENMMEDS------CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTK-------------------------------------HMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVA----KEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET--CKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFK 412          
BLAST of GCR014 vs. Ensembl Celegans
Match: ser-2 (Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-Prot;Acc:O02213])

HSP 1 Score: 154.066 bits (388), Expect = 2.300e-41
Identity = 120/419 (28.64%), Postives = 186/419 (44.39%), Query Frame = 2
Query:  101 IPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCG-HWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            IP   L + +I   +I   TV+GN ++++ +   R L+   N  + +LA SD+ +A  V+PL +V    G  W  GV +C  +   D+L CT+S+ +L  IA DRY A   PI Y      +     I++VW LS +I +P IIGW           +  N+  D+      C L  E  +V++SA GSF LPL++M  VY++IF    Q+              N    +      +K   + S +T + TD  S   D + +                                      MK   N S     +D K        +   ++R   S+     +E RA K + +I+ +F  CW+PF + Y++R  C    C ++  ++   TW GY NSS+NP LY ILN EFR +F+
Sbjct:   49 IPTVELVLGTITYLVIIAMTVVGNTLVVVAVFSYRPLKKVQNYFLVSLAASDLAVAIFVMPLHVVTFLAGGKWLLGVTVCQFFTTADILLCTSSILNLCAIALDRYWAIHNPINYAQKRTTKFVCIVIVIVWILSMLISVPPIIGWNN---------WQENMMEDS------CGLSTEKAFVVFSAAGSFFLPLLVMVVVYVKIFISARQRIRTNRGRSALMRIQNAEGDDDYRKMSIKRASVESARTSSRTDGGSLPKDETTK-------------------------------------HMKYHNNGSCKVKVKDVKEDEGNPNPTAVLRKREKISVA----KEKRAAKTIAVIIFVFSFCWLPFFVAYVIRPFCET--CKLHAKVEQAFTWLGYINSSLNPFLYGILNLEFRRAFK 409          
BLAST of GCR014 vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 152.91 bits (385), Expect = 2.910e-41
Identity = 123/415 (29.64%), Postives = 207/415 (49.88%), Query Frame = 2
Query:  134 IPSMIT--LWTVIGNLXXXXXXSHNRFLRTT-ANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI-INQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNN-----SELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            I SM+T  L  + GNL++++T+  +R LR    N LI +LA++DML+   V+PL +  +  G W  G  +C IWL  DVL+ TAS+  +  I+ DRY +   P+ Y ++    R   YI V W +S +IC+P I GW                       + +C +  +  YV+YS++GSF +P++I+  VY +I++I I   +    +++ ++   N  +    T      ++        E +EN SDP         + K + +     K    LR IS E  LP+  + ++ L TN+     S+L    + K+F +K  R             + + +E +AT ++ +I+  FIL W+PF ++Y++ A   E+   V+++      W GY NS INP++YT+ NREF+   
Sbjct:   25 ISSMLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPLRMFIYIGVSWIVSLLICLPPIFGWRP------------------ERAEGECSVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEY--------ELEEN-SDP-----IEDEKEKVVTNRDMINKVCWQLRKISEE--LPRQGV-KIALDTNHNSPPASDLTRKLEEKKFCEKRKR-------------KLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFGHEAPPLVFKFF----FWLGYCNSGINPVIYTVFNREFKRGL 387          
BLAST of GCR014 vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343171)

HSP 1 Score: 139.428 bits (350), Expect = 8.857e-35
Identity = 117/452 (25.88%), Postives = 216/452 (47.79%), Query Frame = 2
Query:  110 WALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ--------KKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSM------------KTHTETDENSSDP---DCSVQTHTSELXXXXXXXXXXXXXQGLRCIS-VEFLLPQTPLWEMKLSTNNS-----------ELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCS--ESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            WAL +      +  + T+ GN+++I+++   R L+T  N  I +LA++D+L+A  V+P A+     G W     +C+ ++  DV+  T+S+++LV I+ DRY A   PI Y    + RR    I++VW++S+ I  P ++G   +  + P +                C  +N   +++YS++ SF +P IIM  +Y  IF  +          +K   S+    +  +N +   +   T L     +S              ++ E DEN+  P   DC V  +    + + +++ ++     ++ +S V + + +     M L+ N+S           +   N  + RFT        KK+R  +S     K+E +ATK + +++ +F+ CW+PF    ++ A+C+  +  C       ++ TW GY NS +NP++YTI N EFR +F+
Sbjct:  378 WALILI-----LFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVLGLNNTPNREPDV----------------CAFYNAD-FILYSSLSSFYIPCIIMVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETALDSSRHASRILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDKSTEFMLATVVEETGNVAMKPLSFVRYGVQEA----MTLARNDSTLSTTSKTSSRKDKKNSQASRFTIYKVHKASKKKREKSS----AKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMMTTWLGYINSFVNPVIYTIFNPEFRKAFK 799          
BLAST of GCR014 vs. Ensembl Fly
Match: Dop2R (gene:FBgn0053517 transcript:FBtr0343167)

HSP 1 Score: 137.502 bits (345), Expect = 3.571e-34
Identity = 114/440 (25.91%), Postives = 200/440 (45.45%), Query Frame = 2
Query:  110 WALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ--------KKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSM------------KTHTETDENSSDP---DCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCS--ESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            WAL +      +  + T+ GN+++I+++   R L+T  N  I +LA++D+L+A  V+P A+     G W     +C+ ++  DV+  T+S+++LV I+ DRY A   PI Y    + RR    I++VW++S+ I  P ++G   +  + P +                C  +N   +++YS++ SF +P IIM  +Y  IF  +          +K   S+    +  +N +   +   T L     +S              ++ E DEN+  P   DC V  +                       S EF+L                    E++ +FT        KK+R  +S     K+E +ATK + +++ +F+ CW+PF    ++ A+C+  +  C       ++ TW GY NS +NP++YTI N EFR +F+
Sbjct:  378 WALILI-----LFPILTLFGNILVILSVCRERSLQTVTNYFIVSLAIADLLVAVVVMPFAVYFLVNGAWALPDVVCDFYIAMDVICSTSSIFNLVAISIDRYIAVTQPIKYAKHKNSRRVCLTILLVWAISAAIGSPIVLGLNNTPNREPDV----------------CAFYNAD-FILYSSLSSFYIPCIIMVFLYWNIFKALRSRARKQRAARKPHLSELTGGSVIENIAQTRRLAETALDSSRHASRILPDEAATNTASGSNEEEDENAISPDIDDCHVIVNDK---------------------STEFMLATVV----------------EETGKFTIYKVHKASKKKREKSS----AKKERKATKTLAIVLGVFLFCWLPFFSCNIMDAMCAKFKKDCRPGLTAYMMTTWLGYINSFVNPVIYTIFNPEFRKAFK 754          
BLAST of GCR014 vs. Ensembl Fly
Match: Oct-TyrR (gene:FBgn0004514 transcript:FBtr0078479)

HSP 1 Score: 133.265 bits (334), Expect = 4.824e-33
Identity = 78/205 (38.05%), Postives = 116/205 (56.59%), Query Frame = 2
Query:   98 SIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIF 712
            ++PEW   + +++ S+I + T+IGN+++I+++   + LR   N  I +LA++D+ +A  VLP  +     G W FG+H+C +WL  DVL CT+S+ +L  IA DRY A   PI Y     V R    I  VW LS +I  P +IGW              N   D  +    C+L ++  YVIYS++GSF +PL IM+ VYI IF
Sbjct:  103 AVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGW--------------NDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIF 293          

HSP 2 Score: 76.6406 bits (187), Expect = 1.784e-14
Identity = 30/75 (40.00%), Postives = 52/75 (69.33%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            +E RA + + +IM +F++CW+PF +MY++   C ++ CP  ++   I TW GY NS +NP++YTI N ++R +F+
Sbjct:  523 KERRAARTLGIIMGVFVICWLPFFLMYVILPFC-QTCCPTNKFKNFI-TWLGYINSGLNPVIYTIFNLDYRRAFK 595          
BLAST of GCR014 vs. Ensembl Fly
Match: Oct-TyrR (gene:FBgn0004514 transcript:FBtr0301930)

HSP 1 Score: 133.265 bits (334), Expect = 4.824e-33
Identity = 78/205 (38.05%), Postives = 116/205 (56.59%), Query Frame = 2
Query:   98 SIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIF 712
            ++PEW   + +++ S+I + T+IGN+++I+++   + LR   N  I +LA++D+ +A  VLP  +     G W FG+H+C +WL  DVL CT+S+ +L  IA DRY A   PI Y     V R    I  VW LS +I  P +IGW              N   D  +    C+L ++  YVIYS++GSF +PL IM+ VYI IF
Sbjct:  103 AVPEWEALLTALVLSVIIVLTIIGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVALLVLPFNVAYSILGRWEFGIHLCKLWLTCDVLCCTSSILNLCAIALDRYWAITDPINYAQKRTVGRVLLLISGVWLLSLLISSPPLIGW--------------NDWPDEFTSATPCELTSQRGYVIYSSLGSFFIPLAIMTIVYIEIF 293          

HSP 2 Score: 76.6406 bits (187), Expect = 1.784e-14
Identity = 30/75 (40.00%), Postives = 52/75 (69.33%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            +E RA + + +IM +F++CW+PF +MY++   C ++ CP  ++   I TW GY NS +NP++YTI N ++R +F+
Sbjct:  523 KERRAARTLGIIMGVFVICWLPFFLMYVILPFC-QTCCPTNKFKNFI-TWLGYINSGLNPVIYTIFNLDYRRAFK 595          
BLAST of GCR014 vs. Ensembl Fly
Match: 5-HT7 (gene:FBgn0004573 transcript:FBtr0334508)

HSP 1 Score: 129.028 bits (323), Expect = 1.185e-31
Identity = 111/418 (26.56%), Postives = 179/418 (42.82%), Query Frame = 2
Query:  101 IPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            +P       SI+  ++ L TV+GN+++ I +   R LR   N L+ +LALSD+ +A  V+P+A++ +    W FG  +C+IW++ DVL CTAS+ +L  I+ DRY A   P+ Y      RR    + +VW  ++ I +P ++                N ++++   Q  C +     Y IY+ +GSF +PL +M  VY +IF    ++  L  K    +     +    P+A    P   + + +      +SS  + S+   T    +            G    S   L                  +P+    RF                 + + +K  T    IM    V    CW+PF I+ ++R         V   L  +  W GYANS +NPI+Y  LNR+FR  FQ
Sbjct:  157 LPPLTSIFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEKWNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAACISLPPLL-------------ILGN-EHEDEEGQPICTVCQNFAYQIYATLGSFYIPLSVMLFVYYQIFRAA-RRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGGLSSGGGALAGHGSGGGVSGSTGLL-----------------GSPHHKKLRF----------------QLAKEKKASTTLGIIMSAFTV----CWLPFFILALIRPF---ETMHVPASLSSLFLWLGYANSLLNPIIYATLNRDFRKPFQ 519          
BLAST of GCR014 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 163.696 bits (413), Expect = 1.186e-44
Identity = 118/424 (27.83%), Postives = 198/424 (46.70%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ---------KKNLFSKSDTQN-TDDNCSSYNQPTATLLKPKFISSMKTHTETDENSS-DPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPN--EDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            +F+I  ++I L+T+ GN+++II +   R LR   NL + +LA +D+L+A  V+P ++  +  G W F    C I L  DVL+CT+S+  L  I+ DRY +   P+ Y +    R+ K  I+VVW +S+II  P ++                  Q      +  C+L  + +Y++YS +GSF  P +IM  VY+RI+ I  +         +K+     + QN  D    S N P     K + +      TE+ + +     C      S        +       G             PL  +  +   S+   N    SK     + ++      R  +++    RE R T ++ +++ +FI+CW PF   Y ++A+C + +C V   L     W GY NS++NP++YTI NR+FR +F+
Sbjct:   20 VFAITMTLIMLFTIFGNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVS-------------MDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNS-------NMAPLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMI---VREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPD-MCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFK 419          
BLAST of GCR014 vs. Ensembl Zebrafish
Match: FP236542.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:100330650])

