Reticulocalbin-1

Overview
NameReticulocalbin-1
Smed IDSMED30026101
Length (bp)1200
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reticulocalbin-1 (SMED30026101) t-SNE clustered cells

Violin plots show distribution of expression levels for Reticulocalbin-1 (SMED30026101) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reticulocalbin-1 (SMED30026101) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reticulocalbin-1 (SMED30026101) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026101

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026101h1SMcG0016863 dd_Smed_v4_5905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026101h1SMcG0016863 dd_Smed_v4_5905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026101h1SMcG0016863 dd_Smed_v4_5905_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026101h1SMcG0016863 Contig31304newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026101h1SMcG0016863 Contig31304uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026101h1SMcG0016863 Contig30821newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026101h1SMcG0016863 Contig30821uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026101h1SMcG0016863 Contig17263uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026101h1SMcG0016863 Contig17263newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30026101h1SMcG0016863 SMED30003044smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30026101h1SMcG0016863 SMED30003044smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30026101h1SMcG0016863 SMED30003044smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 2 cellSMED30026101h1SMcG0016863 dd_Smed_v6_5905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026101h1SMcG0016863 dd_Smed_v6_5905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30026101h1SMcG0016863 dd_Smed_v6_5905_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: RCN1 (reticulocalbin 1 [Source:HGNC Symbol;Acc:HGNC:9934])

HSP 1 Score: 153.68 bits (387), Expect = 9.841e-43
Identity = 98/276 (35.51%), Postives = 162/276 (58.70%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS---DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +E+SK FD L+ DE K R G+I+D++D D D  V++ ELK W+K + ++ + ++V   WK    +  + I++++Y + T+G  +  P           +KK+   ++++++ ADLN D    + EF  FLHP EFE MK IV  E LE +D N D F+D +EY+A++FS   +  + D  L E E   F    D+NKDG LD +EI+ W LP  Y+  + E +H++   D +++E L+K E+L  +N+F+ S+ ++  +  T  H+EL
Sbjct:   58 YDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQ--FNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL 331          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 152.525 bits (384), Expect = 2.305e-42
Identity = 88/269 (32.71%), Postives = 154/269 (57.25%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G+I+ K+D D D  V+  ELK+W+K   ++ + EDVE  WK         +++++Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 152.14 bits (383), Expect = 3.103e-42
Identity = 88/269 (32.71%), Postives = 154/269 (57.25%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G+I+ K+D D D  V+  ELK+W+K   ++ + EDVE  WK         +++++Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   55 YDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDGDKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 323          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 151.369 bits (381), Expect = 5.161e-42
Identity = 88/269 (32.71%), Postives = 153/269 (56.88%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G I+DK+D D D  V+  ELK+W+K   +K + ++VE  W+         I++ +Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Human
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 151.369 bits (381), Expect = 6.726e-42
Identity = 88/269 (32.71%), Postives = 153/269 (56.88%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G I+DK+D D D  V+  ELK+W+K   +K + ++VE  W+         I++ +Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   55 YDHDAFLGAEEAKTFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNTDEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 323          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 114.39 bits (285), Expect = 1.052e-28
Identity = 66/263 (25.10%), Postives = 141/263 (53.61%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPEN--SETINFQKYFEHTFG------QKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEI-----FSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            +D    L ++ +  FD L+ ++ K +  +++ KMD D D  +   ELK+ +  + ++ +  DV+  WK    E      I ++ Y E  +G      Q++S  Y K+   ++K+W  AD + +  L++TE+  F+HP + + M+ +V  E ++ +D N D  +D++EY+ ++     + ++   +   ++ E   F+   D + DG L+ EE++ W +P  ++  E E +H++ + D +++  L+  E++  Y+ F+ S+ +D
Sbjct:   39 YDHEQFLGKDTAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIVDGKIKWEDYREMVYGSADGAGQELSPEYAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATD 301          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-1 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:H2L0I1])

HSP 1 Score: 114.39 bits (285), Expect = 1.052e-28
Identity = 66/263 (25.10%), Postives = 141/263 (53.61%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPEN--SETINFQKYFEHTFG------QKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEI-----FSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            +D    L ++ +  FD L+ ++ K +  +++ KMD D D  +   ELK+ +  + ++ +  DV+  WK    E      I ++ Y E  +G      Q++S  Y K+   ++K+W  AD + +  L++TE+  F+HP + + M+ +V  E ++ +D N D  +D++EY+ ++     + ++   +   ++ E   F+   D + DG L+ EE++ W +P  ++  E E +H++ + D +++  L+  E++  Y+ F+ S+ +D
Sbjct:   39 YDHEQFLGKDTAAEFDELTPEKSKEKLAKLVPKMDADSDGFIEENELKDHINFMQKRYVNNDVDRTWKNYKAEKIVDGKIKWEDYREMVYGSADGAGQELSPEYAKMIARDEKRWAVADYDSNGALDRTEYGCFMHPEDCDHMRDVVVAETVDDIDKNKDGSVDLDEYIGDMYRPDDYPELNGKEPDWVQSEREMFKEHRDKDGDGKLNQEEMRDWIMPVGFDHAEAEARHLVGIADDNKDGKLNLDEIVAHYDTFVGSQATD 301          
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Match: calu-2 (CALUmenin (Calcium-binding protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q9TYS8])

HSP 1 Score: 51.2174 bits (121), Expect = 4.506e-7
Identity = 43/155 (27.74%), Postives = 71/155 (45.81%), Query Frame = 2
Query:  560 ADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQ---KPTLGHEEL 1015
            AD + D  LN  E   FL+P     M P++    L   D N D  ++  E+L E+  + +  +   +E E   F+   D NKDG L  +E+  W L         E + ++   D D++  LS  E++  + +F K++ + E     P   H+EL
Sbjct:  135 ADEDNDGKLNLEELASFLNPEHHPHMHPVLIAVTLLEKDQNGDGAIEEKEFLGEL-DEQRGSEWYKVEVER--FRTVYDKNKDGKLAGDELTDWLLVDGTTAGSYEAESLLTNSDDDKDGQLSYEEIVKHHALFAKTEAAQEADHLHPYYSHDEL 286          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: scf (gene:FBgn0025682 transcript:FBtr0089942)

HSP 1 Score: 158.303 bits (399), Expect = 1.025e-44
Identity = 89/275 (32.36%), Postives = 153/275 (55.64%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG------------QKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDR--TLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            FD    L  +ESK FDSL+ +E + R G I+D++D++ D  V+  ELKNW+     + + EDV   WK  +P+N+ETI++  Y +  +G            ++  + YK L K ++ +W  AD + DD L K EF  FLHP +   MK +V  E +  +D ++D  + ++EY+ +++      D     + +E   F    D++KDG L+ EE+++W  P  ++  E E KH++   D D ++ L+K E+L+KY++F+ S+ +D  +    H+E 
Sbjct:   55 FDHEAFLGPDESKKFDSLTPEESRRRLGVIVDRIDENKDGSVTLAELKNWIAYTQRRYIEEDVGRVWKQHNPDNNETISWDSYMQTVYGFMDDLSPDEKEQEENGVSYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 329          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: scf (gene:FBgn0025682 transcript:FBtr0089941)

HSP 1 Score: 99.3673 bits (246), Expect = 3.551e-24
Identity = 54/171 (31.58%), Postives = 96/171 (56.14%), Query Frame = 2
Query:  509 SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT--LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
             + YK L K ++ +W  AD + DD L K EF  FLHP +   MK +V  E +  +D ++D  + ++EY+ +++      D     + +E   F    D++KDG L+ EE+++W  P  ++  E E KH++   D D ++ L+K E+L+KY++F+ S+ +D  +    H+E 
Sbjct:   22 GVSYKSLLKRDRYRWSVADQDLDDNLTKDEFTAFLHPEDHPSMKGVVLRETITDLDKDHDGKISVDEYIGDMYRSTGAEDEEPEWVANEREAFSTHRDLDKDGYLNEEEVKQWIAPHDFDHSEAEAKHLLFEADADHDDKLTKEEILDKYDVFVGSQATDFGEALARHDEF 192          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301907)

HSP 1 Score: 99.7525 bits (247), Expect = 3.911e-23
Identity = 78/259 (30.12%), Postives = 134/259 (51.74%), Query Frame = 2
Query:  242 SLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG------QKVSIPY------XXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            ++I   +E++ FDSLS DE K R   +I  MD + D  +   ELK W+    +K   E+    ++ I  +  E I +++Y + T+       +K +I Y      +K+ K +K+ +  AD NKD +L   EF+ F +P E  +M PI+ E  ++  D ++D  ++  E++ +  S     D+  +  E   F  D D N DGVL  +E+  W +P++     +EV H+    D D ++ LS  E+LN Y+ F+ S+ +D
Sbjct:   72 AIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHH---DKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0301905)

HSP 1 Score: 99.7525 bits (247), Expect = 3.911e-23
Identity = 78/259 (30.12%), Postives = 134/259 (51.74%), Query Frame = 2
Query:  242 SLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG------QKVSIPY------XXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            ++I   +E++ FDSLS DE K R   +I  MD + D  +   ELK W+    +K   E+    ++ I  +  E I +++Y + T+       +K +I Y      +K+ K +K+ +  AD NKD +L   EF+ F +P E  +M PI+ E  ++  D ++D  ++  E++ +  S     D+  +  E   F  D D N DGVL  +E+  W +P++     +EV H+    D D ++ LS  E+LN Y+ F+ S+ +D
Sbjct:   72 AIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHH---DKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Match: CG31650 (gene:FBgn0031673 transcript:FBtr0079033)

