slc10a-3

Overview
Nameslc10a-3 (AKN21470.1)
Smed IDSMED30026098
Length (bp)1543
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc10a-3 (SMED30026098) t-SNE clustered cells

Violin plots show distribution of expression levels for slc10a-3 (SMED30026098) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc10a-3 (SMED30026098) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc10a-3 (SMED30026098) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026098

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30026098SMESG000064829.1 Contig2382GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc10a-3 vs. Ensembl Human
Match: SLC10A2 (solute carrier family 10 member 2 [Source:HGNC Symbol;Acc:HGNC:10906])

HSP 1 Score: 127.872 bits (320), Expect = 3.574e-32
Identity = 89/284 (31.34%), Postives = 150/284 (52.82%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIK-KRYFTKEKLEYEAAQ 1392
            MGC ++  +   +IK+P    +GF  QF  MPL    L+  + I     + +L IGC PGG +SN+      GD++LS++MT  S+  AL MMPL L I ++++VD   I IP+DNI  +L+ +V+PV +G+    K+  KA  I+K   + G   +V I   G  +Y + +I   +A  +++  +G   P  G+SLG+LL+ +      +   ++ ETG QN  +   I++ S    E ++     +I SIF  +    ++L  ++  K+   K K E   ++
Sbjct:   49 MGCNVEIKKFLGHIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWI---IAPKLWI--IGTIFPVAGYSLGFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQ-LAFAAIFLGFYVAYKKCHGKNKAEIPESK 326          
BLAST of slc10a-3 vs. Ensembl Human
Match: SLC10A1 (solute carrier family 10 member 1 [Source:HGNC Symbol;Acc:HGNC:10905])

HSP 1 Score: 115.931 bits (289), Expect = 6.059e-28
Identity = 80/238 (33.61%), Postives = 127/238 (53.36%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLI-KIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            +GC ++  ++  ++ KP   AI   +Q+  MPL +  L K++ +     L +L  GCSPGG  SNV+++   GD+NLS+ MT  S+  AL MMPL L+I SR   D  L  K+P+  I  +L++V+IP  +GI+ + K       ++K   +I L   V +       N     + A    L+   + +P++GF LGY+LS +     +    +S+ETG QNV +   IL  + P PE
Sbjct:   42 LGCTMEFSKIKAHLWKPKGLAIALVAQYGIMPLTAFVLGKVFRLKNIEALAILVCGCSPGGNLSNVFSLAMKGDMNLSIVMTTCSTFCALGMMPLLLYIYSRGIYDGDLKDKVPYKGIVISLVLVLIPCTIGIVLKSKRPQYMRYVIKGGMIIILLCSVAVTVLSAI-NVGKSIMFAMTPLLIATSSLMPFIGFLLGYVLSALFCLNGRCRRTVSMETGCQNVQLCSTILNVAFP-PE 277          
BLAST of slc10a-3 vs. Ensembl Human
Match: SLC10A6 (solute carrier family 10 member 6 [Source:HGNC Symbol;Acc:HGNC:30603])

HSP 1 Score: 107.842 bits (268), Expect = 6.972e-25
Identity = 68/232 (29.31%), Postives = 124/232 (53.45%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYS 1245
            +GC ++  +++ +I++P   A+G   QF  MP  +  LA  + +     + +L +GC PGG  SN++T    GD++LS++MT  S+ AAL MMPL +++ +  +     + IP+ NI   L+ + IPV  G+   +++  ++  I+   K+  +   V +L   +             + LL +    P +G   G+LL+L T ++ ++   ISLETG QN+ + I +L+ S
Sbjct:   49 LGCSVEIRKLWSHIRRPWGIAVGLLCQFGLMPFTAYLLAISFSLKPVQAIAVLIMGCCPGGTISNIFTFWVDGDMDLSISMTTCSTVAALGMMPLCIYLYTWSWSLQQNLTIPYQNIGITLVCLTIPVAFGVYVNYRWPKQSKIIL---KIGAVVGGVLLLVVAVAGVVLAKGSWNSDITLLTISFIFPLIGHVTGFLLALFTHQSWQRCRTISLETGAQNIQMCITMLQLS 277          
BLAST of slc10a-3 vs. Ensembl Human
Match: SLC10A3 (solute carrier family 10 member 3 [Source:HGNC Symbol;Acc:HGNC:22979])