HSP 1 Score: 163.696 bits (413), Expect = 1.186e-44
Identity = 118/424 (27.83%), Postives = 198/424 (46.70%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ---------KKNLFSKSDTQN-TDDNCSSYNQPTATLLKPKFISSMKTHTETDENSS-DPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPN--EDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            +F+I  ++I L+T+ GN+++II +   R LR   NL + +LA +D+L+A  V+P ++  +  G W F    C I L  DVL+CT+S+  L  I+ DRY +   P+ Y +    R+ K  I+VVW +S+II  P ++                  Q      +  C+L  + +Y++YS +GSF  P +IM  VY+RI+ I  +         +K+     + QN  D    S N P     K + +      TE+ + +     C      S        +       G             PL  +  +   S+   N    SK     + ++      R  +++    RE R T ++ +++ +FI+CW PF   Y ++A+C + +C V   L     W GY NS++NP++YTI NR+FR +F+
Sbjct:   20 VFAITMTLIMLFTIFGNIMVIIAVLTCRSLRGPQNLFLVSLAAADILVATLVIPFSLAKELMGCWYFESLWCEIILALDVLFCTSSIIHLCAISLDRYLSISRPVQYGTQRTPRKIKGAIVVVWLISAIISFPPLVS-------------MDKPQQAKGDPRTTCELNEDKWYILYSTIGSFFAPCLIMILVYVRIYQIAKKHTRCPPGEPRKDSAVGRELQNGKDGGVDSANNPNIAPSKSEAVKQPPVITESAQKTKRSRRCKENKEESSSSGSDVEVVGGHDANGTNS-------NMAPLETVNKTPAQSQSYRNIIATSKGSQLANAKATGTPNTRRKAMI---VREKRFTFVLAVVIGVFIICWFPFFFSYSLQAICPD-MCKVPEGLFTFFFWIGYCNSALNPLIYTIFNRDFRKAFK 419          
BLAST of GCR014 vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 162.155 bits (409), Expect = 4.236e-44
Identity = 121/419 (28.88%), Postives = 208/419 (49.64%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSS----------DPDCSVQ-THTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S + L+T++GN++++I +  +R L+   NL + +LA +D+L+A  ++P ++ N+  G+W FG   CNI+L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I+VVW +S++I  P +I       +N V              +  CQL +  +Y++YS++GSF  P +IM  VYIRI+ +        +K+ T+N  +     +  + T      +S   +  E    SS          +PD  ++ + +S+ KA  S      SK+  R         +    + + S+ + +L  +   +R                N+I R   ++ RE R T ++ ++M +F++CW PF   Y +  +C E  C +   L     W GY NSS+NP++YTI N++FR +FQ
Sbjct:   43 SFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLISMD----RNTV-----------DERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQV--------AKTRTRNMSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPAEDNPDADLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRR----------------NTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREP-CAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQ 421          
BLAST of GCR014 vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 162.155 bits (409), Expect = 4.236e-44
Identity = 121/419 (28.88%), Postives = 208/419 (49.64%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSS----------DPDCSVQ-THTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S + L+T++GN++++I +  +R L+   NL + +LA +D+L+A  ++P ++ N+  G+W FG   CNI+L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I+VVW +S++I  P +I       +N V              +  CQL +  +Y++YS++GSF  P +IM  VYIRI+ +        +K+ T+N  +     +  + T      +S   +  E    SS          +PD  ++ + +S+ KA  S      SK+  R         +    + + S+ + +L  +   +R                N+I R   ++ RE R T ++ ++M +F++CW PF   Y +  +C E  C +   L     W GY NSS+NP++YTI N++FR +FQ
Sbjct:   43 SFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLISMD----RNTV-----------DERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQV--------AKTRTRNMSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPAEDNPDADLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRR----------------NTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREP-CAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQ 421          
BLAST of GCR014 vs. Ensembl Zebrafish
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 161.77 bits (408), Expect = 5.193e-44
Identity = 121/419 (28.88%), Postives = 208/419 (49.64%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSS----------DPDCSVQ-THTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S + L+T++GN++++I +  +R L+   NL + +LA +D+L+A  ++P ++ N+  G+W FG   CNI+L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I+VVW +S++I  P +I       +N V              +  CQL +  +Y++YS++GSF  P +IM  VYIRI+ +        +K+ T+N  +     +  + T      +S   +  E    SS          +PD  ++ + +S+ KA  S      SK+  R         +    + + S+ + +L  +   +R                N+I R   ++ RE R T ++ ++M +F++CW PF   Y +  +C E  C +   L     W GY NSS+NP++YTI N++FR +FQ
Sbjct:   43 SFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLISMD----RNTV-----------DERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQV--------AKTRTRNMSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPAEDNPDADLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRR----------------NTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREP-CAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQ 421          
BLAST of GCR014 vs. Ensembl Xenopus
Match: ADRA2B (adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485811])

HSP 1 Score: 154.836 bits (390), Expect = 1.734e-41
Identity = 119/435 (27.36%), Postives = 214/435 (49.20%), Query Frame = 2
Query:  113 ALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKK--------------NLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXA--NSIVRAEKR-----ETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            A  + + I + + L+T+ GN+++II +  +R L+   NL + +LA +D+L+A  ++P ++ N+  G+W FG   C ++L  DVL+CT+S+  L  I+ DRY +    I Y S    +R K  I++VW+L+++I +P +I + G              +  + + + +C+L  EP+Y++ S++ SF  P +IM  VY+RI+ I  ++                LFS+++  + +   SS+ Q    ++     S  KT    D    D  C V   +S  +             GL+        PQ          N    N  E +   T  + +      + A  + +  A+K+     E R T ++ +++ +F+LCW PF   Y + A+C+E +C +   +     W GY NSS+NP++YTI N++FR +F+
Sbjct:   16 ATAVIAAIITFLVLFTIFGNVLVIIAVLTSRSLKAPQNLFLVSLAAADILVATLIIPFSLANELMGYWYFGKTWCEMYLALDVLFCTSSIVHLCAISLDRYWSVSQAIEYNSKRTPKRIKCIILIVWTLAALISLPPLI-YKG--------------KSKDQNAKPECKLNEEPWYILSSSICSFFAPCLIMILVYLRIYLIAKRRNRKNSTDKKLKKMAPGLFSRTNKHSLN---SSHTQTQCGIIS----SQEKTGLALD----DLHCGVPVLSSTREERNGHSESF----GLQ--------PQ--------GENLKHTNGCEPAVMDTVATVKGVMLMPKGAKDSDLSSAKKKSYINREKRFTFVLAVVIGVFVLCWFPFFFTYSLGAICTE-LCYIPDSVFQFFFWIGYCNSSLNPVIYTIFNQDFRKAFR 403          
BLAST of GCR014 vs. Ensembl Xenopus
Match: DRD2 (dopamine receptor D2 [Source:NCBI gene;Acc:100493063])

HSP 1 Score: 155.606 bits (392), Expect = 1.785e-41
Identity = 120/446 (26.91%), Postives = 214/446 (47.98%), Query Frame = 2
Query:   83 SSEMESIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSS-SHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ-KKNLFSKSDTQNTD-----DNCSSYNQPTATLLKPKFISS--------MKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQ------GLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR--AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
             + ++  P +  Y  +++ +++    V GN+++ I +S  + L+TT N LI +LA++D+L+A  V+P  +  +  G W F    C+I++  DV+ CTAS+ +L  I+ DRYTA   P+ Y +  S  RR    I VVW LS  I  P + G   +  K  +I        DN            P +VIYS++ SF +P I+   VY++I+ ++ + +K + +K ++   +     D C+    P    L   F+ S         K  +E   +  D D  + + TS  +      +     Q        +C +    LP       K   N    +  + +K F  ++  +   +        R  ++ +E +AT+++ +++ +FI+CW+PF I++++   C+   C + + L    TW GY NS++NPI+YT  N EFR +F
Sbjct:   19 GTAVDQKPHYNYY--AMLLTLLIFVIVFGNVLVCIAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYMEVVGEWRFSRIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTASKVCII--------DN------------PAFVIYSSIVSFYVPFIVTLLVYVQIYIVLRKRRKRVNTKRNSHGVEVNAHKDKCT---HPEDVKLCAVFVKSNGSFPTDKKKVVSEAGNHPEDMDVEMMSSTSPPEKTKHKSASPNHHQLAVPATSNQCNNAN--LPSPVDSPYKAEKNGHPKDSTKPAKVFEIQTMPNGKTRTSIKTMSKRKLSQHKEKKATQMLAIVLGVFIICWLPFFIIHILNMHCN---CNIPQALYSAFTWLGYVNSAVNPIIYTTFNVEFRKAF 434          
BLAST of GCR014 vs. Ensembl Xenopus
Match: ENSXETT00000046867.1 (5-hydroxytryptamine (serotonin) receptor 1A, G protein-coupled [Source:NCBI gene;Acc:100488829])

HSP 1 Score: 143.665 bits (361), Expect = 1.861e-37
Identity = 112/415 (26.99%), Postives = 192/415 (46.27%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQK-KNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDEN---SSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            + S+    + L  + GN  +I  I+  R L+T AN LIG+LA++D++++  VLP+A  N     W  G   C+I+++ DVL CT+S+  L  IA DRY A   PI Y +    RR    I + W +   I IP ++GW     + P          ++ S    C++  +P Y IYS  G+F +PLI+M  +Y +IF     + +    K++ +   D C S +   A           K++ E  +N   + +P  S   + +        I   +    L  I V   +      ++    ++  + P  + +           +       +  A +R+T   K + +IM  FI CW+PF I+ +V   C    C +   L  ++ W GY+NS +NPI+Y   N++F+++F+
Sbjct:   31 VTSLFLGTLILCAIFGNACVIAAIALERCLQTVANYLIGSLAVTDLMVSVLVLPMAAHNQVLNKWTLGQVTCDIFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAVLISITWIVGFSISIPPMLGW-----RTP----------EDRSDPNACKISEDPGYTIYSTFGAFYIPLILMLVLYGKIFKAARFRIRKTVKKAEKKKVADTCLSVSPAVA---------ERKSNGEPSKNWKRTVEPKPSACVNGA--------IRHGEDGAVLEIIEVHHYVNSKSHLDLPNHAHDMAVAPCSEKRN---------DRATDAKRKVALARERKT--VKTLGIIMGTFIFCWLPFFIVALVLPFCET--CHMPHLLFDVINWLGYSNSLLNPIIYAYFNKDFQSAFK 400          
BLAST of GCR014 vs. Ensembl Xenopus
Match: ENSXETT00000026158.1 (alpha-2Db adrenergic receptor-like [Source:NCBI gene;Acc:100493940])

HSP 1 Score: 134.035 bits (336), Expect = 4.089e-34
Identity = 106/421 (25.18%), Postives = 195/421 (46.32%), Query Frame = 2
Query:  107 EWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRET--RATKIMLLIMVI---FILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            E  L I +++   I L TV+GN+++++ I  +R LR   NL + +LA +D+L+ A ++P ++  +  G+W FG   C+++L  D+L+CT+S+  L  I+ DRY +    + Y      +R K  I ++W +S+II  P            P++K        +   +++C L ++ +YV++S   SF +P +IM  +Y RI+ +   +      S  +N   +C+S               + +TH     N    +  ++  TS +         K   +           P +     +LS +++    + D                    SI  ++ R T  R  ++  ++ V+   F++CW PF   Y + ++C +  C +   L     W GY NSS+NPI+YT+ NR+FR +F+
Sbjct:   32 ECTLIIIAVVS--IILSTVLGNILVVLAIFTSRALRAPQNLFLVSLASADILVGALIIPFSLAREVMGYWHFGSVWCSMYLALDILFCTSSIVHLCAISIDRYWSVTKAVKYNLKRTPKRIKRSIAIIWVVSAIISFP------------PLLK--------SKHKEWECLLNDDTWYVLFSCTVSFFVPCLIMILLYCRIYRVAKHR-----VSSLRNGVSDCNSAAAG----------GTCETHHTIQNNHEAEELDLEESTSSVHKFPKKHHHKTKDK-----------PSSAK-AKRLSWSSNRGQQHRD-------------------QSICISQMRLTQLREKRLTFVLAVVIGGFVICWFPFFFTYSLESVCRKR-CGISDALFNFFFWIGYCNSSLNPIIYTVFNRDFRKAFR 383          
BLAST of GCR014 vs. Ensembl Xenopus
Match: ENSXETT00000011711.1 (adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488806])

HSP 1 Score: 120.939 bits (302), Expect = 5.543e-29
Identity = 69/207 (33.33%), Postives = 116/207 (56.04%), Query Frame = 2
Query:  158 TVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ-KKNLFSKSDTQNTDDN 775
             +IGN+++II++  N+ LR   N LI NLA++D+LL++TVLP +   +  G+W FG  +C++W   DVL CTAS++SL  I+ DRY   +  + Y +    +RT   ++ VW  S++I I  ++GW     K P                Y C++  E +Y I+S++ SF +PLI++  +Y R++ +  +  KNL +    +  D  
Sbjct:   58 AIIGNIMVIISVVTNKQLRIPTNYLIVNLAIADLLLSSTVLPFSATKEIVGYWVFGRILCDVWAAMDVLCCTASIFSLCTISIDRYIGVRHSLRYPTIVTRKRTILALLGVWMFSTVISIGPLLGW-----KEPA-----------PPDTYVCEITTEIFYAIFSSLASFYIPLIVILVMYCRVYVVAKRITKNLEAGVMKERMDSK 248          