HSP 1 Score: 99.7525 bits (247), Expect = 3.911e-23
Identity = 78/259 (30.12%), Postives = 134/259 (51.74%), Query Frame = 2
Query:  242 SLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG------QKVSIPY------XXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            ++I   +E++ FDSLS DE K R   +I  MD + D  +   ELK W+    +K   E+    ++ I  +  E I +++Y + T+       +K +I Y      +K+ K +K+ +  AD NKD +L   EF+ F +P E  +M PI+ E  ++  D ++D  ++  E++ +  S     D+  +  E   F  D D N DGVL  +E+  W +P++     +EV H+    D D ++ LS  E+LN Y+ F+ S+ +D
Sbjct:   72 AIIGNTKEAQEFDSLSPDESKRRLLILIKMMDLNKDEFIDRHELKAWILRSFKKLSEEEAADRFEEIDQDADERITWKEYLQDTYAMEDEDFKKETIDYDSYEDEQKMIKQDKEMFNAADTNKDGVLTLEEFVLFQNPEEHPQMLPILLEHTMQDKDADHDGKINFQEFVGDAASHH---DKEWLITEKERFDKDHDSNGDGVLTGDEVLSWIVPSNTAIANDEVDHLFVSTDEDHDDRLSYLEILNNYDTFVGSEATD 327          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 168.703 bits (426), Expect = 9.252e-49
Identity = 104/310 (33.55%), Postives = 168/310 (54.19%), Query Frame = 2
Query:  113 LTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L  C+ L +       T   D       L       G +F +D    L EEE+K FD L+ +E K+R G+I++K+D D D  V+  ELK W+K   +K + ++VE  WK     N   I++++Y   T+G  +  P       YK++   ++++++ AD N D + +K EF  FLHP E+E MK IV  E +E +D N D F+D+ EY+ ++++   ++D    +  E   F    D NKDG +D EE   W LPA Y+  E E KH++   D +++  L+K E+LNKY++F+ S+ +D  +  + H+E 
Sbjct:    8 LLMCFALCVVYATSKPTEKKDRVHHDAPLSSKEHDDGTNFEYDHDAFLGEEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calua (calumenin a [Source:NCBI gene;Acc:415241])

HSP 1 Score: 168.703 bits (426), Expect = 9.252e-49
Identity = 104/310 (33.55%), Postives = 168/310 (54.19%), Query Frame = 2
Query:  113 LTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L  C+ L +       T   D       L       G +F +D    L EEE+K FD L+ +E K+R G+I++K+D D D  V+  ELK W+K   +K + ++VE  WK     N   I++++Y   T+G  +  P       YK++   ++++++ AD N D + +K EF  FLHP E+E MK IV  E +E +D N D F+D+ EY+ ++++   ++D    +  E   F    D NKDG +D EE   W LPA Y+  E E KH++   D +++  L+K E+LNKY++F+ S+ +D  +  + H+E 
Sbjct:    8 LLMCFALCVVYATSKPTEKKDRVHHDAPLSSKEHDDGTNFEYDHDAFLGEEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 158.303 bits (399), Expect = 9.750e-45
Identity = 88/269 (32.71%), Postives = 156/269 (57.99%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV-------SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L +EE+K FD L+ +E K R G+I++K+D+DHD  V++ E+K W+K    + + EDV+  W+     +   +++++Y   T+G  +          Y+++   ++++++ AD + D   NK EF  FLHP EF+ MK IV  E +E +D N D  +D+NEY+ +++S +    +   ++ E   F    D NKDG +D +E + W LPA Y+  E E KH++   D D++  L+K E+++KY++F+ S+ +D     + H+E 
Sbjct:   47 YDHEAFLGQEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEYKNATYGYILDEADPEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSSEPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: calub (calumenin b [Source:NCBI gene;Acc:394057])

HSP 1 Score: 156.377 bits (394), Expect = 8.074e-44
Identity = 86/258 (33.33%), Postives = 152/258 (58.91%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV-------SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            +D    L +EE+K FD L+ +E K R G+I++K+D+DHD  V++ E+K W+K    + + EDV+  W+     +   +++++Y   T+G  +          Y+++   ++++++ AD + D   NK EF  FLHP EF+ MK IV  E +E +D N D  +D+NEY+ +++S +    +   ++ E   F    D NKDG +D +E + W LPA Y+  E E KH++   D D++  L+K E+++KY++F+ S+ +D
Sbjct:   47 YDHEAFLGQEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEYKNATYGYILDEADPEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSSEPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATD 304          
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Match: rcn1 (reticulocalbin 1, EF-hand calcium binding domain [Source:ZFIN;Acc:ZDB-GENE-080225-33])

HSP 1 Score: 144.821 bits (364), Expect = 1.315e-39
Identity = 87/274 (31.75%), Postives = 159/274 (58.03%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +EE+  FD L+ +E K+R G+I++++D + D  +++ ELK W+K + ++ + E+V   W          I++ +Y + T+G  ++ P           +KK+   ++++++TADL+ +   +K EF  FLHP EF  M+ IV  E LE +D N D  +D +EY+A++F+ +    +   +  E   F +  D+NKDG +D EEI+ W LP  Y+  + E +H++   D D++++LSK E+L  +N+F+ S+ ++  +  T  H+EL
Sbjct:   47 YDHEAFLGKEEATTFDQLTPEESKARLGKIVERIDSNVDGFITTDELKAWIKRVQKRYVYENVAKVWTDYDLNKDNKISWDEYKQATYGYYLANPEEFEDATDQFSFKKMLPRDERRFKTADLDGNLAADKEEFTAFLHPEEFAHMQEIVVLETLEDIDKNGDGHVDEDEYIADMFAHEDAGPEPDWVRTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLVYESDTDKDQMLSKEEILENWNMFVGSQATNYGEDLTRNHDEL 320          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: fgf11 (fibroblast growth factor 11 [Source:Xenbase;Acc:XB-GENE-479522])

HSP 1 Score: 157.147 bits (396), Expect = 4.017e-44
Identity = 94/273 (34.43%), Postives = 163/273 (59.71%), Query Frame = 2
Query:  236 DGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            D    L ++++K FD L+ +E K R G+II+++D D D  +++ EL  W+K + ++ + E+V   WK        TI++++Y + T+G  ++ P           +KK+   ++++++ ADLN D   N+ EF  FLHP EFE MK IV  E LE +D N D F+D +EY+A++FS +  + +   +  E   F +  DINKDG +D EEI+ W LP  Y+  + E +H++   D+D++++L+K E+L  +N+F+ S+ ++  +  T  H+EL
Sbjct:   49 DHEAFLGKDDAKTFDQLTPEESKDRLGKIINRIDSDSDGLITTEELTAWIKRVQKRYVYENVARVWKDYDVNKDNTISWEEYKQATYGYYLANPEEFQDAAEQFSFKKMLPRDERRFKQADLNGDLEANREEFTSFLHPEEFEHMKDIVILETLEDIDKNGDGFVDQDEYIADMFSHEEGQPEPDWVATEREQFADFRDINKDGKMDKEEIRHWILPQDYDHAQAEARHLIYESDLDKDKVLTKEEVLQNWNMFVGSQATNYGEDLTRNHDEL 321          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 144.05 bits (362), Expect = 2.928e-39
Identity = 84/269 (31.23%), Postives = 150/269 (55.76%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G I+ K+D D D  V+  EL++W+    ++ + EDVE  WK         +++++Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP EF+ MK IV  E +E +D N D  +D+ EY+ ++++ D    +   ++ E   F    D N DG +D EE + W LP+ Y+  E E +H++   D +++  L++ E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKTFDQLTPEESKERLGRIVGKIDADKDGYVTVNELRDWIIFAQKRWIYEDVERQWKGHDLNGDSMVSWEEYKNATYGYILDDPDPDNSFNYKQMMVRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDANEPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 142.895 bits (359), Expect = 8.224e-39
Identity = 84/261 (32.18%), Postives = 150/261 (57.47%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG-----------QKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMS 979
            +D    L +EE++ FD L+ +E + R G+I+DK+DKD D  V+  ELK WMK    + + E+V  HW        + I++++Y   T+G            K    Y+K+   ++++++ AD + D +  + EF  FLHP E+  M+ IV  E +E +D N+D  +D++EY+A++++ +  + +   ++ E   F +  DINKDG +D  EI +W LP  Y+  + E KH++   D D++  L+K E+L+ +N+F+ S+ +
Sbjct:   48 YDHEAFLGKEEARTFDQLTPEESQHRLGKIVDKIDKDKDGFVTDIELKEWMKHSQNRYIYENVNKHWADYDKNKDDMISWEEYKNTTYGYLPGEEFYDVADKDKERYRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQAT 308          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: calu (calumenin [Source:NCBI gene;Acc:407965])

HSP 1 Score: 138.658 bits (348), Expect = 2.575e-37
Identity = 83/269 (30.86%), Postives = 149/269 (55.39%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G I+ K+D D+D  V+  EL  W+K   +K + ++VE  W+         +++ +Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP EF+ MK IV  E +E +D N D  +D+ EY+ ++++ D    +   ++ E   F    D N DG +D EE + W LP+ Y+  E E +H++   D +++  L++ E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKTFDQLTPEESKERLGMIVSKIDLDNDGYVTEGELTAWIKKAQKKYVYDNVERQWQEFDLNQDGLVSWDEYRNVTYGTYLDDPDPDNSFNYKQMMVRDERRFKMADQDGDLIATKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLEEYIGDMYNHDGDANEPEWVKTEREQFVEFRDKNHDGKMDKEETKDWILPSDYDHAEAESRHLVYESDQNKDSKLTREEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:395023])