HSP 1 Score: 105.531 bits (262), Expect = 9.857e-24
Identity = 73/250 (29.20%), Postives = 131/250 (52.40%), Query Frame = 1
Query:  553 GCGIDRLEVFKYIKKPISPAI-GFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSI 1299
            GC ++ LEV K + +   P + G   QF+ MPL +  +AK++ +  A  LGL+    SPGGG S +++++ GGD+ L+++MTF+S+ AA   +PL   I SR+      + +P   I   LL + IP+ +G+L + K    +  +++  K      ++  L        +I   +   + L  VG ++P VG  +GY L+   +    Q   +S+E G QN  +A+ +L+ S+ + + D  +    IV++
Sbjct:  179 GCKVE-LEVLKGLMQSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGVFILAGIRLPIVL--VGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVAL 425          
BLAST of slc10a-3 vs. Ensembl Human
Match: SLC10A3 (solute carrier family 10 member 3 [Source:HGNC Symbol;Acc:HGNC:22979])

HSP 1 Score: 104.375 bits (259), Expect = 2.539e-23
Identity = 73/250 (29.20%), Postives = 131/250 (52.40%), Query Frame = 1
Query:  553 GCGIDRLEVFKYIKKPISPAI-GFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSI 1299
            GC ++ LEV K + +   P + G   QF+ MPL +  +AK++ +  A  LGL+    SPGGG S +++++ GGD+ L+++MTF+S+ AA   +PL   I SR+      + +P   I   LL + IP+ +G+L + K    +  +++  K      ++  L        +I   +   + L  VG ++P VG  +GY L+   +    Q   +S+E G QN  +A+ +L+ S+ + + D  +    IV++
Sbjct:  208 GCKVE-LEVLKGLMQSPQPMLLGLLGQFLVMPLYAFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLPLSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSFVLLLGGLFLAYRMGVFILAGIRLPIVL--VGITVPLVGLLVGYCLATCLKLPVAQRRTVSIEVGVQNSLLALAMLQLSLRRLQADYASQAPFIVAL 454          
BLAST of slc10a-3 vs. Ensembl Celegans
Match: Y71G10AR.4 (pep chromosome:WBcel235:IV:2199041:2209051:1 gene:WBGene00044650.1 transcript:Y71G10AR.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71G10AR.4)

HSP 1 Score: 206.838 bits (525), Expect = 3.973e-60
Identity = 111/263 (42.21%), Postives = 167/263 (63.50%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLA-KLYGIDG--AFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVD----PTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPL 1317
            MGC +D   V   +KKP++P IG  +QF+ MPLLS  +A  ++   G  +  LGL   GCSPGGG+SN WT++  G+LNLS+TMTFIS+  +LVMMP WL+ L   F+       +IK+P+  IA  L+ +++P+L+GI  +    + AAK  K  +   +F ++F++ FG   N Y+F+++     +   G +LPW GF  G   +L+T+R  +   AI++ETG QN GIAI++LK S  QP+ D+G+++ VIV+ FTP PL
Sbjct:  199 MGCELDIDAVLATLKKPVAPGIGLFAQFIIMPLLSYLIAYAIFMPRGLYSMALGLFVTGCSPGGGASNFWTLLLDGNLNLSVTMTFISTICSLVMMPAWLYFLGHPFLQGFNSTAVIKVPYGKIASQLVTLILPLLIGIAIKKFKPTWAAKARKIMRPFVIFVMIFVVIFGSLTNLYMFRMLTGPALI--GGLALPWCGFMFGCFAALLTKRKPEDVTAIAVETGIQNTGIAILLLKASFGQPDADIGSLIPVIVAAFTPGPL 459          
BLAST of slc10a-3 vs. Ensembl Fly
Match: CG11655 (gene:FBgn0030638 transcript:FBtr0074031)