HSP 2 Score: 60.077 bits (144), Expect = 4.363e-9
Identity = 29/74 (39.19%), Postives = 46/74 (62.16%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            RE +A K + +++ +FILCW+PF  +  + +L      PV   L+ I+ W GY NS INPI+Y   ++EF+ +F
Sbjct:  287 REKKAAKTLGIVVGMFILCWLPFFTVLPLSSLSEHLTPPVT--LEKIIFWLGYFNSCINPIIYPCSSKEFKRAF 358          
BLAST of GCR014 vs. Ensembl Mouse
Match: Adra2a (adrenergic receptor, alpha 2a [Source:MGI Symbol;Acc:MGI:87934])

HSP 1 Score: 158.303 bits (399), Expect = 1.880e-42
Identity = 112/418 (26.79%), Postives = 193/418 (46.17%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSD-------------PDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
             ++ L+TV GN+++II +  +R L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C I+L  DVL+CT+S+  L  I+ DRY +    I Y      RR K  I+ VW +S++I  P +I     G                   +  C++ ++ +YVI S++GSF  P +IM  VY+RI+ I  ++  +     ++   D CS+   P     +P  +   +    T   +               P         +L+  +SS   ++     R         +T   ++K   +     P       +   +        +A+     + RE R T ++ +++ +F++CW PF   Y + A+     CPV   L     WFGY NSS+NP++YTI N +FR +F+
Sbjct:   56 GLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGG-----------GQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRV---PPSRRGPDACSA--PPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSEHAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVG----CPVPSQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFK 453          
BLAST of GCR014 vs. Ensembl Mouse
Match: Adra2a (adrenergic receptor, alpha 2a [Source:MGI Symbol;Acc:MGI:87934])

HSP 1 Score: 158.303 bits (399), Expect = 1.880e-42
Identity = 112/418 (26.79%), Postives = 193/418 (46.17%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSD-------------PDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
             ++ L+TV GN+++II +  +R L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C I+L  DVL+CT+S+  L  I+ DRY +    I Y      RR K  I+ VW +S++I  P +I     G                   +  C++ ++ +YVI S++GSF  P +IM  VY+RI+ I  ++  +     ++   D CS+   P     +P  +   +    T   +               P         +L+  +SS   ++     R         +T   ++K   +     P       +   +        +A+     + RE R T ++ +++ +F++CW PF   Y + A+     CPV   L     WFGY NSS+NP++YTI N +FR +F+
Sbjct:   56 GLLMLFTVFGNVLVIIAVFTSRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKVWCEIYLALDVLFCTSSIVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISIEKKGAGG-----------GQQPAEPSCKINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRV---PPSRRGPDACSA--PPGGADRRPNGLGPERGAGPTGAEAEPLPTQLNGAPGEPAPAGPRDGDALDLEESSSSEHAERPPGPRRPDRGPRAKGKTRASQVKPGDSLPRRGPGAAGPGASGSGHGEERGGGAKASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLIAVG----CPVPSQLFNFFFWFGYCNSSLNPVIYTIFNHDFRRAFK 453          
BLAST of GCR014 vs. Ensembl Mouse
Match: Adra2c (adrenergic receptor, alpha 2c [Source:MGI Symbol;Acc:MGI:87936])

HSP 1 Score: 155.606 bits (392), Expect = 1.622e-41
Identity = 115/417 (27.58%), Postives = 195/417 (46.76%), Query Frame = 2
Query:  143 MITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCS--SYNQPTATLLKPKFISSMKTHTETDENS-----------SDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
             + ++TV+GN++++I +  +R LR   NL + +LA +D+L+A  V+P ++ N+   +W FG   C ++L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I+ VW +S++I  P            P++ F+   + D +++  QC L +E +Y++ S +GSF  P +IM  VY RI+ +   +    S+       D  S  + N       +    +  +T  E DE+S                  +    +  +         ++QG R  S      ++P    +LS  +S       S  F     R       R       EK   R T ++ ++M +F+LCW PF   Y +  +C E+ C +   L     W GY NSS+NP++YT+ N++FR SF+
Sbjct:   60 FLIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFP------------PLVSFYR--RPDGAAYP-QCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTLSEKRGPAGPDGASPTTENGLGKAAGENGHCAPPRTEVEPDESSAAERRRRRGALRRGGRRREGAEGDTGSADGPGPGLAAEQGARTAS------RSPGPGGRLSRASSR------SVEFFLSRRRRARSSVCRRKVAQAREK---RFTFVLAVVMGVFVLCWFPFFFSYSLYGICREA-CQLPEPLFKFFFWIGYCNSSLNPVIYTVFNQDFRRSFK 445          
BLAST of GCR014 vs. Ensembl Mouse
Match: Htr1a (5-hydroxytryptamine (serotonin) receptor 1A [Source:MGI Symbol;Acc:MGI:96273])

HSP 1 Score: 152.525 bits (384), Expect = 1.185e-40
Identity = 112/412 (27.18%), Postives = 196/412 (47.57%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR-AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            I S++   +    V+GN  ++  I+  R L+  AN LIG+LA++D++++  VLP+A +      W  G   C++++  DVL CT+S+  L  IA DRY A   PI Y +    RR    I + W +  +I IP ++GW     + P          ++ S+  +C +  +  Y IYS  G+F +PL++M  +Y RIF    +      +   +  +   +  +  T++   PK           +      DC     ++E +A+ +  +    +QG    ++E +         ++  +   L    +S   +        K  R A +  + A  RE +  K + +IM  FILCW+PF I+ +V   C ES C +   L  I+ W GY+NS +NP++Y   N++F+N+F+
Sbjct:   38 ITSLLLGTLIFCAVLGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGW-----RTP----------EDRSNPNECTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIF----RAARFRIRKTVKKVEKKGAGTSFGTSSAPPPK--------KSLNGQPGSGDCR---RSAENRAVGTPCANGAVRQGEDDATLEVIEVH------RVGNSKGHLPLPSESGATSYVPACLERKNERTAEAKRKMALARERKTVKTLGIIMGTFILCWLPFFIVALVLPFC-ESSCHMPELLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFK 412          
BLAST of GCR014 vs. Ensembl Mouse
Match: Adra2b (adrenergic receptor, alpha 2b [Source:MGI Symbol;Acc:MGI:87935])

HSP 1 Score: 150.214 bits (378), Expect = 1.511e-39
Identity = 115/433 (26.56%), Postives = 197/433 (45.50%), Query Frame = 2
Query:  143 MITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLK-----PKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXX--------XXXXXXXQGLRCISVE-----------FLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIV--RAEKRETRATKIMLLIMV---IFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
             + L+T+ GN ++I+ +  +R LR   NL + +LA +D+L+A  ++P ++ N+  G+W F    C ++L  DVL+CT+S+  L  I+ DRY A    + Y S    RR K  I+ VW ++++I +P +I              +   Q        QC+L  E +Y++ S++GSF  P +IM  VY+RI+ +I ++ +       + + +  S    P A  +      P  +S + +  E + +   P    +  T E     +          S +  K+G    + E              PQT L     S  N  L   + S+       +    K     S    R   + +R  +   ++ V   +F++CW PF   Y + A+C +  C V   L     W GY NSS+NP++YTI N++FR +F+
Sbjct:   26 FLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSLANELLGYWYFWRAWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIAAVISLPPLI--------------YKGDQRPEPHGLPQCELNQEAWYILASSIGSFFAPCLIMILVYLRIY-VIAKRSHCRGLGAKRGSGEGESKKPHPAAGGVPASAKVPTLVSPLSSVGEANGHPKPPREKEEGETPEDPEARALPPNWSALPRSVQDQKKGTSGATAEKGAEEDEEEVEECEPQT-LPASPASVFNPPLQQPQTSRVLATLRGQVLLSKNVGVASGQWWRRRTQLSREKRFTFVLAVVIGVFVVCWFPFFFSYSLGAICPQH-CKVPHGLFQFFFWIGYCNSSLNPVIYTIFNQDFRRAFR 441          
BLAST of GCR014 vs. UniProt/SwissProt
Match: sp|O01670|OAR2_LYMST (Octopamine receptor 2 OS=Lymnaea stagnalis OX=6523 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 1.176e-50
Identity = 95/228 (41.67%), Postives = 144/228 (63.16%), Query Frame = 2
Query:  128 SIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTII-NQKKNLFSKSD---TQNTDDNCSSYNQPT 799
            +++ ++ITLWT++GN  +++ +     LRT +N LIGNLA+SD+LLA TVLP++ V+D  G+W FG   C +WL  DVLYCTAS+W L  +A DRY AT +P+WY     VR+    I+ VW  S +I     IGW     ++ +  FFS   ++ S  +YQC LF    YV+YS+MGSF++P I+M+ +Y+RIF ++ NQ + +  KS    + +  + C   N+P+
Sbjct:   85 AVVLTLITLWTILGNFFVLMALYRYGTLRTMSNCLIGNLAISDLLLAVTVLPISTVHDLLGYWVFGEFTCTLWLCMDVLYCTASIWGLCTVAFDRYLATVYPVWYHDQRSVRKAVGCIVFVWIFSIVISFAPFIGW-----QHMIPSFFS---FNASIQRYQCILFTSSSYVLYSSMGSFVIPAILMAFMYVRIFVVLHNQSRGVKFKSGLKISSSKYNGCPVINEPS 304          

HSP 2 Score: 83.1889 bits (204), Expect = 1.291e-15
Identity = 37/79 (46.84%), Postives = 53/79 (67.09%), Query Frame = 2
Query: 1118 RAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            R E RE RATK MLLIM  F +CW+PF  MY++R++C    C + +     + W GY NSS+NP+LYT+ N +F+ +F+
Sbjct:  484 RFELREQRATKRMLLIMACFCVCWMPFLFMYILRSVCDT--CHMNQHFVAAIIWLGYVNSSLNPVLYTLFNDDFKVAFK 560          
BLAST of GCR014 vs. UniProt/SwissProt
Match: sp|Q93126|GPR9_AMPAM (Probable G-protein coupled receptor No9 OS=Amphibalanus amphitrite OX=1232801 PE=3 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 4.087e-45
Identity = 125/422 (29.62%), Postives = 199/422 (47.16%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIF-TIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENS---------SDPDCSVQ------THTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSK--RFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            + + L  V GNL++++ +  +  LRT  NL I +LA +D+L+   VLP +   +    W +G   C++WL  DV  CT+S+ +L  I+ DRY A   PI Y S    RR K  I  VW LS +IC P ++GW       P     S     +S+ +  C+L NE  YVIYSA+GSF LP  +M   Y RI+ T ++  + +     T   D+      + T  + + + ++                     S+P    Q       H  E     +        +G          PQ P  ++  ++ +SE    +DS+  RF       +   RR      R  + ET+A K + +I+ +FILCW+PF + Y+VR  C++ + P+   L  +  W GY NS++NP +Y + +R+FR +F
Sbjct:   41 AFLNLMVVAGNLLVVMAVFVHSKLRTVTNLFIVSLACADLLVGMLVLPFSATLEVLDVWLYGDVWCSVWLAVDVWMCTSSILNLCAISLDRYLAVSQPISYPSLMSTRRAKQLIAAVWVLSFVICFPPLVGWN----DRPGTLIGSR---GSSACRLTCELTNERGYVIYSALGSFFLPSTVMLFFYGRIYRTAVSTTRAIAQGFRTTKEDEE----GRLTLRIHRGRSVTQRAEQAAAGGARAHGQVRLTLSEPGARRQNKPSFVVHCREDSRAKNQYEIYTVVEGDSRPGRRVPQPQRPAKKLSSASQSSE----DDSRPPRFI------SRVSRRNVRHQARRFRMETKAAKTVGIIVGLFILCWLPFFVCYLVRGFCADCVPPL---LFSVFFWLGYCNSAVNPCVYALCSRDFRFAF 438          
BLAST of GCR014 vs. UniProt/SwissProt
Match: sp|Q25188|OAR_HELVI (Octopamine receptor OS=Heliothis virescens OX=7102 PE=2 SV=1)