HSP 1 Score: 135.576 bits (340), Expect = 5.565e-36
Identity = 81/263 (30.80%), Postives = 149/263 (56.65%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMS 979
            +D    L +EE++ FD L+ +E + R G+IID+MDKD+D  ++S EL  W+K +  +  +ED E   K         I++ +Y +  +G  +                Y+K+   ++++++ AD + D +  + EF  FLHP E+  M+ IV  E +E +D N+D  +D++EY+A++++ +  + +   ++ E   F +  DINKDG +D  EI +W LP  Y+  + E KH++   D D++  L+K E+L+ +N+F+ S+ +
Sbjct:   48 YDHEAFLGKEEARTFDQLTPEESQHRLGKIIDQMDKDNDKYITSGELFAWIKHVSRRWNLEDSEKQGKKYDTNKDGMISWDEYAKGVYGHLLGKGEEFYDVADKDKERYRKMMMRDERRFKVADKDGDLIATREEFTAFLHPEEYGYMQDIVITETIEDIDKNDDGIVDVHEYIADMYTPNEDEPEPDWVKTERQQFTDFRDINKDGKMDRTEISQWILPHDYDHADLEAKHLVYESDKDKDGKLTKKEILDNWNMFVGSQAT 310          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn1 (reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559])

HSP 1 Score: 157.532 bits (397), Expect = 2.114e-44
Identity = 98/276 (35.51%), Postives = 165/276 (59.78%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS---DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +E+SK FD LS DE K R G+I+D++D D D  V++ ELK W+K + ++ + ++V   WK    +  E I++++Y + T+G  +  P           +KK+   ++++++ +DL+ D    + EF  FLHP EFE MK IV  E LE +D N D F+D +EY+A++FS   +  + D  L E E   F +  D+NKDG LD +EI+ W LP  Y+  + E +H++   D +++E+L+K E+L+ +N+F+ S+ ++  +  T  H+EL
Sbjct:   52 YDHEAFLGKEDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQ--FNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL 325          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 152.14 bits (383), Expect = 2.259e-42
Identity = 88/269 (32.71%), Postives = 154/269 (57.25%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K+FD L+ +E K R G I+DK+D D D  V+  ELK+W+K   +K + ++VE  W+         I++ +Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKSFDQLTPEESKERLGMIVDKIDADKDGFVTEGELKSWIKHAQKKYIYDNVENQWQEFDMNQDGLISWDEYRNVTYGTYLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Calu (calumenin [Source:MGI Symbol;Acc:MGI:1097158])

HSP 1 Score: 151.754 bits (382), Expect = 2.616e-42
Identity = 88/269 (32.71%), Postives = 154/269 (57.25%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K+FD L+ +E K R G+I+ K+D D D  V+  ELK W+K   ++ + EDVE  WK         +++++Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKSFDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 134.806 bits (338), Expect = 7.238e-36
Identity = 78/263 (29.66%), Postives = 140/263 (53.23%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMD--KDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQ----------KVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            +D    L  + +K FD LS +E ++R G I+D+MD   D D  VS  EL+ W+    ++ + + V   W T   +    + +++    T+G           + +  YKK+   +++++  AD + D +  + E   FLHP EF  M+ IV  E LE +D N D ++ + EY+A+++S +  + +   ++ E   F+   D+NKDG LD  E+  W LP S ++   E  H++   D D++  LSK E+L+ +N+F+ S+ ++
Sbjct:   54 YDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATN 316          
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Match: Rcn3 (reticulocalbin 3, EF-hand calcium binding domain [Source:MGI Symbol;Acc:MGI:1277122])

HSP 1 Score: 134.806 bits (338), Expect = 7.238e-36
Identity = 78/263 (29.66%), Postives = 140/263 (53.23%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMD--KDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQ----------KVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            +D    L  + +K FD LS +E ++R G I+D+MD   D D  VS  EL+ W+    ++ + + V   W T   +    + +++    T+G           + +  YKK+   +++++  AD + D +  + E   FLHP EF  M+ IV  E LE +D N D ++ + EY+A+++S +  + +   ++ E   F+   D+NKDG LD  E+  W LP S ++   E  H++   D D++  LSK E+L+ +N+F+ S+ ++
Sbjct:   54 YDHEAFLGRDVAKEFDKLSPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSEEPGEEEPAWVQTERQQFREFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATN 316          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q6IQP3|CALUA_DANRE (Calumenin-A OS=Danio rerio OX=7955 GN=calua PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 7.370e-48
Identity = 104/310 (33.55%), Postives = 168/310 (54.19%), Query Frame = 2
Query:  113 LTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L  C+ L +       T   D       L       G +F +D    L EEE+K FD L+ +E K+R G+I++K+D D D  V+  ELK W+K   +K + ++VE  WK     N   I++++Y   T+G  +  P       YK++   ++++++ AD N D + +K EF  FLHP E+E MK IV  E +E +D N D F+D+ EY+ ++++   ++D    +  E   F    D NKDG +D EE   W LPA Y+  E E KH++   D +++  L+K E+LNKY++F+ S+ +D  +  + H+E 
Sbjct:    6 LLMCFALCVVYATSKPTEKKDRVHHDAPLSSKEHDDGTNFEYDHDAFLGEEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|B5X186|CALUA_SALSA (Calumenin-A OS=Salmo salar OX=8030 GN=calua PE=2 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.088e-46
Identity = 96/271 (35.42%), Postives = 159/271 (58.67%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS---DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L ++E+K+FD LS +E K R G I++K+D D D  V+  EL+ W+K   +K + E+V+  WK     N   I++++Y   T+G  +  P       Y+ +   ++++++ AD N+D + NK EF  FLHP E++ MK IV  E +E +D N D F+D+NEY+ ++++   +M++ D    E E   F    D NKDG +D EE   W LP+ Y+  E E KH++   D +++  LSK E+LNKY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGQKEAKSFDDLSPEESKRRLGVIVEKIDGDSDGFVTEVELRAWIKKAQKKYIYENVDRQWKDFDVNNDGMISWEEYRNVTYGTYLDDPEPDDGYNYQHMMARDERRFKMADQNRDQIANKEEFTAFLHPEEYDHMKDIVVLETMEDIDKNGDGFIDLNEYIGDMYNHEDEMEEPDWVATEREQ--FSEFRDKNKDGKMDREETMDWILPSDYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q7SXV9|CALUB_DANRE (Calumenin-B OS=Danio rerio OX=7955 GN=calub PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.757e-44
Identity = 88/269 (32.71%), Postives = 157/269 (58.36%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV-------SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L +EE+K FD L+ +E K R G+I++K+D+DHD  V++ E+K W+K    + + EDV+  W+     +   +++++Y + T+G  +          Y+++   ++++++ AD + D   NK EF  FLHP EF+ MK IV  E +E +D N D  +D+NEY+ +++S +    +   ++ E   F    D NKDG +D +E + W LPA Y+  E E KH++   D D++  L+K E+++KY++F+ S+ +D     + H+E 
Sbjct:   47 YDHEAFLGQEEAKTFDQLTPEESKERLGKIVEKIDEDHDGFVTADEMKRWIKHAQRRWIYEDVDRQWQAHDLNSDSFVSWEEYKDATYGYILDEADPEDGFNYRQMMTRDERRFKMADQDGDLRANKEEFTAFLHPEEFDYMKDIVVLETMEDIDKNGDGLIDLNEYIGDMYSQNGDSSEPEWVKTEREQFTEFRDKNKDGRMDKDETRDWILPADYDHAEAEAKHLLYESDADKDGRLTKQEIVDKYDLFVGSQATDFGDALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q05186|RCN1_MOUSE (Reticulocalbin-1 OS=Mus musculus OX=10090 GN=Rcn1 PE=1 SV=1)

HSP 1 Score: 157.532 bits (397), Expect = 1.479e-43
Identity = 98/276 (35.51%), Postives = 165/276 (59.78%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS---DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +E+SK FD LS DE K R G+I+D++D D D  V++ ELK W+K + ++ + ++V   WK    +  E I++++Y + T+G  +  P           +KK+   ++++++ +DL+ D    + EF  FLHP EFE MK IV  E LE +D N D F+D +EY+A++FS   +  + D  L E E   F +  D+NKDG LD +EI+ W LP  Y+  + E +H++   D +++E+L+K E+L+ +N+F+ S+ ++  +  T  H+EL
Sbjct:   52 YDHEAFLGKEDSKTFDQLSPDESKERLGKIVDRIDSDGDGLVTTEELKLWIKRVQKRYIYDNVAKVWKDYDRDKDEKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKASDLDGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEDNGPEPDWVLSEREQ--FNDFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEMLTKEEILDNWNMFVGSQATNYGEDLTKNHDEL 325          
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Match: sp|Q6XLQ7|CALU_RABIT (Calumenin OS=Oryctolagus cuniculus OX=9986 GN=CALU PE=1 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 4.405e-42
Identity = 88/269 (32.71%), Postives = 154/269 (57.25%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  EE+K FD L+ +E K R G+I+ K+D D D  V+  ELK+W+K   ++ + EDVE  WK         +++++Y   T+G  +  P       YK++   ++++++ AD + D +  K EF  FLHP E++ MK IV +E +E +D N D F+D+ EY+ +++S     D    ++ E   F    D N+DG +D EE + W LP+ Y+  E E +H++   D +++  L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHDAFLGAEEAKTFDQLTPEESKERLGKIVSKIDADKDGFVTVDELKDWIKFAQKRWIYEDVERQWKGHDLNEDGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFLHPEEYDYMKDIVVQETMEDIDKNGDGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEFRDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A3S2PK98 (Uncharacterized protein OS=Chilo suppressalis OX=168631 GN=evm_001508 PE=4 SV=1)