HSP 1 Score: 167.933 bits (424), Expect = 4.608e-45
Identity = 130/473 (27.48%), Postives = 221/473 (46.72%), Query Frame = 2
Query:   98 SIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIF----------------TIINQKKNLFSKSDTQNTDDNCSS-----YNQPTATLL----------------KPK-----------------FISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            ++PEW     +I+ ++I + T++GN+++I+++   + LR   N  I +LA++D+ +A  VLPL +     G W FG+++C +WL  D++ CT+S+ +L  IA DRY A   PI Y     + R    I VVW LS II  P ++GW              N   D       C+L ++P +VI+S+ GSF +PL+IM+ VY  I+                + I+  +N ++  D  +  D+ SS      +Q    L+                KPK                  +S+  + T+  EN  + + S ++++ E                   I V   +P        + T++ +  PN+ S  +     +          S+ R E+R  R   I   IM +F++CW+PF ++Y+V   C+ S C   +++  I TW GY NS++NP++YTI N +FR +F+
Sbjct:   46 AVPEWEAICTAIVLTLIIISTIVGNILVILSVFTYKPLRIVQNFFIVSLAVADLTVAILVLPLNVAYSILGQWVFGIYVCKMWLTCDIMCCTSSILNLCAIALDRYWAITDPINYAQKRTLERVLLMIGVVWVLSLIISSPPLLGW--------------NDWPDVFEPDTPCRLTSQPGFVIFSSSGSFYIPLVIMTVVYFEIYLATKKRLRDRAKATKISTISSGQNKYNNKDDHHDQDSVSSEANHNEHQGVTRLVSDNEKKKRTRKLTPKKKPKRKYWSKDDKSQNKLIIPILSNENSVTDMGENLENRNTSSESNSKETHEDDL-------------IEVNETVP--------VKTHHKKPKPNQQSAVYQFIEEKQRI-------SLTR-ERRAARTLGI---IMGVFVVCWLPFFVIYLVIPFCA-SCCLSNKFINFI-TWLGYCNSALNPLIYTIFNMDFRRAFK 470          
BLAST of GCR014 vs. UniProt/SwissProt
Match: sp|Q90WY6|ADA2C_DANRE (Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.198e-43
Identity = 121/419 (28.88%), Postives = 208/419 (49.64%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSS----------DPDCSVQ-THTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S + L+T++GN++++I +  +R L+   NL + +LA +D+L+A  ++P ++ N+  G+W FG   CNI+L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I+VVW +S++I  P +I       +N V              +  CQL +  +Y++YS++GSF  P +IM  VYIRI+ +        +K+ T+N  +     +  + T      +S   +  E    SS          +PD  ++ + +S+ KA  S      SK+  R         +    + + S+ + +L  +   +R                N+I R   ++ RE R T ++ ++M +F++CW PF   Y +  +C E  C +   L     W GY NSS+NP++YTI N++FR +FQ
Sbjct:   43 SFLILFTIVGNVLVVIAVLTSRALKPPQNLFLVSLASADILVATLIIPFSLANELMGYWFFGEVWCNIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKGMIVVVWLISAVISFPPLISMD----RNTV-----------DERRPMCQLNDHTWYILYSSIGSFFAPCVIMILVYIRIYQV--------AKTRTRNMSEKRRDPDGGSGTPRLENGLSREDSRRENGHCSSSPGERKPAEDNPDADLEDSSSSDEKAKRSQNETAPSKKDRRSSRKNSSSSKHSSRKSRASSKSLDLFSSRRKRR----------------NTISRKKISQAREKRFTFVLAVVMGVFVVCWFPFFFSYSLYGICREP-CAIPDPLFKFFFWIGYCNSSLNPVIYTIFNQDFRRAFQ 421          
BLAST of GCR014 vs. UniProt/SwissProt
Match: sp|O42384|5H1AB_TAKRU (5-hydroxytryptamine receptor 1A-beta OS=Takifugu rubripes OX=31033 GN=htr1a-B PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 5.086e-43
Identity = 113/418 (27.03%), Postives = 195/418 (46.65%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQK-KNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVE------FLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            + S +   + L ++ GN  ++  I+  R L+  AN LIG+LA++D++++  VLP+A +      W  G   C+I+++ D+L CT+S+  L +IA DRY A   PI Y      RR    I V W +   I IP ++          +++   +   ++ ++  QC++  +P+Y IYS  G+F +PL +M  +Y RIF     + +    K++ +   D C +             +S    H +T  ++             L  +  ++      + L  I V+        LP TP   + L  N  E    E  ++                     A  RE +  K + +IM  FILCW+PF I+ +V   C ES C +  WL+ ++ W GY+NS +NPI+Y   N++F+++F+
Sbjct:   35 VTSFLLGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNRWTLGQIPCDIFISLDMLCCTSSILHLCVIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISIPPML----------IMRSQPSSMAEDRANSKQCKITQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRKTEKKKVSDTCLA-------------LSPAMFHRKTPGDAHGKSWKRSVEPRPLPNVNGAVKHAGEGESLDIIEVQSNSRCNLPLPNTP-GTVPLFENRHE-KATETKRKI--------------------ALARERKTVKTLGIIMGTFILCWLPFFIVALVMPFCQES-CFMPHWLKDVINWLGYSNSLLNPIIYAYFNKDFQSAFK 406          
BLAST of GCR014 vs. TrEMBL
Match: A0A193KUG1 (GCR014 OS=Schmidtea mediterranea OX=79327 GN=gcr014 PE=2 SV=1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 422/422 (100.00%), Postives = 422/422 (100.00%), Query Frame = 2
Query:   89 EMESIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            EMESIPEWALYIFSIIPSMITLWTVIGNLIIIITISHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELKAIASSISKKKSKQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTKKSYRSNYKKRRRANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ
Sbjct:    6 EMESIPEWALYIFSIIPSMITLWTVIGNLIIIITISHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELKAIASSISKKKSKQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTKKSYRSNYKKRRRANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 427          
BLAST of GCR014 vs. TrEMBL
Match: A0A183PIL2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS14198 PE=4 SV=1)

HSP 1 Score: 250.366 bits (638), Expect = 1.395e-74
Identity = 165/414 (39.86%), Postives = 217/414 (52.42%), Query Frame = 2
Query:  110 WALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            WA  I SII   ITL T +GN ++   +   R LRTT+NLLIGNLALSD+LLA TVLP++   D  G W FG  +C+IWL  DV YCTASVWSLV IA DR+TAT FPIWYR + + RR   YI+ VW LS +IC+P ++                        + Y+C LF E YY++YSAMGSFI+P IIM  +Y +IF I+ Q+  L  +S                            + H     N S P+C +  H  +           +S   +   + E  L  +P      +TN S +N    +K        +  K  +    + + E+   RATK M LI++IF L WIPFT+MY+VR LC E  CP    L+  VTW GY NS+INPILY + N  FR +F
Sbjct:   10 WAFVIISIIFLFITLLTAVGNALVFAALFRFRKLRTTSNLLIGNLALSDLLLAVTVLPISAATDATGVWLFGPVMCDIWLTIDVFYCTASVWSLVTIAFDRFTATTFPIWYRGNKNKRRVICYILFVWILSGLICVPGLLAL----------------------NHYECVLFTEAYYIVYSAMGSFIIPFIIMIILYAKIFLILQQRTRLIRQSR---------------------------RIH-----NKSPPECMI-VHDKQF--------NGQSVDKINNYTTEKNLLTSP------NTNTSIINSITTTKPVLTNIKIAVDKPNQVMERVEQRER---RATKRMGLIIIIFALSWIPFTLMYLVRGLCGEQFCPDISDLRKFVTWLGYVNSTINPILYALFNVHFRQAF 351          
BLAST of GCR014 vs. TrEMBL
Match: G4VFR6 (Putative 5-hydroxytryptamine receptor OS=Schistosoma mansoni OX=6183 GN=Smp_134820 PE=4 SV=1)

HSP 1 Score: 244.588 bits (623), Expect = 2.241e-72
Identity = 163/418 (39.00%), Postives = 210/418 (50.24%), Query Frame = 2
Query:  104 PEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDD--NCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            P WA  I SII   ITL T IGN ++   +   R LRTT+NLLIGNLALSD+LLA TVLP++   D  G W FG  +C+IWL  DV YCTASVWSLV IA DR+TAT FPIWYR + + RR   YI+ VW LS +IC+P ++                        + Y+C LF E YY++YSAMGSFI+P IIM  +Y +IF I+ Q+  L  +S   +      C   ++      KP    S+  +  T  N+S    S  T T  +                               ++ +   N  +   E  +R                    RA KR       M LI++IF L WIPFT+MY+VR LC E  CP    L+  VTW GY NS+INPILY + N  FR +F
Sbjct:    8 PNWAFLILSIIFLFITLLTAIGNALVFAALFRFRKLRTTSNLLIGNLALSDLLLAITVLPISATTDATGIWLFGPVMCDIWLTIDVFYCTASVWSLVTIAFDRFTATTFPIWYRGNKNRRRVICYILFVWILSGLICLPGLL----------------------VLNHYECVLFTEAYYIVYSAMGSFIIPFIIMIILYAKIFFILQQRTRLIRQSRRIHNKSLLECMIIHE------KPLNEQSIDKNLLTIPNTSTSLISSMTTTKPILTNI---------------------------KIAVDAPNQVMERAEQRER--------------------RATKR-------MGLIIIIFALSWIPFTLMYLVRGLCGEQFCPDISDLRKFVTWLGYVNSTINPILYALFNVHFRQAF 343          
BLAST of GCR014 vs. TrEMBL
Match: A0A183QLK4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 8.190e-69
Identity = 165/418 (39.47%), Postives = 216/418 (51.67%), Query Frame = 2
Query:  104 PEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDD--NCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            P WA  I SII   I L T IGN ++   +   R LRTT+NLLIGNLALSD+LLA TVLP++   D  G W FG  +C+IWL  DV YCTASVWSLV IA DR+TAT FPIWYR + + RR   YI+ VW LS +IC+P ++                        + Y+C LF E YY++YSAMGSFI+P IIM  +Y +IF I+ Q+  L  +S   +      C   ++      KP    S+  +  T  N+S    S  T T  +                             L  +K++ +     PN+  +R                  + + E+R   ATK M LI++IF L WIPFT+MY+VR LC E  CP    L+  VTW GY NS+INPILY + N  FR +F
Sbjct:    8 PNWAFVILSIIFLFIILLTAIGNALVFAALFRFRKLRTTSNLLIGNLALSDLLLAITVLPISATTDATGIWLFGPVMCDIWLTIDVFYCTASVWSLVTIAFDRFTATTFPIWYRGNKNRRRVICYILFVWILSGLICLPGLL----------------------VLNHYECVLFTEAYYIVYSAMGSFIIPFIIMIILYAKIFFILQQRTRLIRQSRRIHNKSLPECMIIDE------KPLNEQSIDKNLLTIPNTSTSLISSMTTTKPI-----------------------------LTNIKIAVD----APNQVMER------------------VEQRERR---ATKRMGLIIIIFALSWIPFTLMYLVRGLCGEQFCPDISDLRKFVTWLGYVNSTINPILYALFNVHFRQAF 343          
BLAST of GCR014 vs. TrEMBL
Match: A0A1Q1NIM9 (Putative octopamine/tyramine receptor OS=Crassostrea gigas OX=29159 PE=2 SV=1)

HSP 1 Score: 236.113 bits (601), Expect = 1.168e-67
Identity = 158/455 (34.73%), Postives = 227/455 (49.89%), Query Frame = 2
Query:  128 SIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNL-QYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQ-------KKNLFSKSDTQNTD-----DNCSSYNQPT-----------ATLLKP-------------KFISSMKTHTE-----TDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTN----NSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            +I+ S+IT+WT+ GN ++ + +     LR+ +N LIGNLA+SD+LLA TVLP+++ ND  G+W FG  +C IWL  DVLYCTAS+W LV IA DRYTAT +P+WY       R   YII+VW  S I+ I   IGW          +   NL +++  + +++C LF    YV+YSAMGSF++P ++M  +Y RIF I+ +       KK  F  +  Q+ D     D  S  +Q T           AT + P             + +S    H E     T +NS  PD   ++ T E                   +S      Q    + K  T     + +       KR +    + N K +       + E RE RATK M ++M  F+ CW PF  MY++R+ C      V+  +Q  + W GY NSSINPILYT+ N +FR +F+
Sbjct:   66 AILLSLITIWTIFGNALVWVALYRFPKLRSMSNCLIGNLAMSDLLLALTVLPISLGNDLLGYWVFGEVMCPIWLCIDVLYCTASIWGLVTIAVDRYTATVYPVWYFERRSPLRALIYIIMVWFFSIIVSIAPFIGWR---------EMIPNLYKFNIETKRFECVLFETEGYVVYSAMGSFVIPAVLMLFLYFRIFIILRKRMKTMQLKKEKFKLNIDQDFDSCPLQDENSQIDQSTTPVTQVKMTDKATQISPVSKKQCTTSYNVQRSLSETNVHGENSQKITKDNSILPDVICKSQTEEGTEEEKQPCLYDVNVNKSILSSADDQKQENRPDEKGPTRFIRTDQDNTKRASKKRVSLLYKKRNSKSKHIQGIKTKYELREQRATKRMAIVMGCFLFCWFPFPFMYLIRSFCVSCYLNVH--IQASIIWLGYVNSSINPILYTLFNDDFRKAFK 509          
BLAST of GCR014 vs. Ensembl Cavefish
Match: adra2b (adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751])

HSP 1 Score: 163.31 bits (412), Expect = 8.733e-45
Identity = 114/414 (27.54%), Postives = 202/414 (48.79%), Query Frame = 2
Query:  143 MITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTAT-----LLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNN-SELNPNED--SKRFTXXXXXXXXXXXXXANSIVRAE--KRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            ++ ++T++GN+++II +  +R LR   NL + +LA +D+L+A  ++P ++ N+  G W F    C I+L  DVL+CT+S+  L  I+ DRY +    + Y +    RR K  I++VW +S++I  P ++               +  +  + +   QC+L NE +Y++YS +GSF  P +IM  VY+RI+ I  Q+            +   S+  QP  T     LL P  + +  T  +   ++++ + S     +E              QG     V   +P TP  E     ++ + +    D  +     +      K+    NS  R     RE R T ++ +++ +F++CW PF   Y ++A+C  + C +   L     W GY NS +NP++YTI N++FR +F+
Sbjct:   29 LMIVFTIVGNILVIIAVLTSRSLRGPQNLFLVSLAAADILVATLIIPFSLANELMGFWYFKSVWCEIYLALDVLFCTSSIVHLCAISLDRYLSISRAVTYGAQRTPRRIKCAILIVWLISAVISFPPLLS-------------MNKKKGTDEAGCPQCELNNERWYILYSTIGSFFAPCLIMILVYMRIYQIAKQRTR--CPPGEPRKEIPASAKQQPATTPTTNNLLPPPSLGTALTPPDKKPDNNNGESSTSDSDTE--------------QG----GVGTEMPMTPSGEPSAGIHSPATIQKYRDMIATAKGTRLASRKSKQDGTPNSARRKAMVNREKRFTFVLAVVIGVFVVCWFPFFFSYSLQAVCPRT-CNLPEPLFKFFFWIGYCNSCLNPVIYTIFNKDFRRAFK 408          
BLAST of GCR014 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 159.073 bits (401), Expect = 3.598e-43
Identity = 112/427 (26.23%), Postives = 208/427 (48.71%), Query Frame = 2
Query:  125 FSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSS-SHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNED--------------SKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            ++++ +++    V GN+++ + +S  + L+TT N LI +LA++D+L+A  V+P  +  +  G W F    C+I++  DV+ CTAS+ +L  I+ DRYTA   P+ Y +  S  RR    I VVW LS  I  P + G   +  ++  +                C++ N P +V+YS++ SF +P II   VY++I+ ++ +++         NT  NC   +      LK   I       E  +  +  +  + T TS  + +  +             +V  L  Q+P     L   + E  P++D              +K F  ++  +   +     ++ +   ++ +E +AT+++ +++ +FI+CW+PF I ++++  C+    P+  +     TW GY NS++NPI+YT  N EFR +F
Sbjct:   35 YAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTATRDDSV----------------CEIAN-PAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRV------NTKRNCQKADAEPQPPLKQLLIK------EVVQPGTGVEMGLMTSTSPPEKMKLAAPP----------AVNLLATQSPSHASPL---HEEWQPHDDEKNGHAKDAQTPKETKSFETQALPNGKTRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCYVPLEMYNAF--TWLGYVNSAVNPIIYTTFNVEFRKAF 417          
BLAST of GCR014 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 159.073 bits (401), Expect = 6.776e-43
Identity = 113/440 (25.68%), Postives = 208/440 (47.27%), Query Frame = 2
Query:  125 FSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSS-SHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCI-------------SVEFLLPQTPLWEMKLSTNNSELNPNED--------------SKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            ++++ +++    V GN+++ + +S  + L+TT N LI +LA++D+L+A  V+P  +  +  G W F    C+I++  DV+ CTAS+ +L  I+ DRYTA   P+ Y +  S  RR    I VVW LS  I  P + G   +  ++  +                C++ N P +V+YS++ SF +P II   VY++I+ ++ +++         NT  NC   +      LK K          T    ++    V+   ++L            + GL                +V  L  Q+P     L   + E  P++D              +K F  ++  +   +     ++ +   ++ +E +AT+++ +++ +FI+CW+PF I ++++  C+    P+  +     TW GY NS++NPI+YT  N EFR +F
Sbjct:   35 YAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTATRDDSV----------------CEIAN-PAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRV------NTKRNCQKADAEPQPPLKEKCTHPEDVKLCTVIVKTNGSLPVKNKKAQLLIKEVVQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPL---HEEWQPHDDEKNGHAKDAQTPKETKSFETQALPNGKTRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCYVPLEMYNAF--TWLGYVNSAVNPIIYTTFNVEFRKAF 446          
BLAST of GCR014 vs. Ensembl Cavefish
Match: drd2b (D(2) dopamine receptor A [Source:NCBI gene;Acc:103035621])

HSP 1 Score: 157.918 bits (398), Expect = 1.149e-42
Identity = 119/438 (27.17%), Postives = 212/438 (48.40%), Query Frame = 2
Query:  125 FSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSS-SHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTE--------TDENSSDP---DCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNED--------------SKRFTXXXXXXXXXXXXXANSIVR---AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            ++++ +++    V GN+++ + +S  + L+TT N LI +LA++D+L+A  V+P  +  +  G W F    C+I++  DV+ CTAS+ +L  I+ DRYTA   P+ Y +  S  RR    I VVW LS  I  P + G   +  ++  +                C++ N P +V+YS++ SF +P II   VY++I+ ++ +++         NT  NC   +      LK K      TH E           N S P      VQ  T     + +S S  +  +     +V  L  Q+P     L   + E  P++D              +K F  ++  +   +     ++ +   ++ +E +AT+++ +++ +FI+CW+PF I ++++  C+    P+  +     TW GY NS++NPI+YT  N EFR +F
Sbjct:   29 YAMLLTLLIFVIVFGNVLVCMAVSREKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWRFSKIHCDIFVTLDVMMCTASILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMISVVWVLSFAISCPLLFGLNNTATRDDSV----------------CEIAN-PAFVVYSSIMSFYVPFIITLLVYVQIYVVLRKRRKRV------NTKRNCQKADAEPQPPLKEKC-----THPEDVKLCTVIVKTNGSLPVKNKKVVQPGTGVEMGLMTSTSPPEKMKLAAPPAVNLLATQSPSHASPL---HEEWQPHDDEKNGHAKDAQTPKETKSFETQALPNGKTRTTVTKTMSKRKMSQHKEKKATQMLAIVLGVFIICWLPFFITHILKTHCTSCYVPLEMYNAF--TWLGYVNSAVNPIIYTTFNVEFRKAF 433          
BLAST of GCR014 vs. Ensembl Cavefish
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 155.606 bits (392), Expect = 3.733e-42
Identity = 123/396 (31.06%), Postives = 185/396 (46.72%), Query Frame = 2
Query:  167 GNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            GNL+ +I +  +R L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C I+L  DVL+CTAS+  L  I+ DRY +    + Y      RR K  I+VVW ++++I  P +   T      P+            +    CQ+  + +Y+I S +GSF LP IIM  VYIRI+ I   +       D +  DD     N      L     +      + D N+ D + S  +        AS   + K K  L  I                     ++N  E++ R TK S                 + RE R T ++ +++ +F++CW PF   Y +RALC ES C V   L     WFGY NSS+NPI+YTI N +FR +F+
Sbjct:   29 GNLLAVIAVFTSRALKAPQNLFLVSLASADILVATLVMPFSLANELMGYWYFGPVWCKIYLALDVLFCTASIAHLCAISLDRYWSITRAVEYNLKRTPRRIKCVILVVWVIAAVISFPPL---TIMKEDEPI------------NDPPSCQINKDKWYIISSCIGSFFLPCIIMVLVYIRIYQIAKSRTRT-PPGDRRKRDDE-KKENGHCHERLNGDAANGNDKDDKGDVNAVDMEESSSSDHKVTNPCASKKKRAKGKTKLSQIK-----------------PGDDINKRENANRGTKSSRWKGR------------QNREKRFTFVLAVVIGVFMICWFPFFFTYTLRALC-ESCC-VNETLFKFFFWFGYCNSSLNPIIYTIFNNDFRRAFK 376          
BLAST of GCR014 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008360.1 (pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1 gene:ENSPMAG00000007563.1 transcript:ENSPMAT00000008360.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 4.578e-25
Identity = 67/227 (29.52%), Postives = 114/227 (50.22%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQ----CQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATL 808
            S I L T+ GN ++ I +  ++ L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C ++L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I++VW ++++I  P ++G TG    N           + SS        C+L  E +YV+ S   SF  P +IM  VY RI+ +   +   + +  ++      S++      L
Sbjct:   41 SFIILVTIFGNSLVAIAVFTSKSLKAAQNLFLVSLAAADILVATLVMPFSLANELMGYWVFGSFWCEMYLALDVLFCTSSIVHLCAISLDRYWSVTQAVRYNMKRTPRRVKRAIVIVWVIAALISFPPLVG-TGRPPANIHRHRHQGSGRNASSSPSSVLPTCKLNEETWYVLSSCTASFFTPCLIMLLVYARIYQVAKGRARHWIRGGSERESPFPSAFESQADEL 266          

HSP 2 Score: 67.781 bits (164), Expect = 1.848e-12
Identity = 29/75 (38.67%), Postives = 47/75 (62.67%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            RE R T ++ ++M +F+ CW PF   Y +  +C E+ C    +L     W GY NSS+NP++YT+ N++FR +F+
Sbjct:  387 REKRFTFVLAVVMGVFVACWFPFFFSYSLTKIC-EASCKPPEYLFKFFFWCGYCNSSLNPLIYTVFNQDFRRAFK 460          
BLAST of GCR014 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009127.1 (pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 gene:ENSPMAG00000008256.1 transcript:ENSPMAT00000009127.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 9.142e-25
Identity = 70/218 (32.11%), Postives = 114/218 (52.29%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI--INQKKNLFSKSDTQNTD 769
            I S+  + + L  + GN  +I  I+  R L+  AN LIG+LA++D+L++  VLP+A +      W  G  +C+I++  DVL CT+S+  L +IA DRY A   PI Y +    RR    I + W +   I IP ++GW     + P          ++ +    C++  +  Y IYS  G+F +PLI+M  +Y RIF       +KN+   ++ ++ D
Sbjct:   38 ISSLCLTALILCAIFGNSCVIAAIALERTLQNVANYLIGSLAVTDLLVSILVLPMAALYQVLDRWTLGQVVCDIFIALDVLCCTSSILHLCVIALDRYWAITNPIDYVNKRTPRRAVIMISLTWLVGFSISIPPMLGW-----RTP----------EDRADPNACKISQDHGYTIYSTFGAFYIPLILMLVLYSRIFRAARFRIRKNVKKATEKKSFD 240          
BLAST of GCR014 vs. Ensembl Sea Lamprey
Match: adra2c (adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752])

HSP 1 Score: 100.523 bits (249), Expect = 4.880e-23
Identity = 61/194 (31.44%), Postives = 100/194 (51.55%), Query Frame = 2
Query:  143 MITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIIN 724
            ++   TV GN ++II +     L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C I+L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I++VW ++  I +P +I                N Q      +  C+L    +Y++ S +GSF  P +IM  VY RI+ ++ 
Sbjct:   60 ILVFATVFGNCLVIIAVLTRPSLKAPQNLFLVSLATADILVATLVIPFSLFNELMGYWYFGRVWCEIYLALDVLFCTSSIVHLCAISLDRYWSVSQAVEYNIKRTPRRIKRIIVIVWFIAIAISLPPLISMNQ-----------KNRQQQEEVGRPNCELNTNTWYILGSCIGSFFAPCLIMVLVYARIYHLVK 242          

HSP 2 Score: 77.7962 bits (190), Expect = 1.327e-15
Identity = 32/78 (41.03%), Postives = 50/78 (64.10%), Query Frame = 2
Query: 1121 AEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            A+ RE R T ++ +++ +F++CW PF   Y + ALCS   C +   L     WFGY NS +NP++YT+ NR+FR +F+
Sbjct:  374 AQARERRFTFVLSVMIGVFVICWFPFFFTYSLSALCSPESCAIPETLFKFFFWFGYCNSCLNPVIYTVFNRDFRRAFK 451          
BLAST of GCR014 vs. Ensembl Sea Lamprey
Match: HTR1F (5-hydroxytryptamine receptor 1F [Source:HGNC Symbol;Acc:HGNC:5292])

HSP 1 Score: 97.0561 bits (240), Expect = 5.405e-22
Identity = 62/193 (32.12%), Postives = 95/193 (49.22%), Query Frame = 2
Query:  194 SHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDD 772
            S  R LR  AN LIG+LA++D+L+AA V+P+A      G W  G  +C++WL+ DV  CTAS+  L  IA DR+ A      Y       R    I   W L++ I +P +  W     ++P  K    +++D+              Y IYS  G+F +PL ++  +Y RIF      K L+ K +++  + 
Sbjct:   73 SATRKLRQPANYLIGSLAVADLLVAALVMPVAAAYVVTGEWALGGALCDLWLSLDVTCCTASILHLCAIALDRFWAITDAAEYAHKRTPGRAALMIAASWLLAACISVPPLF-WRR---RDPA-KPRCIIEHDHV------------LYTIYSTFGAFYVPLALLLALYCRIF---RAAKRLYEKRESKQREK 245          