HSP 1 Score: 175.252 bits (443), Expect = 7.286e-48
Identity = 103/319 (32.29%), Postives = 179/319 (56.11%), Query Frame = 2
Query:  110 MLTSCYI-LLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG-------QKVSIP------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS---DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            ML + ++ L +  +   +  +F + E  K+   + QF  D F      L E+++K FD LS +E K R G I+D++D D D  V+  ELK+W++   ++ + EDVE HWK  +P+N ETI ++ Y ++ +G       +++  P      Y  L K ++++W  AD ++DD LN+TEF  FLHP E   M+ IV  E LE +D +ND  + I+EY+ +++       + +   ++ E   F    D NKDG +D +E+++W  P  ++  E E +H++   D D +E L+K E+L+K+++F+ S+ +D  +    H+E 
Sbjct:    1 MLRTLFVSLAVSAETKKLVQHFSDAEHFKNEHHNKQFDHDAF------LGEDQAKTFDQLSPEESKRRLGIIVDRIDSDKDGFVTLVELKDWIRYTQKRYIDEDVERHWKQHNPQNEETIPWETYRKNVYGFMDEMDEKELRAPNSEGFTYSSLLKRDRRRWHYADGDQDDALNRTEFSAFLHPEEHTGMRDIVVLETLEDVDKDNDGKVSIDEYIGDLYKTEDGEDEEEPDWVKQEREQFTGYRDTNKDGYMDADEVKEWIAPPEFDHAEAEARHLVFEADADADERLTKQEVLDKHDLFVGSQATDFGEAFARHDEF 313          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A5E4QM45 (Uncharacterized protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS9951 PE=4 SV=1)

HSP 1 Score: 171.4 bits (433), Expect = 1.957e-46
Identity = 104/321 (32.40%), Postives = 174/321 (54.21%), Query Frame = 2
Query:  110 MLTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF----FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFG-----------QKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS--DMKKVDR--TLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            MLT+ YI L    VY      +  + + D   D +   ++     FD    L E+++K+FD L  +E K R G I+DK+D D D  VS  ELK+W++   ++ ++EDVE HWK  +P N + I+++ Y +  +G            K    YK L K ++++W+ AD ++DD LN+TEF  FLHP +   M+ +V  E LE +D + D  L + EY+ +++   + + VD     ++ E   F    D NKDG +D +E+  W  P  ++  + E +H++   D D +E L+K E+L+KY++F+ S+ +D  +    H+E 
Sbjct:    1 MLTTLYIALAITAVYAGVPNPEETKRLMDHLSDAEHYRNEHHNKQFDHDAFLGEDQAKSFDQLPPEESKRRLGMIVDKIDADKDGFVSLVELKDWIRYTQKRYIVEDVENHWKQHNPNNEDLISWENYKKDVYGFMDEMTDSEKKSKEGATYKNLLKRDRRRWQYADGDQDDSLNRTEFGAFLHPEDHSGMREVVVLETLEDIDVDKDGKLSLEEYIGDMYKPEEGESVDEEPDWVKQEREQFTGYRDTNKDGFMDEKEVMDWIAPPEFDHADAEARHLVFEADTDADEKLTKDEILDKYDLFVGSQATDFGEALARHDEF 321          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: Q86FI4 (Calumenin (Crocalbin) OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 4.867e-46
Identity = 99/317 (31.23%), Postives = 175/317 (55.21%), Query Frame = 2
Query:  128 ILLICVQVYMVTCYFDNFEEIKDLFKDMQ-----------FPGD--DFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXXXXXX------XXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDR--TLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            ++  C+   +V C   +F  ++  +K              F G+    FD    L  +E+K FD L+ +E K + GEI+DK+D + D Q++S E+  W+  + +K L++DV+  WK +   + + ++++K+ +  FG+   +  +     +       ++W TAD++ D  L+K E+L FLHP    +M+ +V  E +E +D NNDSF+D++EY+ +++S     +     ++ E   F    DIN DG LD EE+ KW  P  YN I+ EV H+    D D++  LSK+E+LN+Y++F+ S+ ++  +   GH+EL
Sbjct:    1 MIFSCIPCTIVICILSDFAFVESKYKPRTADKDLSDLPHTFEGEHSSAFDHDAFLGRDEAKRFDDLTPEESKQKLGEIVDKIDLNSDGQITSEEMAAWISKVSKKMLLDDVDRAWKDLELSDGDKLSWEKHMDELFGEDGDLEDEDDDTKKTISERDKRRWATADVDGDGKLSKEEYLAFLHPEHEPKMRQVVIRETMEEVDKNNDSFVDLDEYIKDLWSPNSPSEEEPEWVKTEREEFSKRRDINGDGKLDLEEVGKWIAPEDYNNIQAEVTHLFSESDADQDGKLSKSEILNRYDLFVGSQATNFGEILTGHDEL 317          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: A0A5A9PID8 (Calumenin-A OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti002050 PE=4 SV=1)

HSP 1 Score: 169.088 bits (427), Expect = 1.702e-45
Identity = 103/310 (33.23%), Postives = 171/310 (55.16%), Query Frame = 2
Query:  131 LLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGS-------LILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            LL+C  + +V       E+ + +  D      +  DG+         L EEE+K FD L+ +E ++R G+I+DK+D D D  V+  ELK W+K   +K + ++VE  WK     N   I++ +Y   T+G  +  P       YK++   ++++++ AD N D + +K EF  FLHP E+E MK IV  E +E +D N D F+D+ EY+ ++++   ++D    +  E   F    D NKDG +D EE   W LPA Y+  E E KH++   D +++ LL+K E++NKY++F+ S+ +D  +  + H+E 
Sbjct:    9 LLMCFALCVVYATSKPTEKKERVHHDATLSSKEHNDGTNFDYDHDAFLGEEEAKTFDDLTPEESQNRLGKIVDKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDINNDGMISWDEYKNVTYGSYLDDPEPDDGYNYKQMMARDERRFKLADQNGDQIADKEEFTAFLHPEEYEHMKDIVVLETIEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVSTEREQFSEFRDKNKDGKMDKEETMDWILPADYDHAEAEAKHLVYESDTNKDGLLTKEEIINKYDLFVGSQATDFGEALVRHDEF 318          
BLAST of Reticulocalbin-1 vs. TrEMBL
Match: Z4YIA7 (Calumenin-A OS=Danio rerio OX=7955 GN=calua PE=1 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 2.070e-45
Identity = 104/310 (33.55%), Postives = 168/310 (54.19%), Query Frame = 2
Query:  113 LTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L  C+ L +       T   D       L       G +F +D    L EEE+K FD L+ +E K+R G+I++K+D D D  V+  ELK W+K   +K + ++VE  WK     N   I++++Y   T+G  +  P       YK++   ++++++ AD N D + +K EF  FLHP E+E MK IV  E +E +D N D F+D+ EY+ ++++   ++D    +  E   F    D NKDG +D EE   W LPA Y+  E E KH++   D +++  L+K E+LNKY++F+ S+ +D  +  + H+E 
Sbjct:    8 LLMCFALCVVYATSKPTEKKDRVHHDAPLSSKEHDDGTNFEYDHDAFLGEEEAKTFDDLTPEESKNRLGKIVEKIDADEDGFVTEAELKAWIKKAQKKYIYDNVERQWKDFDLNNDRMISWEEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADGNGDHIADKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDREETMDWILPADYDHAEAEAKHLVYESDTNKDGKLTKEEILNKYDLFVGSQATDFGEALVRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: calua (calumenin [Source:NCBI gene;Acc:103043492])

HSP 1 Score: 165.622 bits (418), Expect = 1.329e-47
Identity = 103/310 (33.23%), Postives = 167/310 (53.87%), Query Frame = 2
Query:  113 LTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L  C+ L +       T   D       L       G++F +D    L EE +K+FD L+ +E K R G+I++K+D D D  V+  ELK W+K   +K + ++V+  WK     N   I++ +Y   T+G  +  P       YK++   ++++++ AD N D + +K EF  FLHP E+E MK IV  E +E +D N D F+D+ EY+ ++++   ++D    +  E   F    D NKDG +D EE   W LPA Y+  E E KH++   D +++  LSK E+LNKY++F+ S+ +D  +  + H+E 
Sbjct:    6 LLMCFALCVVYATSKPTEKKDRVHHDAPLSSKEHNDGENFDYDHDAFLGEEVAKSFDDLTPEESKDRLGKIVEKIDDDQDGFVTEAELKEWIKKAQKKYIYDNVDRQWKDFDMNNDGMISWDEYKNVTYGTYLDDPEPDDGYNYKQMMARDERRFKMADRNGDSIADKEEFTAFLHPEEYEHMKEIVVLETMEDIDKNGDGFIDLEEYIGDMYNHEDEMDEPEWVATEREQFSEFRDKNKDGKMDKEETMDWILPADYDHAEAEAKHLVYESDSNKDGKLSKEEILNKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: calub (calumenin-B [Source:NCBI gene;Acc:103027690])

HSP 1 Score: 158.303 bits (399), Expect = 6.984e-45
Identity = 90/269 (33.46%), Postives = 159/269 (59.11%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV--SIP-----YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L +EE+K FD L+ +E K R G I+DK+D+DHD  V+  ELK W+K   ++ + EDV+  W++        +++++Y   T+G  +  S P     Y+++   ++++++ AD + +   +K EF  FLHP E++ MK IV  E +E +D N D F+D++EY+ +++S D    +   +  E   F    D NKDG +D EE + W LP+ Y+  E E KH++   D D++ +L+K E+++KY++F+ S+ +D  +  + H+E 
Sbjct:   47 YDHEAFLGQEEAKTFDQLTPEESKERLGLIVDKIDEDHDAHVTVEELKKWIKHAQKRWIYEDVDRQWQSHDLNADGYVSWEEYKNATYGYILDDSDPDDGFNYRQMMARDERRFKMADTDGNLQADKEEFTAFLHPEEYDYMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYSQDGDPTEPEWVRTEREQFTEFRDKNKDGRMDKEETRDWILPSDYDHAEAEAKHLLYESDTDKDGMLTKQEIVDKYDLFVGSQATDFGEALVRHDEF 315          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:103039743])