HSP 2 Score: 70.8626 bits (172), Expect = 1.826e-13
Identity = 32/75 (42.67%), Postives = 49/75 (65.33%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            RE RA K + LI+  F++CW+PF I  +V  LC    C V   +  ++TW GY NS INP++YT+ N +F+++F+
Sbjct:  346 RERRAAKTLGLILGAFVVCWLPFFIKELVVNLCKS--CAVSPEVADLLTWLGYMNSLINPLIYTMFNEDFKSAFR 418          
BLAST of GCR014 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001357.1 (pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 gene:ENSPMAG00000001226.1 transcript:ENSPMAT00000001357.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 1.052e-21
Identity = 98/395 (24.81%), Postives = 169/395 (42.78%), Query Frame = 2
Query:  158 TVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI----INQKKNLFSKSDTQN-TDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEM-----KLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPI 1312
            ++ GN  ++  I   R L+T AN LIG+LA++D+L++  VLP+A +    G W  G  +C+ ++  DVL CT+S+  L  IA DRY A   P+ Y +    RR    I + W +   I IP ++GW                Q ++ +    C +     Y IYS  G+F +PL++M  +Y +IF+     I +     S S T N + D      +             +    +  +N S  +C++QT  S        +    +   L+ I +  ++P + +        KL++ N +     +  R +      +  +   +NSI      +T  T ++           +PF         C    C +   L  ++TW GY+NS +NP+
Sbjct:   16 SIAGNAFVLAAIYLERSLQTVANYLIGSLAVTDLLVSVLVLPVAALYQVLGRWTLGQAVCDAFIALDVLCCTSSILHLCAIALDRYWAITDPVDYVNKRTPRRAALMIAITWVVGFSISIPPMLGWR---------------QAEDRADPDACNISQHLGYTIYSTFGAFYIPLVLMLVLYGKIFSAARFRIRKNVAFKSASHTDNGSADGPMDREEADGDGGGGSGGGRVGQERKRSQNMSSYNCNLQTIGSN------QLIISSNISNLQTI-IMMMMPISSIVISSSNLRKLNSRNLQRTRGSNRNRISSNRCMKSNLQISSSNSI--NNDLQTNLTTLV-----------VPF---------CGPP-CELPPILMALITWLGYSNSLLNPV 365          
BLAST of GCR014 vs. Ensembl Nematostella
Match: EDO36609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI86])

HSP 1 Score: 82.0333 bits (201), Expect = 4.412e-17
Identity = 67/233 (28.76%), Postives = 111/233 (47.64%), Query Frame = 2
Query:   89 EMESIPE-WALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAI-VNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI-INQKKNLFS-KSDTQNTDDN 775
             M+++PE +    F II  ++TL+   GN ++++ +   R +RT  N  + +LA+SD+L+A   LP  I        W   +  C  W+  D++   AS+W+LV+I+ DR+ A   P  Y +          I  VW LS ++ +   I WT  G   P    F             C  F+  YY + S +  F LPL I+  +Y  +FT+ + Q + + + ++D Q T D 
Sbjct:   21 SMDTLPENYGHVAFEIIILLVTLY---GNFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIMCAGASIWNLVIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYG--KPHFNIF-----------ISCANFDPIYYTVLSVV-LFFLPLFIVFVMYGHVFTVALTQARAVAALQTDRQATTDG 236          

HSP 2 Score: 48.1358 bits (113), Expect = 4.212e-6
Identity = 24/81 (29.63%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMVRA-----LCSESICP--VYRWLQIIVTWFGYANSSINPILYTILNREFRNSF 1351
            +E +A K++ +++  F++CW P+ ++ +V       L  ++I P       Q  V+     NS++NPI+Y + N++FR SF
Sbjct:  246 KEVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRDTISPEQAKGINQTFVSALPVLNSTLNPIIYALFNKDFRRSF 326          
BLAST of GCR014 vs. Ensembl Nematostella
Match: EDO36608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI85])

HSP 1 Score: 81.2629 bits (199), Expect = 4.716e-17
Identity = 66/232 (28.45%), Postives = 113/232 (48.71%), Query Frame = 2
Query:   92 MESIPEWALYI-FSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAI-VNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI-INQKKNLFS-KSDTQNTDDN 775
            M+++PE+  ++ F II  ++T +   GN ++++ +   R +RT  N  + +LA+SD+L+A   LP  I        W   +  C  W+  D++   AS+W+L +I+ DR+ A   P  Y +          I  VW LS ++ +   I WT  G   P    F +           C  F+  YY + S +  F LPL I+  +Y R+FT+ +N  + + + ++D Q T D 
Sbjct:    1 MDTLPEYYGHMAFQIIILLVTFY---GNFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVATLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYG--KPHFNIFIS-----------CANFDPIYYTVVSVV-LFFLPLYIVFVMYGRVFTVALNHARAVAALQTDRQATTDG 215          
BLAST of GCR014 vs. Ensembl Nematostella
Match: EDO28321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T3])

HSP 1 Score: 81.2629 bits (199), Expect = 5.628e-17
Identity = 66/232 (28.45%), Postives = 113/232 (48.71%), Query Frame = 2
Query:   92 MESIPEWALYI-FSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAI-VNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI-INQKKNLFS-KSDTQNTDDN 775
            M+++PE+  ++ F II  ++T +   GN ++++ +   R +RT  N  + +LA+SD+L+A   LP  I        W   +  C  W+  D++   AS+W+L +I+ DR+ A   P  Y +          I  VW LS ++ +   I WT  G   P    F +           C  F+  YY + S +  F LPL I+  +Y R+FT+ +N  + + + ++D Q T D 
Sbjct:    1 MDTLPEYYGHMAFQIIILLVTFY---GNFMVVLAVVMFRRMRTITNYFVVSLAVSDLLVAMLSLPFRIHQTTHNTAWCLSLEACVAWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYG--KPHFNIFIS-----------CANFDPIYYTVVSVV-LFFLPLYIVFVMYGRVFTVALNHARAVAALQTDRQATTDG 215          
BLAST of GCR014 vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 80.1073 bits (196), Expect = 1.000e-16
Identity = 65/222 (29.28%), Postives = 102/222 (45.95%), Query Frame = 2
Query:  146 ITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGH---WPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSH---QYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTI-INQKKNLFSKSDTQNTDDNCSSYN 790
            I L T  GN ++++ +     +RT  N  + +LA+SD+L+A   LP  I      H   W  G+  C  W+  D++ C AS+W+L MI+ DR+ A   P  Y +          I  VW LS  + +  +I WT  G                S H   + QC+ F+  YY + S +G F LPL I+  +Y ++F + +NQ + + +           SS N
Sbjct:    8 ILLVTFYGNFMVVLAVVLFHRMRTITNYFVVSLAVSDLLVATLSLPFRIHQT--THNTAWCLGLEACVAWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTELG----------------SPHFHIEVQCRKFDPVYYTVVSVVG-FFLPLFIVLLMYGQVFVVAMNQARAVAALQTDSKRRGRRSSIN 210          

HSP 2 Score: 48.9062 bits (115), Expect = 2.048e-6
Identity = 26/81 (32.10%), Postives = 47/81 (58.02%), Query Frame = 2
Query: 1130 RETRATKIMLLIMVIFILCWIPFTIMYMV-----RALCSESICP-VYRWLQIIVTW-FGYANSSINPILYTILNREFRNSF 1351
            +E +A KI+ +++  F++CW PF ++ +V      AL  E+I     R + +   +     NS++NPI+Y + NR+FR +F
Sbjct:  213 KEVKAAKILAIVVGCFVVCWFPFFVLTLVSLWEPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAF 293          
BLAST of GCR014 vs. Ensembl Nematostella
Match: EDO32513 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUW3])

HSP 1 Score: 80.1073 bits (196), Expect = 1.796e-16
Identity = 93/409 (22.74%), Postives = 161/409 (39.36%), Query Frame = 2
Query:  143 MITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGH-----WPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPY-YVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIP-FTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNS 1348
            ++ L  ++GN ++  T+   R L  +A  L+ +LA++D+++  ++LPL+I     G      W F   +C+     +  +C ASV++L  ++ DRY A   P+ Y       + +  I V+W +S                    + F   +    S   + C        Y + SA+  FI+PLI +     RI +I   +     K   Q       SY             SS K+ TE +   S    +++  T++                          PQ P  E  L    S   PN   K +                   +  +RE +  K+ +++  +F++CW P F  M M   L + ++  +  +  I+    GYANS+ N  +Y+  NREFRN+
Sbjct:    4 ILMLVIIVGNTLVFRTVFVTRRLHFSAFYLVASLAIADLMVGVSLLPLSIAYTIIGEMKGGEWSFSPVVCHAGTLFNFWFCCASVFNLCAVSWDRYVAVTSPLLYTVRMDDAKVRWTIAVIWVVSLF------------------MSFLIMVAVIESKTVFYCTATGLAVEYSLSSALVIFIIPLIFLVFANGRIMSIARAQL----KKIKQQMPYGYDSYED-----------SSSKSRTEAETLPSTTVTNLEQITTK--------------------------PQEP--EQNLDFQESIQIPNTSKKLY------------------FQRFRREFKTFKLFVIVTGVFLVCWTPLFVTMVMSSFLRTWTMVSIMHFALIL----GYANSACNVFIYSYFNREFRNA 329          
BLAST of GCR014 vs. Ensembl Medaka
Match: adra2a (adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750])

HSP 1 Score: 173.711 bits (439), Expect = 1.050e-48
Identity = 125/425 (29.41%), Postives = 202/425 (47.53%), Query Frame = 2
Query:  113 ALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIIN----------QKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNE-DSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            AL +  ++  MI+L  V GN++++I +  +R LR   NL + +LA +D+L+A  V+P ++ N+  G W FG   C I+L  DVL+CTAS+  L  I+ DRY +    I Y      RR K  I++VW ++++I  P +I                 ++ +N S    C++ +E +YVI S +GSF LP IIM  VY+RI+ I            Q+K L S           +   +P   L   K         +        +  V+ +  +++  +SS  K      +            P    K  T  S++ P + D +R           +  +A+     + RE R T ++ +++ +F++CW PF   YM++ LCS   C V   L     WFGY NS++NPI+YTI N +FR +F+
Sbjct:   16 ALPLSVLVGVMISL-IVFGNVLVVIAVFTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMGFWYFGKVWCEIYLALDVLFCTASIAHLCAISLDRYWSITQAIEYNLKRTPRRIKSIIVIVWVIAAVISFPPLI----------------TMEKENGSESPVCKINDEKWYVISSCIGSFFLPCIIMVLVYVRIYQIAKKRTRAPPGDRQQKGL-SGPGAAAAGQRENGVGEPDDGLCHEKLNGEQDVELKEGVERGADEAKVEVNGGDMEESSSSDHKADHPCSI------------PKKSAKGKTRLSQVKPGDADPQR---------RAQSAKASRWKGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYMLKTLCSS--CYVPTALFNFFFWFGYCNSALNPIIYTIFNHDFRRAFK 399          
BLAST of GCR014 vs. Ensembl Medaka
Match: ENSORLT00000005282.2 (pep primary_assembly:ASM223467v1:9:8571029:8576106:1 gene:ENSORLG00000004220.2 transcript:ENSORLT00000005282.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 3.569e-45
Identity = 119/420 (28.33%), Postives = 185/420 (44.05%), Query Frame = 2
Query:  122 IFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQK-KNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDC--SVQTHTSELXXXXXXXXXXXXXQGLRCISV------EFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            I S++   + L ++ GN  ++  I+  R L+  AN LIG+LA++D++++  VLP+A +      W  G  IC+++++ DVL CT+S+  L  IA DRY A   PI Y +     R    I   W +   I IP ++GW  +               ++ ++   C +  +P Y IYS  G+F +PLI+M  +Y RIF     + +    K +T    D C + + P     K    S  +     D +     C      H  E              + L  I V         LP TP        N +E N     K                      A  RE +  K + +IM  FI CW+PF I+ +V   C ES C +  WL  ++ W GY+NS +NPI+Y   N++F+N+F+
Sbjct:   44 ITSLLLGALILCSIFGNACVVAAIALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQEICDLFISLDVLCCTSSILHLCAIALDRYWAITDPIDYVNKRTPMRAVLLICATWLIGFSISIPPMLGWRSA---------------EDRANPDACMISQDPGYTIYSTFGAFYIPLILMLVLYGRIFRAARFRIRKTVKKIETAKVSDKCLAVS-PAFFHKKSNGQSGGRGWKRCDGSKPSSPCVNGAVMHGDE-------------GESLEIIEVISNSKTHLPLPNTPQSSSHGYENMNERNSGAKRK---------------------LALSRERKTVKTLGIIMGTFIFCWLPFFIVALVLPFCPES-CFMPDWLGAVINWLGYSNSLLNPIIYAYFNKDFQNAFK 412          
BLAST of GCR014 vs. Ensembl Medaka
Match: ADRA2C (adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC:283])