HSP 1 Score: 145.591 bits (366), Expect = 5.337e-40
Identity = 86/274 (31.39%), Postives = 158/274 (57.66%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +E++K FD LS  E + R G+I+D++D D +  +++ ELK W+K + ++ + E+V   W          I++ +Y + T+G  ++ P           +KK+   ++++++ ADL+ D    + EF  FLHP EF+ MK IV  E +E +D N D  +D +EY+A++F+ +    +   ++ E   F +  D+NKDG +D EEI+ W LP  Y+  + E +H++   D D++++L+K E+L  +N+F+ S+ ++  +  T  H+EL
Sbjct:   48 YDHEAFLGKEDAKTFDQLSPAESRDRLGKIVDRIDADGNGYITTEELKAWIKRVQKRYVYENVAKVWSDYDLNKDNKISWDEYKQATYGYYLANPEEFEDATDQFSFKKMLPRDERRFKLADLDGDLAAEREEFTAFLHPEEFDHMKEIVVLETMEDIDKNGDGHVDEDEYIADMFAHEEGGPEPDWVKTERDQFSDFRDLNKDGKMDLEEIRHWILPQDYDHAQAEARHLLLESDTDKDQMLTKEEILENWNMFVGSQATNYGEDLTRNHDEL 321          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn3 (reticulocalbin 3 [Source:NCBI gene;Acc:103045651])

HSP 1 Score: 136.346 bits (342), Expect = 1.174e-36
Identity = 83/272 (30.51%), Postives = 151/272 (55.51%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV---------SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIF-SDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +EE+K FD L+ +E K++ G+I+D++D D D  VS  EL +W+K    + + E+V+ HWK    +    I + +Y   T+G  +            YK +   ++++++ AD + D + ++ EF  FLHP EF  MK +V +E +E +D N D  +++ EY+ +++ S+  + +   +  E   F    D+NKDG LD  E+ +W LP   +  + E KH++   D D ++ ++K E+L  +N+F+ S+ ++  +  T  H+EL
Sbjct:   42 YDHEAFLGKEEAKTFDQLTPEESKAKLGKIVDRIDTDKDGFVSHAELHHWIKHRQRRYIEENVDKHWKEYDQDKDGKIAWTEYKNTTYGFYLDDEFSDVENRESYKAMLMRDERRFKVADKDGDGIASREEFTAFLHPEEFSYMKDLVVQETVEDIDKNGDGKINLEEYIGDMYTSEDGENEPEWVNTEKKQFSEFRDVNKDGFLDASEVAQWILPGDVDHADIEAKHLIHETDRDNDDKMTKKEILENWNMFVGSQATNYGEDLTRKHDEL 313          
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Match: rcn2 (reticulocalbin 2 [Source:NCBI gene;Acc:103045530])

HSP 1 Score: 97.8265 bits (242), Expect = 1.153e-22
Identity = 71/268 (26.49%), Postives = 136/268 (50.75%), Query Frame = 2
Query:  251 LEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSI------------PYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPT-LGHEEL 1015
            L++E+      LS  E++ +  EI+ ++D D D  ++  E+  W++ ++++  ++D +  +      +   + + +Y     G  V +              + LH  EK++++ AD +    LN TEFL F HP E + M     E++L   D + D F+ ++E++ ++ +           +E   F++  D NKDG L+ +E  +W  P SY    EE  H++K +D D +E LS+TE+L   +IF+ S+++D  +   + H+EL
Sbjct:   34 LDDEDKDEIKKLSPSEQRGKMVEIVKRIDTDSDKFLTPEEITVWIQRVYKRYAMDDAQERFPGFDINSDGLVTWDEYNMVMHGHTVEVDENAVLEDPEEESLRFLHLKEKRRFDFADTDGTSGLNVTEFLAFTHPSEVDHMSDFAIEDVLSEYDLDKDGFISLSEFIGDLRASESDEPSQWEAEETVRFKDLYDQNKDGKLNRDEQLRWVAPNSYGSAREEAVHLIKEMDQDGDERLSETEILKNQDIFMNSEVTDYGRQLHVPHDEL 301          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 154.066 bits (388), Expect = 6.712e-44
Identity = 86/269 (31.97%), Postives = 152/269 (56.51%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            +D    L  E +K FD LS +E K R G+I++K+D D D  V+  E+  W+K    + + EDV+  W     +   ++++++Y   T+G     P       YK++   ++++++ AD++ D   +K EF  FLHP EFE MK I+  E +E +D N D F+D+NEY+ ++++   + +    ++ E   F +  D NKDG +D EE   W LP+ Y+  E E +H++   D D++  LSK E+L+K+++F+ S+ ++  +    H+E 
Sbjct:   49 YDHEAFLGAETAKTFDQLSPEESKERLGKIVEKIDSDGDGLVTQDEMTMWIKHTQRRWVYEDVDRQWTGHDIDGDGSVSWEEYRNATYGFLAVSPIEEDGFNYKQMLGRDERRFKAADVDGDGQASKEEFTAFLHPEEFEHMKDIIVTETMEDIDKNGDGFIDLNEYIGDMYNQAGESEEPEWVKTERQQFTDFRDTNKDGKMDKEETMAWILPSDYDHAEAEARHLIYESDSDKDGKLSKEEILDKHDLFVGSQATNFGEALTRHDEF 317          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: CALU (calumenin [Source:HGNC Symbol;Acc:HGNC:1458])

HSP 1 Score: 114.775 bits (286), Expect = 4.703e-30
Identity = 62/239 (25.94%), Postives = 132/239 (55.23%), Query Frame = 2
Query:  320 IIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV------SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            I+ ++D++ D  V+ TEL  W++    + ++E+ E  W +   +    +N+ +Y   T+             Y+ +   ++++++ AD++ D   ++ E+  FLHP E   M+ +V  E +E +D N D F++++EY+ +++S+  +   +  +E E   F    D + DG++  +E+  W LP  Y++ E E KH++   D D++  L++ E++ KY++F+ S+ +D  +  + H+EL
Sbjct:    2 IVTRIDENGDGLVTETELTEWIRHAQRRWVLEEAERQWSSHDLDGDGYVNWAEYKNATYSYLAEEDPEDPDGYRAMVLRDERRFQAADVDGDGRASRNEYAAFLHPEEHPHMRNLVVTETIEDIDKNGDGFINVDEYIGDMYSEESEEGDSEWVESERKQFAELRDTDGDGLMGHDEVAAWILPDDYDQAEAESKHLIHECDDDQDGNLTREEIIAKYDLFVGSQATDFGEALMRHDEL 240          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 80.1073 bits (196), Expect = 1.271e-17
Identity = 54/159 (33.96%), Postives = 85/159 (53.46%), Query Frame = 2
Query:  560 ADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSD--MKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLG-----HEEL 1015
            AD +    LN TEFL F HP EF+ M+  V EE L   D + D F+D+ E+L +   D    + D   +  E   F ++ DI+ DG L+  E+  W +P +    E+E +H+++ +D D +  LS  E++    +FL S+++D  +  LG     HEEL
Sbjct:   72 ADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGR-QLGEQYAHHEEL 229          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: rcn2 (reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-62])

HSP 1 Score: 79.7221 bits (195), Expect = 2.120e-17
Identity = 54/159 (33.96%), Postives = 85/159 (53.46%), Query Frame = 2
Query:  560 ADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSD--MKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLG-----HEEL 1015
            AD +    LN TEFL F HP EF+ M+  V EE L   D + D F+D+ E+L +   D    + D   +  E   F ++ DI+ DG L+  E+  W +P +    E+E +H+++ +D D +  LS  E++    +FL S+++D  +  LG     HEEL
Sbjct:   87 ADSDGVQGLNITEFLAFEHPEEFDYMQDSVLEEALLEHDKDGDGFVDLAEFLGDYHRDPSTPQSDPEWVITETDKFTSEFDIDHDGKLNPSELLSWLMPNNLEVAEDETEHLLEHMDTDGDGQLSHDEVVQNKELFLTSEVTDYGR-QLGEQYAHHEEL 244          
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Match: sdf4 (stromal cell derived factor 4 [Source:NCBI gene;Acc:406360])

HSP 1 Score: 64.6994 bits (156), Expect = 3.933e-12
Identity = 58/252 (23.02%), Postives = 115/252 (45.63%), Query Frame = 2
Query:  308 RFGEIIDKMDKDHDNQVSSTELKNWM---KVIHEKKLIEDVEGHWKTISPENSETINFQKY-----FEHTFGQK-------------VSIPYXXXXXXXXXXWETAD-LNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDM-----KKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            R    + ++DKD D ++S+ EL+ W+      H ++ +++ + H++T+ P+    + + +Y         F +K             +    ++L    K++W  AD   +D  LN+ EFL F HP     M   + +E++  +D + D  L ++E+ +     +     + +D   + +    F   +D NKDG +   E++++  P S +    E K ++ + D D +  LS  E+L     F  SK+ D
Sbjct:    1 RLCASLVRVDKDRDKRISAVELQEWIVEKTREHLQQALDENKPHFRTLDPDGDGLVTWDEYRLRYLVSKGFDEKDIAERIRDKQELKIDEETEELMDNLKERWNQADDAPQDQKLNEKEFLSFQHPEHSRSMLSYMVQEIIHDLDQDKDQRLSLSEFASLPLGTVENQKEQDIDDDWVRERRKEFIEVIDSNKDGFITRSELEEYMDPTSSHNALSEAKQMISVADEDEDAQLSLDEVLRYSEYFTGSKLVD 252          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO32638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUH8])

HSP 1 Score: 159.458 bits (402), Expect = 1.370e-45
Identity = 98/327 (29.97%), Postives = 174/327 (53.21%), Query Frame = 2
Query:  107 TMLTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISP-----------------ENSETINFQKYFEHTFG-----QKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT--LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
             +L  C + L   Q    T  FD     ++ F+  +   +  +D    L +E  K FD LS +E K R G+++DK+D DHD +V+  ELK W+K   ++ + EDV+  W  +                   + +  I +++Y  +T+G      K    Y  + K ++++WE AD+N+DD L+K E+  FLHP E+E MK +V EE L+ +D N D ++ + EYL +++ + +K D     ++ E   F    D N+DG +D +E++ W +PA ++ +  EV H++   DV+++  L+K+E+++K+ +F  S+ +D       H+E 
Sbjct:    7 VLLCICAVALARPQDKKKTRVFDGKVSEEEHFRGTEQEHNTEYDHEAFLGDE-KKTFDQLSPEESKERLGKLVDKIDVDHDGKVTEEELKQWIKKSAKRYVYEDVDRQWDHLKKIEHAKIKMDDLVDGKRVDMAAPIGWEEYKNNTYGFIKEDDKSEYNYDNMIKRDRRRWEKADINRDDKLSKEEYTAFLHPEEYEYMKDVVVEETLDDIDKNKDGYVSLEEYLGDLYPESEKEDEEPDWVKTEREQFLTVRDKNRDGKMDKDEVRDWIVPADFDHVGAEVTHLINEADVNKDGYLTKSEIIDKHEVFAGSQATDFGDALTRHDEF 332          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO47673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLD6])

HSP 1 Score: 122.865 bits (307), Expect = 3.433e-32
Identity = 78/266 (29.32%), Postives = 140/266 (52.63%), Query Frame = 2
Query:  260 EESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSE-------------TINFQKYFEHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEI-FSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            ++ K FDSL+  E K R G I+D++DKD D +++ TE+K W+     +   +D +  WK I     +              I++  Y E  FG+ ++   +K ++ ++K+WE AD NKD  L+K EF    HP  F+ M+ +V +E +  +DTN D ++   E+L +       + ++ +I      F    D NKDG LD  E++ +  PA Y+ +  E +H++  VD + + +L+K E+++ +  F+ S+ ++  +    HEE 
Sbjct:   33 QDKKEFDSLTPQESKRRLGLIVDRIDKDQDGRITYTEMKEWINYAGNRYAFDDGDRLWKAIKKREEQIAKKENKSFNPDAPIDWDLYKEDAFGKTITDANEKRYQRDRKQWEVADRNKDTKLSKEEFPALFHPSVFDYMQDLVLDESMLDIDTNRDGYISQEEFLGKATEEKGTEEEKEMIARRRQEFLEHRDTNKDGRLDRRELKDYLFPA-YDHVGAEAQHLINEVDKNEDGMLTKDEIMDNFEKFVGSRAAEFGQALNRHEEF 297          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO35844 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKE6])

HSP 1 Score: 100.523 bits (249), Expect = 5.546e-24
Identity = 74/254 (29.13%), Postives = 132/254 (51.97%), Query Frame = 2
Query:  263 ESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXX--XXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPAS-YNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            E + FD L  +E K R   +I ++D + D  V++ EL +W+K + +K+ +E V+   K         +++ +Y + T+G +     +     + +K++++ AD NKD  L + E   FLHP    EM  +   E +E +D + D  + + E+L E   +  +V    ++DE + F  + D NKDG LD EE++ W LP + +    EE KH++   D + +  L+  E+   Y +F+ S+ +D  +  L  EEL
Sbjct:   57 EKEEFDHLPPEEAKKRLRALIREVDNNKDGAVTTEELTDWVKGVFKKRSMEGVDNDLKEKDANEDGKVDWNEYSKGTYGDQTEDDEEMKEFLRRDKRRFDAADTNKDGFLTREEMAIFLHPESSPEMSEVHILETIEDIDRDKDGLISLKEFLGEYEEEPGEV-PDWVKDETNRFNEEYDKNKDGKLDKEEVRLWILPETDHLMAAEEAKHLVSSADDNSDGKLTIEEIEKNYAVFVGSEATDYGR-ALPKEEL 308          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO31169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYP9])

HSP 1 Score: 93.2041 bits (230), Expect = 9.631e-22
Identity = 68/261 (26.05%), Postives = 133/261 (50.96%), Query Frame = 2
Query:  230 FFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYF--------EHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAE--IFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
             +D    L E+++  FD L+  + K R  E+  K+D D D ++S  EL  W+ V  +K   +  E   + +       +++++Y         E     +     K++ K ++K+W+ AD++ D+LL   E   F+HP E   M  ++ +E +E +D++ D  +   EY  +  +   M++ ++  ++     F NDLD +KDG L+ EE++ W  P S +    E +H+M  VD +++  L+  E++ +Y +F  S+ ++
Sbjct:    1 MYDHDAFLGEDQAAEFDELTPKQTKQRLRELFPKIDVDQDQKISLKELVEWIDVNMKKHTRKSSESRMEQMDKNKDGKVSWEEYVNVEYDPKNEKGMSNENKDHLKEMKKRDEKRWKHADMDNDNLLTIDELQMFIHPEETPRMTSVLVQENMEMLDSDKDGKISFAEYAGKLSVMWRMREDNQDSLKSLKDDFNNDLDKDKDGSLNKEELKSWIFP-SGSPSSGEAEHLMTEVDKNKDNFLTVDEIMERYELFAGSRATN 260          
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Match: EDO42789 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S7])

HSP 1 Score: 92.0485 bits (227), Expect = 2.440e-21
Identity = 72/258 (27.91%), Postives = 136/258 (52.71%), Query Frame = 2
Query:  236 DGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEK-KLIEDVEGHWKTISPENSETINFQKYFEHTFG---QKVSIPYXXXX-----XXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEI----FSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKS 970
            D    L EE +K F++LS +E + R   ++ ++D + D  V   EL+ W++   +K ++ EDV+  ++ +   N     ++++   T+G   + ++  +++ +     + +++KW+ AD +KD  L + E+  F HP E E M P +A +++   D + D FL + EYL  +    F  M K D          F+   D NKDG LD +E++ W+ P ++NK  EE +H+++  D++ +  LS  E++  +  F  S
Sbjct:    7 DHVAFLGEEMAKEFENLSPEEARRRLRMLVPRIDINKDGFVEEAELEIWIRHKMKKWEVEEDVDAIFRDMDFNNDNHATWKEFMMRTYGFTDEDINKKWERNNLKDYIEDDRRKWKYADQDKDSRLTREEYEYFHHPKEHEVMIPYIAMKVMLEGDKDKDGFLSLQEYLDWLEMPDFHIMDKRD----------FEEKHDQNKDGKLDLKEVEDWRRPKNFNKALEEAQHLIEHADLNGDGKLSADEIVTSHEFFAGS 254          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: calub (calumenin [Source:NCBI gene;Acc:101165303])

HSP 1 Score: 159.844 bits (403), Expect = 1.829e-45
Identity = 96/310 (30.97%), Postives = 171/310 (55.16%), Query Frame = 2
Query:  113 LTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKV-------SIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L  C+ L +       T   D     + L        D+F +D    L +EE+K+FD L+ +E K R G ++D++D+D D  V++ E+K W+K   ++ + +DV+  WK+        +++++Y   T+G  +          YK++   ++++++ AD + D   NK EF  FLHP E+E MK IV  E +E +D N D F+D++EY+ ++++ D +  +   ++ E   F    D NKDG +D EE + W LP+ Y+  E E KH++   DVD++  L+K E+++KY++F+ S+ +D  +    H+E 
Sbjct:    9 LVMCFALCVVYATSKPTEKKDRVHHDEPLSNLEHDDADNFDYDHEAFLGQEEAKSFDQLTPEESKERLGMLVDRIDEDKDGYVTAEEMKRWIKDAQKRWIYDDVDRQWKSHDLNGDGFVSWEEYKNATYGYVLDDQDPDDGFSYKQMMARDERRFKMADQDNDMKANKEEFTAFLHPEEYEHMKDIVVLETMEDIDKNGDGFIDLDEYIGDMYNQDGETTEPEWVKTEREQFTEFRDKNKDGKMDKEETKDWILPSDYDHAEAEAKHLVYESDVDKDGRLTKAEIVDKYDLFVGSQATDFGEALTRHDEF 318          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: rcn1 (reticulocalbin 1 [Source:NCBI gene;Acc:101175141])

HSP 1 Score: 154.451 bits (389), Expect = 4.441e-43
Identity = 88/274 (32.12%), Postives = 163/274 (59.49%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIP-----------YXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD-EQKPTLGHEEL 1015
            +D    L +EE+K FD L+ +E + R G+I++++D D D  +++ ELK+W+K + ++ + E+V   W          I++ +Y + T+G  ++ P           +KK+   ++++++ ADLN D+  +K EF  FLHP EF+ MK IV +E LE +D N D ++D +EY+A++FS +    +   ++ E   F +  D+NKDG +D +EI+ W +P  Y+  + E +H++   D D+++ L+K E+L  +N+F+ S+ ++  +  T  H+EL
Sbjct:   79 YDHEAFLGKEEAKTFDQLTPEESRDRLGKIVERIDGDGDGYITTAELKDWIKRVQKRYVYENVAKVWTDYDLNKDNRISWDEYKQATYGYYLANPEEFQDDKDQFSFKKMLPRDERRFKAADLNGDNTADKEEFTSFLHPEEFDHMKDIVVQETLEDIDKNGDGYVDEDEYIADMFSHEDGGPEPDWVKTEREQFSDFRDLNKDGKMDKDEIRHWIMPQDYDHAQAEARHLVYESDQDKDQKLTKDEILENWNMFVGSQATNYGEDLTRSHDEL 352          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: rcn3 (reticulocalbin-1 [Source:NCBI gene;Acc:101175408])