HSP 1 Score: 163.31 bits (412), Expect = 1.223e-44
Identity = 118/405 (29.14%), Postives = 197/405 (48.64%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S + L+TV+GN++++I +  +R L+   NL + +LA +D+L+A  V+P ++ N+  G+W FG   C I+L  DVL+CT+S+  L  I+ DRY +    + Y      RR K  I++VW +S+ I  P            P++    N   ++ S Q QC+L +E +Y++ S++ SF  P +IM  VYIRI+ +   +    S S+ +   D  +      + +  P    +   H       S    +    T E+    SS S+ K     R  S      Q      K S +    + +  S +          ++R        ++ RE R T ++ ++M +F++CW PF   Y +  +C +S C +   L     W GY NSS+NP +YTI NR+FR++FQ
Sbjct:   43 SFLILFTVVGNILVVIAVLTSRALKAPQNLFLVSLATADILVATLVMPFSLANELMGYWYFGKVWCGIYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRIKCTILIVWLVSAFISSP------------PLVSIDRN---NDISSQPQCELNDETWYILSSSIASFFAPCLIMILVYIRIYQVAKTRTR--SMSEKKPKPDGVTQTENGLSKVSSPLHGEAENGHCHCPPTPSQRTVTTGPQTQEVDVEESSSSEGKGHNPQRQDS------QRARKARKSSFSKHSAHISRVSNKSMDLFASRRKRRRSSFARKKVSQAREKRFTFVLAVVMGVFVMCWFPFFFSYSLYGVCRDS-CRIPDPLFKFFFWIGYCNSSLNPAIYTIFNRDFRHAFQ 423          
BLAST of GCR014 vs. Ensembl Medaka
Match: htr1ab (5-hydroxytryptamine (serotonin) receptor 1A b [Source:ZFIN;Acc:ZDB-GENE-090409-2])

HSP 1 Score: 160.614 bits (405), Expect = 5.951e-44
Identity = 118/431 (27.38%), Postives = 197/431 (45.71%), Query Frame = 2
Query:   83 SSEMESIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQK-KNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVE------FLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S E E +      + S +   + L  + GN  ++  I   R L+  AN LIG+LA++D++++  VLP+A +      W  G   C+I+++ DVL CT+S+  L  IA DRY A   PI Y      RR    I V W +   I +P ++          V++       ++ ++  QC++  +P+Y IYS  G+F +PL +M  +Y RIF     + +    K++ +   D+C + +            S        D        SV+     L ++  ++   +  + L  I V         LP TP     +    S  +   ++KR                     A  RE +  K + +IM  FILCW+PF I+ +V   C ES C + RWL+ ++ W GY+NS +NPI+Y   N++F+++F+
Sbjct:    7 SVEKEDMKLSYQVVTSFLLGALILCAIFGNACVVAAIVLERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNSWTLGQVPCDIFISLDVLCCTSSILHLCAIALDRYWAITEPIDYMKKRTPRRAAVLISVTWLVGFSISVPPML----------VMRSQPGSMAEDRANPKQCKIRQDPWYTIYSTFGAFYIPLTLMLVLYGRIFKAARFRIRRTVRKTEKKKVADSCLAISP-----------SLFHKTPHGDAQGKSWKRSVEPRPLALPSVNGAVKHAEDGESLEIIEVHSNSRGNLPLPNTP---STVPLFESRHDKATEAKRKI-------------------ALARERKTVKTLGIIMGTFILCWLPFFIVALVMPFCQES-CYMPRWLEDVINWLGYSNSLLNPIIYAYFNKDFQSAFK 393          
BLAST of GCR014 vs. Ensembl Medaka
Match: ENSORLT00000042787.1 (alpha-2B adrenergic receptor-like [Source:NCBI gene;Acc:101155866])

HSP 1 Score: 160.999 bits (406), Expect = 1.525e-43
Identity = 122/460 (26.52%), Postives = 214/460 (46.52%), Query Frame = 2
Query:  113 ALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSH-QYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTII--------NQKKNLFSKSDTQNTD----------------------------DNCSSYN--QPTATLLK-PKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEK---RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESIC---PVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            A   FSI+ + + + T++GN+++II +  +R LR   NL + +LA +D+L+A  V+P ++  +  G W F    C I    DVL+CTAS+  L  IA DRY +   P+ Y ++   RR K  I++VW +++++  P +                  L  D     + +C+  ++P+Y++YS +GSF  P +IM  VYIRI+ I          +K+  F  + T +T+                             +C+ +N  +P  +  + P   S+   +   D   ++ + +V T +SE      SI +     G      +   P         +++ ++L P + +K               +   I R +    RE R T ++ ++M +F++CW PF   Y ++A+C E      P++R+      W GY NS +NPI+YTI NR+FR +F+
Sbjct:   26 ATAAFSIVMTSMMILTIVGNILVIIAVLMSRSLRGPQNLFLVSLAAADILVALIVVPFSMAYELLGCWVFSSIWCEIHKALDVLFCTASIVHLCAIALDRYLSISRPVSYGTTRSRRRIKSAIVMVWLIAAVVSFPPL------------------LYLDTKDKVKGKCEPDDKPWYILYSTIGSFFAPCVIMILVYIRIYQIAKRHMHCPPGEKRRSFYGAATDDTEMKSLPEESQKDVGQRAPAAPELSLTTVHTDCAQWNDKKPAESPTEGPPLFSTAVPNAARDLPKAEGEDAVHTSSSESDTELQSIEEGDRAGGGGSPKAQVQSPTCRYKNTIKTSSGTKLLPEDTAK--------------TQETPISRHKAMINREKRFTLVLAVVMGVFVVCWFPFFFSYSLKAVCPEKYQVPDPLFRFF----FWSGYCNSCLNPIIYTIFNRDFRTAFK 449          
BLAST of GCR014 vs. Planmine SMEST
Match: SMESG000031038.1 (SMESG000031038.1)

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 421/421 (100.00%), Postives = 421/421 (100.00%), Query Frame = 2
Query:   92 MESIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            MESIPEWALYIFSIIPSMITLWTVIGNLIIIITISHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELKAIASSISKKKSKQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTKKSYRSNYKKRRRANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ
Sbjct:    1 MESIPEWALYIFSIIPSMITLWTVIGNLIIIITISHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELKAIASSISKKKSKQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTKKSYRSNYKKRRRANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 421          
BLAST of GCR014 vs. Planmine SMEST
Match: SMESG000047573.1 (SMESG000047573.1)

HSP 1 Score: 206.838 bits (525), Expect = 1.679e-60
Identity = 102/197 (51.78%), Postives = 140/197 (71.07%), Query Frame = 2
Query:  140 SMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQK 730
            S++ LWT+IGN +++I++   + LR+ +N+LIGNLALSD+LLA TV+PLA +ND  G+W  G+ +CN+WL  DVLYCTAS+WSLV IA DR+TAT FP WYR      R   YI +VW LS  IC+P +IGW G   K+P   F  N Q++N +   +C LF+E  YVIYS+MGSFI+PL+I+   Y +IF +I ++
Sbjct:   19 SVLVLWTIIGNCLVLISLVKFKQLRSNSNILIGNLALSDILLALTVMPLAEMNDVLGYWTMGLVMCNVWLTLDVLYCTASIWSLVAIAFDRFTATSFPSWYREKVSSERVIVYIALVWILSVGICLPPVIGWNGVTLKDPSEIFHKNYQHNNMTKLDECILFSERNYVIYSSMGSFIVPLLILLIFYAKIFIVIQRR 215          

HSP 2 Score: 81.6481 bits (200), Expect = 2.767e-16
Identity = 40/79 (50.63%), Postives = 56/79 (70.89%), Query Frame = 2
Query: 1118 RAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            + +++E RATK M LI++ FILCWIPFT+MY+ R+L   +I      ++  + W GY+NS INPILYTI N +FR SF+
Sbjct:  403 KVDRKEQRATKRMALIIIGFILCWIPFTVMYLTRSLF-PTITYNDHTIKFFI-WLGYSNSGINPILYTIFNLDFRKSFK 479          
BLAST of GCR014 vs. Planmine SMEST
Match: SMESG000056795.1 (SMESG000056795.1)

HSP 1 Score: 183.341 bits (464), Expect = 6.829e-53
Identity = 113/420 (26.90%), Postives = 203/420 (48.33%), Query Frame = 2
Query:   98 SIPEWALYIFSIIPSMITLWTVIGNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVY-RWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            S+  W + + SI   +I   T++GN+++I+++ ++R LR   N LI +LA +D+ +A+ V+P A++N   G W FG  +C+ WL +DV  CTAS+ +L  IA DRY A  +P+ Y +   +R     I   + LS +I IP ++GW                  +   + Y C L +   YV++SA GSFI+P +++  VYIRI+  I ++             D     NQ    L+K + + + +  ++ + +  +  C +                                  TP    K++  N+  +   +S +  +                  +  +E ++ + M +IM +F++CW PF +MY++   CS S+C    + +++ + W GY NS++NPI+YTI N++FR++F 
Sbjct:    9 SLENWEIVLGSISAILIIFITIVGNILVILSVIYHRPLRKVQNFLIISLAAADLSVASLVMPFALINYILGRWIFGSVLCDFWLTSDVFCCTASILNLCAIALDRYWAINYPLDYVNKRTIRTILSVICGAYILSGLISIPPLLGWK-----------------EEMKNLYVCSLSDNRIYVLFSAFGSFIIPTVVIFFVYIRIYFAIRKR-----------LRDKIKFINQNDRLLMKKETVKNKRKDSKENSSLENETCKI----------------------------------TPTCSNKVNNENTNFSSVNNSDKLNQFWNERQKI----------SLSKERKSARTMGIIMGVFVICWSPFFLMYVIVPFCSASVCQNRNQRVEVFLVWLGYVNSALNPIIYTIFNKDFRDAFH 356          
BLAST of GCR014 vs. Planmine SMEST
Match: SMESG000025945.1 (SMESG000025945.1)

HSP 1 Score: 168.318 bits (425), Expect = 6.745e-47
Identity = 115/403 (28.54%), Postives = 195/403 (48.39%), Query Frame = 2
Query:  167 GNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEK----RETRATKIMLLIMVIFILCWIPFTIMYMVRALCSESIC---PVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            GN +I+I +   R L+T  N  + +LA++D+L++ TVLPL I  +  G W  G H+C  W++ D+L CTAS+ +L  I+ DRY A   P+ Y +    +     I++ W LS II +P +IGW+   F N                   C++     + IYS++GSF +PLI+M  VY+RIF I N +K L +              +Q +  +   K  S+  ++   D  +S+P    +    +L         + + +  + + +   L Q P+       N   +  + + + FT  S          + S    E     RE +  K++ +++  F++CW+PF  +Y++ +LCS+ I    P+   L   VTW GY NS++NP LY   N+E+  +F+
Sbjct:   23 GNSLILIAVLTTRHLQTVTNFYVVSLAIADLLVSGTVLPLTIAKELHGKWVLGKHVCQFWVSMDILLCTASILNLCCISIDRYMAITKPLVYATKRSYKLAGCMILIAWILSVIISVPPVIGWSDHNFTNTT-----------------CEISIHLGFRIYSSLGSFFIPLILMIFVYLRIFAIANYRKILLNS-------------HQSSRNIKSNKNSSNSLSYKSLDFQTSNPSSQQRRQALDL---------ESNPKHAQALKLNSYLCQRPIHRSCALQN--LIYKSGNLQNFTNLSTGCAVLSSGLSQSQKGKETAAFLREHKTAKVIAMVIGCFVVCWLPFFTIYVLESLCSQRILCPYPIGSLLVKSVTWLGYINSALNPFLYAFYNKEYARTFK 384          
BLAST of GCR014 vs. Planmine SMEST
Match: SMESG000044639.1 (SMESG000044639.1)