HSP 1 Score: 145.591 bits (366), Expect = 4.598e-40
Identity = 80/260 (30.77%), Postives = 143/260 (55.00%), Query Frame = 2
Query:  233 FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVS---------IPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFS-DMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSD 982
            +D    L +EE+K FD L+ +E K+R  +I++++D D D  +S  EL +W+K    + + ++V  HWK       + I +++Y   T+G  +            YK +   +++++  AD + D +  ++EF  FLHP EF+ MK +V +E LE +D N D  +DINEY+ ++F+ +  + +   +  E   F    D NKDG LD  E+  W LP   +  + E KH++   D D++  ++K E+L  +N+F+ S+ ++
Sbjct:   47 YDHEAFLGKEEAKTFDQLTPEESKARLAKIVERIDTDKDGFISHAELHHWIKHRQRRYIEDNVNKHWKDYDKNRDDQIAWEEYKNTTYGYYLGEDFDDVEDKATYKSMLARDERRFRAADRDADGIATRSEFTAFLHPEEFDHMKDVVVQETLEDIDKNKDGKIDINEYIGDMFTPEDGETEPDWVHTEKKHFSEFRDSNKDGYLDAGEVAHWILPGEVDHADNEAKHLIHETDTDKDGKVTKKEILANWNMFVGSQATN 306          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 96.6709 bits (239), Expect = 3.819e-22
Identity = 81/309 (26.21%), Postives = 159/309 (51.46%), Query Frame = 2
Query:  137 ICVQVYMVTCY---FDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKY--FEH----TFGQKVSI------PYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLG-HEEL 1015
            + V V++V  +   F + + ++D F   Q   D   D +++L +E ++    L+ +E++ +  EI+ K+D + DN + + E+  W++ ++ K  +ED E  +          + +++Y    H    TF +   +        ++LH  EKK+++ AD++    L+ +EFL F HP E + M     +++L   DT+ D F+ ++E++ ++  +     +  IE E   F+   D +KDG L+ +E  +W  P SY    EE  H++  +D D +E +S  E+L   + F+ S+++D  +   G H+EL
Sbjct:    5 VAVFVWLVVQFGFGFSSHKHLQDHFNGDQHNPD--HDMAVLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEYNTVAHDQLFTFDESTVLEDPEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRGEDNSPSKWEIE-ETVRFKELYDQDKDGNLNRDEQLRWIAPNSYGSAREEALHLINEMDQDGDEQISVAEVLKNQDTFMNSEVTDYGRQLHGSHDEL 310          
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Match: pstpip1a (proline-serine-threonine phosphatase-interacting protein 1 [Source:NCBI gene;Acc:101156493])

HSP 1 Score: 75.485 bits (184), Expect = 2.577e-14
Identity = 68/267 (25.47%), Postives = 134/267 (50.19%), Query Frame = 2
Query:  137 ICVQVYMVTCY---FDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKY--FEH----TFGQKVSI------PYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIM 892
            + V V++V  +   F + + ++D F   Q   D   D +++L +E ++    L+ +E++ +  EI+ K+D + DN + + E+  W++ ++ K  +ED E  +          + +++Y    H    TF +   +        ++LH  EKK+++ AD++    L+ +EFL F HP E + M     +++L   DT+ D F+ ++E++ ++  +     +  IE E   F+   D +KDG L+ +E  +W  P SY    EE K  +
Sbjct:    5 VAVFVWLVVQFGFGFSSHKHLQDHFNGDQHNPD--HDMAVLLGDETTEEIKKLTPEEQREKLLEIVKKIDTNGDNLLGAEEITLWIQHVYRKYALEDAEERFPEFDLNKDGVLTWEEYNTVAHDQLFTFDESTVLEDPEQDSLRQLHLKEKKRFDFADIDDTPGLSVSEFLAFTHPSEVDRMADFTIQDVLTEYDTDKDGFISLSEFIGDVRGEDNSPSKWEIE-ETVRFKELYDQDKDGNLNRDEQLRWIAPNSYGSAREEGKEFI 268          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000077405.1 (SMESG000077405.1)

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 300/302 (99.34%), Postives = 301/302 (99.67%), Query Frame = 2
Query:  110 MLTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            MLTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPY+KLHKLEKKKWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELL SMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL
Sbjct:    1 MLTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYEKLHKLEKKKWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLGSMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 302          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000077405.1 (SMESG000077405.1)

HSP 1 Score: 548.895 bits (1413), Expect = 0.000e+0
Identity = 285/287 (99.30%), Postives = 286/287 (99.65%), Query Frame = 2
Query:  155 MVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            MVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPY+KLHKLEKKKWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELL SMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL
Sbjct:    1 MVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYEKLHKLEKKKWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLGSMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 287          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000077404.1 (SMESG000077404.1)

HSP 1 Score: 236.113 bits (601), Expect = 2.842e-75
Identity = 125/266 (46.99%), Postives = 178/266 (66.92%), Query Frame = 2
Query:  224 DDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMS-DEQKPTLGHEEL 1015
            DD+ +D + IL+ EE++ F S+S  E K +F EIIDKMD +HD  V   ELKNW+  ++   L +DV+G WKT   +N + INF  Y   TFG K +  + KL   E+ +W  ADL+ D LLNKTEF RFLHP EF+++KP++A+E L+ MDTN DS +DINEYL ++F   ++     I +E   F  D D+NKDGVLD +EIQ W LP SYN++E E +H+M+L D +++ +LSK+EML+KY +F+ S+ S +   P   H++L
Sbjct:   30 DDYSYDHNSILKSEEARKFYSMSPSESKKKFSEIIDKMDINHDGSVEMIELKNWITNVYNSILSDDVDGQWKTFGQKNDDKINFDYYVSKTFGSKRTADHLKLINKEQHRWIEADLDNDKLLNKTEFFRFLHPEEFKDLKPLLAQETLDEMDTNKDSVIDINEYLEDMFPQGREAKEEWIRNERQNFGIDRDLNKDGVLDRDEIQNWLLPDSYNRVESEAQHLMELADTNKDRILSKSEMLDKYQVFVGSRESVNYGGPDQSHDDL 295          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000077404.1 (SMESG000077404.1)

HSP 1 Score: 236.113 bits (601), Expect = 4.070e-75
Identity = 125/266 (46.99%), Postives = 178/266 (66.92%), Query Frame = 2
Query:  224 DDF-FDGSLILEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMS-DEQKPTLGHEEL 1015
            DD+ +D + IL+ EE++ F S+S  E K +F EIIDKMD +HD  V   ELKNW+  ++   L +DV+G WKT   +N + INF  Y   TFG K +  + KL   E+ +W  ADL+ D LLNKTEF RFLHP EF+++KP++A+E L+ MDTN DS +DINEYL ++F   ++     I +E   F  D D+NKDGVLD +EIQ W LP SYN++E E +H+M+L D +++ +LSK+EML+KY +F+ S+ S +   P   H++L
Sbjct:   42 DDYSYDHNSILKSEEARKFYSMSPSESKKKFSEIIDKMDINHDGSVEMIELKNWITNVYNSILSDDVDGQWKTFGQKNDDKINFDYYVSKTFGSKRTADHLKLINKEQHRWIEADLDNDKLLNKTEFFRFLHPEEFKDLKPLLAQETLDEMDTNKDSVIDINEYLEDMFPQGREAKEEWIRNERQNFGIDRDLNKDGVLDRDEIQNWLLPDSYNRVESEAQHLMELADTNKDRILSKSEMLDKYQVFVGSRESVNYGGPDQSHDDL 307          
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Match: SMESG000012033.1 (SMESG000012033.1)

HSP 1 Score: 144.436 bits (363), Expect = 5.980e-40
Identity = 83/256 (32.42%), Postives = 152/256 (59.38%), Query Frame = 2
Query:  251 LEEEESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKLIEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYXXXXXXXXXXWETADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINEYLAEIFSDMKKVDRT-LIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASYNKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHEEL 1015
            L ++ES  + ++S +E K +  +I+DK+D + D ++   ELK+W+ +  ++ L ED + +W   + E  + + F+ Y +  +          + K ++++W  AD++ D+LL K EF  FLHP E E+M+ IV +E ++ MD N D  +D++EY+ ++F+  K  +    ++ E + F++  D+NKDG LD EE+ +W LP  +N +  E  H+M+  DV+++  L+K E+L KY++F+ S+ +D       H EL
Sbjct:   53 LGKDESSKYKNMSPEESKEKLSKIVDKIDVNSDGKIYPDELKHWITIQSQRYLREDTDKNWADYTIE-KDKLTFENYKKKAYEDDDEA---DMVKRDERRWAKADIDGDNLLTKEEFFDFLHPEESEKMRDIVIQETIDDMDKNKDGAIDLDEYIRDMFNPEKDEEEPDWVKTERAQFKDHRDLNKDGKLDREEVGQWILPPDHNHVTSETSHLMEQTDVNKDGHLTKEEILEKYDVFIGSQATDFGDALTRHSEL 304          
The following BLAST results are available for this feature:
BLAST of Reticulocalbin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RCN19.841e-4335.51reticulocalbin 1 [Source:HGNC Symbol;Acc:HGNC:9934... [more]
CALU2.305e-4232.71calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU3.103e-4232.71calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU5.161e-4232.71calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU6.726e-4232.71calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
calu-11.052e-2825.10CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-11.052e-2825.10CALUmenin (Calcium-binding protein) homolog [Sour... [more]
calu-24.506e-727.74CALUmenin (Calcium-binding protein) homolog [Sour... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scf1.025e-4432.36gene:FBgn0025682 transcript:FBtr0089942[more]
scf3.551e-2431.58gene:FBgn0025682 transcript:FBtr0089941[more]
CG316503.911e-2330.12gene:FBgn0031673 transcript:FBtr0301907[more]
CG316503.911e-2330.12gene:FBgn0031673 transcript:FBtr0301905[more]
CG316503.911e-2330.12gene:FBgn0031673 transcript:FBtr0079033[more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua9.252e-4933.55calumenin a [Source:NCBI gene;Acc:415241][more]
calua9.252e-4933.55calumenin a [Source:NCBI gene;Acc:415241][more]
calub9.750e-4532.71calumenin b [Source:NCBI gene;Acc:394057][more]
calub8.074e-4433.33calumenin b [Source:NCBI gene;Acc:394057][more]
rcn11.315e-3931.75reticulocalbin 1, EF-hand calcium binding domain [... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgf114.017e-4434.43fibroblast growth factor 11 [Source:Xenbase;Acc:XB... [more]
calu2.928e-3931.23calumenin [Source:NCBI gene;Acc:407965][more]
rcn38.224e-3932.18reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
calu2.575e-3730.86calumenin [Source:NCBI gene;Acc:407965][more]
rcn35.565e-3630.80reticulocalbin 3 [Source:NCBI gene;Acc:395023][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rcn12.114e-4435.51reticulocalbin 1 [Source:MGI Symbol;Acc:MGI:104559... [more]
Calu2.259e-4232.71calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Calu2.616e-4232.71calumenin [Source:MGI Symbol;Acc:MGI:1097158][more]
Rcn37.238e-3629.66reticulocalbin 3, EF-hand calcium binding domain [... [more]
Rcn37.238e-3629.66reticulocalbin 3, EF-hand calcium binding domain [... [more]
back to top
BLAST of Reticulocalbin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6IQP3|CALUA_DANRE7.370e-4833.55Calumenin-A OS=Danio rerio OX=7955 GN=calua PE=2 S... [more]
sp|B5X186|CALUA_SALSA1.088e-4635.42Calumenin-A OS=Salmo salar OX=8030 GN=calua PE=2 S... [more]
sp|Q7SXV9|CALUB_DANRE3.757e-4432.71Calumenin-B OS=Danio rerio OX=7955 GN=calub PE=2 S... [more]
sp|Q05186|RCN1_MOUSE1.479e-4335.51Reticulocalbin-1 OS=Mus musculus OX=10090 GN=Rcn1 ... [more]
sp|Q6XLQ7|CALU_RABIT4.405e-4232.71Calumenin OS=Oryctolagus cuniculus OX=9986 GN=CALU... [more]
back to top
BLAST of Reticulocalbin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S2PK987.286e-4832.29Uncharacterized protein OS=Chilo suppressalis OX=1... [more]
A0A5E4QM451.957e-4632.40Uncharacterized protein OS=Leptidea sinapis OX=189... [more]
Q86FI44.867e-4631.23Calumenin (Crocalbin) OS=Schistosoma japonicum OX=... [more]
A0A5A9PID81.702e-4533.23Calumenin-A OS=Triplophysa tibetana OX=1572043 GN=... [more]
Z4YIA72.070e-4533.55Calumenin-A OS=Danio rerio OX=7955 GN=calua PE=1 S... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calua1.329e-4733.23calumenin [Source:NCBI gene;Acc:103043492][more]
calub6.984e-4533.46calumenin-B [Source:NCBI gene;Acc:103027690][more]
rcn15.337e-4031.39reticulocalbin 1 [Source:NCBI gene;Acc:103039743][more]
rcn31.174e-3630.51reticulocalbin 3 [Source:NCBI gene;Acc:103045651][more]
rcn21.153e-2226.49reticulocalbin 2 [Source:NCBI gene;Acc:103045530][more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CALU6.712e-4431.97calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
CALU4.703e-3025.94calumenin [Source:HGNC Symbol;Acc:HGNC:1458][more]
rcn21.271e-1733.96reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
rcn22.120e-1733.96reticulocalbin 2 [Source:ZFIN;Acc:ZDB-GENE-050706-... [more]
sdf43.933e-1223.02stromal cell derived factor 4 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO326381.370e-4529.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476733.433e-3229.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO358445.546e-2429.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311699.631e-2226.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427892.440e-2127.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Reticulocalbin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
calub1.829e-4530.97calumenin [Source:NCBI gene;Acc:101165303][more]
rcn14.441e-4332.12reticulocalbin 1 [Source:NCBI gene;Acc:101175141][more]
rcn34.598e-4030.77reticulocalbin-1 [Source:NCBI gene;Acc:101175408][more]
pstpip1a3.819e-2226.21proline-serine-threonine phosphatase-interacting p... [more]
pstpip1a2.577e-1425.47proline-serine-threonine phosphatase-interacting p... [more]
back to top
BLAST of Reticulocalbin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077405.10.000e+099.34SMESG000077405.1[more]
SMESG000077405.10.000e+099.30SMESG000077405.1[more]
SMESG000077404.12.842e-7546.99SMESG000077404.1[more]
SMESG000077404.14.070e-7546.99SMESG000077404.1[more]
SMESG000012033.15.980e-4032.42SMESG000012033.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026101 ID=SMED30026101|Name=Reticulocalbin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1200bp
GTAAAAAATTCAGATGAGATAATATATGCTGACCAAACTTGTTTTATGAA
ATATATCTGTAACATTTTGTATTTTCTTCAGTTTTCAATAGCTTCATTCA
TTCAATACAATGTTGACAAGCTGCTATATTCTTTTAATTTGTGTCCAAGT
TTATATGGTCACATGTTATTTCGATAATTTCGAGGAAATAAAGGATCTAT
TTAAAGATATGCAATTTCCCGGTGATGACTTTTTTGACGGAAGTCTAATT
TTAGAAGAGGAAGAATCAAAAAATTTTGACAGTTTATCGGAAGATGAGAA
AAAATCTAGATTCGGTGAAATTATTGATAAAATGGATAAAGATCATGACA
ATCAAGTCAGTTCAACTGAGTTAAAAAATTGGATGAAAGTTATTCACGAA
AAGAAACTTATTGAAGACGTGGAAGGTCATTGGAAAACAATTTCTCCAGA
AAACAGTGAAACAATTAACTTTCAAAAATATTTTGAACATACTTTTGGTC
AAAAAGTTTCAATTCCATATAAAAAATTACACAAATTAGAAAAAAAGAAA
TGGGAAACAGCTGACTTGAACAAAGATGATTTGTTAAATAAAACTGAATT
TCTTCGATTTTTACATCCAATAGAATTTGAAGAAATGAAGCCAATAGTTG
CCGAGGAATTGCTTGAATCTATGGATACAAATAATGATTCATTCTTAGAT
ATTAATGAATATTTGGCTGAAATATTTTCTGATATGAAGAAAGTTGACAG
AACACTTATTGAAGATGAAAACTCAACTTTTCAAAATGATTTAGATATAA
ATAAAGATGGAGTGTTAGATACAGAAGAAATTCAAAAATGGCAGCTTCCC
GCGAGTTATAATAAAATTGAAGAAGAAGTAAAACATATTATGAAACTAGT
AGATGTGGATCGTAATGAATTGTTAAGCAAAACAGAAATGTTGAACAAAT
ATAATATATTTTTAAAAAGTAAAATGTCTGATGAACAAAAGCCAACATTG
GGACATGAAGAACTTTAGCATTTCTCTAAATAAAAATCTAAATAAATGAA
AATCACATTGCATGTTGACATGTTTTATGGAATAATAACATAATTAACTT
TAGTTATTATTTTGACTTTTTAATTAATTTGAATAATTGTTTATAATATT
ATTGCTTTTAAATACATTTCGTACATTTGGATAAATCATAGAAAACCTCA
back to top

protein sequence of SMED30026101-orf-1

>SMED30026101-orf-1 ID=SMED30026101-orf-1|Name=SMED30026101-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MLTSCYILLICVQVYMVTCYFDNFEEIKDLFKDMQFPGDDFFDGSLILEE
EESKNFDSLSEDEKKSRFGEIIDKMDKDHDNQVSSTELKNWMKVIHEKKL
IEDVEGHWKTISPENSETINFQKYFEHTFGQKVSIPYKKLHKLEKKKWET
ADLNKDDLLNKTEFLRFLHPIEFEEMKPIVAEELLESMDTNNDSFLDINE
YLAEIFSDMKKVDRTLIEDENSTFQNDLDINKDGVLDTEEIQKWQLPASY
NKIEEEVKHIMKLVDVDRNELLSKTEMLNKYNIFLKSKMSDEQKPTLGHE
EL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005788endoplasmic reticulum lumen
GO:0005576extracellular region
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016529sarcoplasmic reticulum
GO:0033018sarcoplasmic reticulum lumen
GO:0042470melanosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR002048EF_hand_dom
IPR011992EF-hand-dom_pair
IPR018247EF_Hand_1_Ca_BS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0046872metal ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002048EF-hand domainSMARTSM00054efh_1coord: 143..171
e-value: 31.0
score: 5.8
coord: 256..284
e-value: 6.7
score: 11.1
coord: 180..208
e-value: 58.0
score: 3.6
coord: 67..95
e-value: 0.023
score: 23.9
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 176..211
score: 5.587
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 145..174
score: 7.428
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 252..287
score: 8.962
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 63..98
score: 12.672
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 226..251
score: 6.452
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 57..97
e-value: 1.3E-5
score: 26.4
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 210..295
e-value: 1.7E-7
score: 33.3
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 98..209
e-value: 3.9E-7
score: 32.3
NoneNo IPR availablePANTHERPTHR10827:SF52IP16409Pcoord: 43..301
NoneNo IPR availablePANTHERPTHR10827RETICULOCALBINcoord: 43..301
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.636
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 229..241
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 76..88
IPR018247EF-Hand 1, calcium-binding sitePROSITEPS00018EF_HAND_1coord: 152..164
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 23..169
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 145..279