HSP 1 Score: 163.696 bits (413), Expect = 3.592e-45
Identity = 118/399 (29.57%), Postives = 194/399 (48.62%), Query Frame = 2
Query:  167 GNLXXXXXXSHNRFLRTTANLLIGNLALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSLVMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTGSGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMSGVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKTHTETDENSSDPDCSVQTHTSELXXXXXXXXXXXXXQGLRCISVEFLLPQTPLWEMKLSTNNSELNPNEDSKRFTXXXXXXXXXXXXXANSIVRAEKRETRATKIMLLIMVIFILCWIPFTIMYMVRALC---SESICPVYRWLQIIVTWFGYANSSINPILYTILNREFRNSFQ 1354
            GN +++I IS +  L+   N  +G+LA++D+LL   +LP ++ N+  G W FG  +C++WL  DVL CTAS+  L +I+ DRY +   PI Y++S    R    II  W +S +IC+P + GW+             +L +  SS++ +C+L     YV+YS++GSF +PL+I+  VY+++F    ++ N            N   +        K + +     +TE  +N     C+     SE                + CI V+   P          TNN E   ++  +    +S     K   R + +VR   RE R   ++ +++  FI+CW+PF   Y++   C   +E +   + WL       GY NS +NPI+YT+ NR+FR +FQ
Sbjct:   39 GNSLVLIAISTDYRLKNIQNWFLGSLAIADLLLGILILPFSLFNEIFGRWIFGRLLCSLWLAIDVLLCTASIMHLCLISIDRYYSIVRPIQYKTSRTPNRVLAMIIAAWIISGLICLPPLFGWSS-----------HSLNFSISSNEQKCELTQNRAYVLYSSIGSFYIPLLIIIIVYLQVFIEAKRRANRKYVVKKPEVKKNPELFR-------KKEVVEVDIEYTEIQQN-----CNCNQVDSE---------------AISCI-VDDDDPSV--------TNNQEPLNSQKHRIDRIQSKNIISKLAIRKSKLVRY--RERRTIVVLGVVVGAFIVCWLPFFTSYLIVIFCKCMNEHLFGFFFWL-------GYCNSGLNPIIYTVYNRDFRKAFQ 381          
The following BLAST results are available for this feature:
BLAST of GCR014 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DRD23.082e-4127.63dopamine receptor D2 [Source:HGNC Symbol;Acc:HGNC:... [more]
ADRA2A1.472e-4027.29adrenoceptor alpha 2A [Source:HGNC Symbol;Acc:HGNC... [more]
HTR1A4.277e-4026.895-hydroxytryptamine receptor 1A [Source:HGNC Symbo... [more]
DRD31.154e-3527.45dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
DRD31.154e-3527.45dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of GCR014 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ser-21.661e-4128.88Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-21.938e-4128.64Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-22.008e-4128.64Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
ser-22.300e-4128.64Tyramine receptor Ser-2 [Source:UniProtKB/Swiss-P... [more]
octr-12.910e-4129.64OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of GCR014 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dop2R8.857e-3525.88gene:FBgn0053517 transcript:FBtr0343171[more]
Dop2R3.571e-3425.91gene:FBgn0053517 transcript:FBtr0343167[more]
Oct-TyrR4.824e-3338.05gene:FBgn0004514 transcript:FBtr0078479[more]
Oct-TyrR4.824e-3338.05gene:FBgn0004514 transcript:FBtr0301930[more]
5-HT71.185e-3126.56gene:FBgn0004573 transcript:FBtr0334508[more]
back to top
BLAST of GCR014 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FP236542.11.186e-4427.83alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
FP236542.11.186e-4427.83alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
adra2c4.236e-4428.88adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
adra2c4.236e-4428.88adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
adra2c5.193e-4428.88adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
back to top
BLAST of GCR014 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADRA2B1.734e-4127.36adrenoceptor alpha 2B [Source:NCBI gene;Acc:100485... [more]
DRD21.785e-4126.91dopamine receptor D2 [Source:NCBI gene;Acc:1004930... [more]
ENSXETT00000046867.11.861e-3726.995-hydroxytryptamine (serotonin) receptor 1A, G pro... [more]
ENSXETT00000026158.14.089e-3425.18alpha-2Db adrenergic receptor-like [Source:NCBI ge... [more]
ENSXETT00000011711.15.543e-2933.33adrenoceptor alpha 1B [Source:NCBI gene;Acc:100488... [more]
back to top
BLAST of GCR014 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adra2a1.880e-4226.79adrenergic receptor, alpha 2a [Source:MGI Symbol;A... [more]
Adra2a1.880e-4226.79adrenergic receptor, alpha 2a [Source:MGI Symbol;A... [more]
Adra2c1.622e-4127.58adrenergic receptor, alpha 2c [Source:MGI Symbol;A... [more]
Htr1a1.185e-4027.185-hydroxytryptamine (serotonin) receptor 1A [Sourc... [more]
Adra2b1.511e-3926.56adrenergic receptor, alpha 2b [Source:MGI Symbol;A... [more]
back to top
BLAST of GCR014 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01670|OAR2_LYMST1.176e-5041.67Octopamine receptor 2 OS=Lymnaea stagnalis OX=6523... [more]
sp|Q93126|GPR9_AMPAM4.087e-4529.62Probable G-protein coupled receptor No9 OS=Amphiba... [more]
sp|Q25188|OAR_HELVI4.608e-4527.48Octopamine receptor OS=Heliothis virescens OX=7102... [more]
sp|Q90WY6|ADA2C_DANRE3.198e-4328.88Alpha-2C adrenergic receptor OS=Danio rerio OX=795... [more]
sp|O42384|5H1AB_TAKRU5.086e-4327.035-hydroxytryptamine receptor 1A-beta OS=Takifugu r... [more]
back to top
BLAST of GCR014 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUG10.000e+0100.00GCR014 OS=Schmidtea mediterranea OX=79327 GN=gcr01... [more]
A0A183PIL21.395e-7439.86G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
G4VFR62.241e-7239.00Putative 5-hydroxytryptamine receptor OS=Schistoso... [more]
A0A183QLK48.190e-6939.47G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1Q1NIM91.168e-6734.73Putative octopamine/tyramine receptor OS=Crassostr... [more]
back to top
BLAST of GCR014 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra2b8.733e-4527.54adrenoceptor alpha 2B [Source:NCBI gene;Acc:266751... [more]
drd2b3.598e-4326.23D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2b6.776e-4325.68D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
drd2b1.149e-4227.17D(2) dopamine receptor A [Source:NCBI gene;Acc:103... [more]
adra2a3.733e-4231.06adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
back to top
BLAST of GCR014 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008360.14.578e-2529.52pep scaffold:Pmarinus_7.0:GL477173:168532:170490:1... [more]
ENSPMAT00000009127.19.142e-2532.11pep scaffold:Pmarinus_7.0:GL478629:43196:44446:-1 ... [more]
adra2c4.880e-2331.44adrenoceptor alpha 2C [Source:NCBI gene;Acc:266752... [more]
HTR1F5.405e-2232.125-hydroxytryptamine receptor 1F [Source:HGNC Symbo... [more]
ENSPMAT00000001357.11.052e-2124.81pep scaffold:Pmarinus_7.0:GL478256:17157:19157:1 g... [more]
back to top
BLAST of GCR014 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of GCR014 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO366094.412e-1728.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366084.716e-1728.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283215.628e-1728.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366101.000e-1629.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325131.796e-1622.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of GCR014 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adra2a1.050e-4829.41adrenoceptor alpha 2A [Source:NCBI gene;Acc:266750... [more]
ENSORLT00000005282.23.569e-4528.33pep primary_assembly:ASM223467v1:9:8571029:8576106... [more]
ADRA2C1.223e-4429.14adrenoceptor alpha 2C [Source:HGNC Symbol;Acc:HGNC... [more]
htr1ab5.951e-4427.385-hydroxytryptamine (serotonin) receptor 1A b [Sou... [more]
ENSORLT00000042787.11.525e-4326.52alpha-2B adrenergic receptor-like [Source:NCBI gen... [more]
back to top
BLAST of GCR014 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031038.10.000e+0100.00SMESG000031038.1[more]
SMESG000047573.11.679e-6051.78SMESG000047573.1[more]
SMESG000056795.16.829e-5326.90SMESG000056795.1[more]
SMESG000025945.16.745e-4728.54SMESG000025945.1[more]
SMESG000044639.13.592e-4529.57SMESG000044639.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026106 ID=SMED30026106|Name=GCR014|organism=Schmidtea mediterranea sexual|type=transcript|length=1524bp
ATTTTGTGCAAACAGGTCTACCTCATCCTCTGACGTCTCTGGTAGCTCGA
TGGACGGAAGGAAAACTGAAGATTTATCTTAAAGTTCTGAAATGGAATCC
ATTCCAGAATGGGCATTGTATATATTTTCAATTATTCCTTCAATGATAAC
ATTGTGGACTGTCATCGGGAATTTGATCATCATTATAACAATCTCCCATA
ACCGATTTCTAAGAACAACCGCAAACTTATTAATCGGGAATCTCGCTTTG
AGTGACATGTTATTGGCAGCTACAGTTTTACCATTAGCAATAGTCAATGA
CTTTTGTGGACACTGGCCATTTGGAGTTCATATTTGTAACATTTGGCTCA
ATACGGATGTACTGTATTGTACAGCCTCTGTATGGAGTCTAGTGATGATA
GCTTGTGATCGTTATACCGCCACAAAGTTTCCAATTTGGTATAGGTCAAG
TTCTCACGTCAGACGGACGAAACCTTATATTATTGTTGTTTGGTCTTTGT
CTTCAATAATATGCATCCCCCAAATCATTGGCTGGACTGGAAGTGGTTTT
AAAAATCCAGTTATAAAGTTTTTTAGTAATTTACAATACGACAATAGCTC
CCATCAATACCAGTGTCAGTTATTCAACGAACCGTATTATGTGATATATT
CCGCAATGGGATCTTTCATTTTACCCTTAATTATAATGTCGGGTGTATAC
ATTCGAATATTTACAATTATTAATCAAAAAAAGAATCTTTTTTCCAAATC
AGACACTCAAAATACAGATGATAACTGCTCGTCCTACAACCAACCAACAG
CGACATTGTTAAAACCAAAATTTATTTCCTCAATGAAAACGCACACAGAA
ACCGATGAAAATAGTTCTGATCCTGATTGTTCTGTCCAAACTCATACGAG
CGAACTAAAAGCCATAGCATCCTCAATTTCCAAAAAGAAATCAAAACAAG
GTCTACGATGCATATCAGTAGAATTTCTGCTGCCACAGACCCCTTTATGG
GAAATGAAATTAAGCACAAACAACTCAGAACTCAATCCCAATGAGGATTC
AAAGAGATTCACTAAGAAAAGCTACAGATCCAATTACAAAAAACGTCGAC
GAGCAAATAGTATAGTTCGTGCGGAAAAACGAGAGACACGCGCCACGAAG
ATCATGTTATTAATAATGGTTATTTTTATTTTATGCTGGATCCCTTTCAC
TATTATGTACATGGTGCGTGCTTTATGTAGCGAATCCATTTGTCCGGTTT
ATCGCTGGCTGCAGATTATCGTCACCTGGTTCGGCTATGCTAATAGTTCT
ATAAATCCGATTTTGTACACAATTCTTAACAGAGAATTTCGAAATAGTTT
CCAGAAACTCCTAAAGCGCCGCTGATTATTGAAATCGGGTTCCAAAATCA
ACTGTTTTCCTTTGGAATTTTTACAAGATTGAGCTGGTTTTGAATTTCCG
GATGAATTGAGATTTTTTGACTGTTTGTTTTGTTGAATTACTAACTAAAT
ATAATTTGAGAGTTCCAAAAAAAA
back to top

protein sequence of SMED30026106-orf-1

>SMED30026106-orf-1 ID=SMED30026106-orf-1|Name=SMED30026106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=428bp
MESIPEWALYIFSIIPSMITLWTVIGNLIIIITISHNRFLRTTANLLIGN
LALSDMLLAATVLPLAIVNDFCGHWPFGVHICNIWLNTDVLYCTASVWSL
VMIACDRYTATKFPIWYRSSSHVRRTKPYIIVVWSLSSIICIPQIIGWTG
SGFKNPVIKFFSNLQYDNSSHQYQCQLFNEPYYVIYSAMGSFILPLIIMS
GVYIRIFTIINQKKNLFSKSDTQNTDDNCSSYNQPTATLLKPKFISSMKT
HTETDENSSDPDCSVQTHTSELKAIASSISKKKSKQGLRCISVEFLLPQT
PLWEMKLSTNNSELNPNEDSKRFTKKSYRSNYKKRRRANSIVRAEKRETR
ATKIMLLIMVIFILCWIPFTIMYMVRALCSESICPVYRWLQIIVTWFGYA
NSSINPILYTILNREFRNSFQKLLKRR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 351..375
score: 28.37
coord: 125..146
score: 23.42
coord: 89..111
score: 33.99
coord: 391..417
score: 33.93
coord: 11..35
score: 18.79
coord: 184..207
score: 29.77
coord: 44..65
score: 33.31
IPR000276G protein-coupled receptor, rhodopsin-likeSMARTSM013817TM_GPCR_Srsx_2coord: 24..424
e-value: 0.0081
score: -68.1
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 26..409
e-value: 1.3E-64
score: 218.1
NoneNo IPR availableGENE3DG3DSA:1.10.530.40coord: 215..235
e-value: 2.0E-52
score: 180.4
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 295..427
e-value: 1.1E-27
score: 98.9
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 17..214
e-value: 2.0E-52
score: 180.4
NoneNo IPR availablePANTHERPTHR24248ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 8..426
NoneNo IPR availablePANTHERPTHR24248:SF66coord: 8..426
NoneNo IPR availableCDDcd149677tmA_amine_R-likecoord: 11..420
e-value: 7.09392E-67
score: 212.038
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 4..427
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 182..204
NoneNo IPR availableTMHMMTMhelixcoord: 130..152
NoneNo IPR availableTMHMMTMhelixcoord: 44..66
NoneNo IPR availableTMHMMTMhelixcoord: 390..412
NoneNo IPR availableTMHMMTMhelixcoord: 353..375
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 26..409
score: 44.384