HSP 1 Score: 152.14 bits (383), Expect = 2.114e-40
Identity = 108/345 (31.30%), Postives = 184/345 (53.33%), Query Frame = 1
Query:  304 KNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFK-YIKKPISPAIGFCSQFVFMPLLSAGLAK-LYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYL 1332
            ++WT  +  V+   L Q    + LY  +  ++ L     ++  L +  K         R   VV+ +F   I + + ++    G  ++ L+V +  I +P  P IGF  Q V MPLLS  L   ++    A  LGL   G SP GG+SN W+ + GG+++LS+ MT +S+ AA   +PLW   L ++  +   IK+P+  IA     +V+P+LLG+L + +    A  +++  K +  F ++FI+ F I  NFY+F L +  + +   G +LP +G+   +L + +  +    ++ I++ETG QN GIAI +L  ++  PE D+  V+ V V++ TP+PL  +YL
Sbjct:   96 RDWTG-DIVVNGHFLGQTKIQVKLYDSQRNTSELPTNWSNDSTLDVKIK---------RPKRVVDDIFLGTIILLMSLLYISFGAALN-LDVLRGLITRPTGPCIGFVMQVVGMPLLSYALGVFIFPQAPAMQLGLFFTGISPSGGASNTWSAVLGGNIHLSVLMTTVSNVAAFATIPLWTITLGQLIFERAGIKVPYGKIASYSSSLVLPLLLGLLVQKRMPQVARVLVRLLKPVSAFIILFIIVFAIINNFYLFYLFSWQIVV--AGMALPGLGYIFAFLAAKLLHQNAADALTIAIETGIQNTGIAIFLLTTTLESPEADITTVVPVSVAVMTPLPLLGIYL 427          
BLAST of slc10a-3 vs. Ensembl Fly
Match: CG9903 (gene:FBgn0030756 transcript:FBtr0074297)

HSP 1 Score: 84.7297 bits (208), Expect = 3.372e-17
Identity = 73/284 (25.70%), Postives = 137/284 (48.24%), Query Frame = 1
Query:  385 RLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDG-AFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGA-SLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAII 1230
            R G + LE +LKS   +   Y + +  + V+R   V E +   +     L++   +G  +D   +   I +P+ P +G  S+FV MP +  GL +    D     L L     SP GG +NV  V   G++NLS+  T I+S  AL ++P+W+ +L RI  +   + +PF  ++     +V  + +G+L R         I ++ K + +   + ++   +  N ++F    ++ + + V A  LP  G+   YLLS +  R+   ++ +++E    N+ + I+
Sbjct:  112 RFGYSSLEVELKSG-AVTETYPKPL-PITVLRTQVVDERITTYVSAALALLMFLNLGTVLDMQRLAGIICRPVGPVVGVVSRFVLMPAVGFGLGRALWPDSWPLQLALFYTALSPSGGLANVCAVFLKGNINLSVATTTINSLLALALLPIWILVLGRILYEDDELTVPFGQLSGGAAALVACLAIGVLLRLCLPRTTRFIFRFLKPLSVVLSLCLVGLTVGLNSFVFY---EFTWQILVAAVCLPLAGYLSTYLLSKILCRSSTDALTLAIEASVLNMTMPIV 390          
BLAST of slc10a-3 vs. Ensembl Zebrafish
Match: slc10a2 (solute carrier family 10 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1328])

HSP 1 Score: 124.79 bits (312), Expect = 3.525e-31
Identity = 90/282 (31.91%), Postives = 153/282 (54.26%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF----TPIPLYVLYLIIFIKKRYFTKEKLE 1377
            MGC ++  +++ ++++P    IGF  QF  MP  +  L+ L+ +     + ++ +GC PGG SSNV+     GD++LS++MT  SS  AL MMPL L I + I+     I+IP+DNI   L+ +++PV LG+L + K+   A KI+K   V+G+  ++ I   G  +Y + +    +A  +++  +G   P++GF LG+LL+    +   +   I+LETG QN  +A  I + S    E ++     +I SIF      I + + Y I   + +   +E  E
Sbjct:   50 MGCTVEARKLWGHVRRPWGIFIGFLCQFGIMPFTAFILSLLFNVLPVQAVVIIIMGCCPGGSSSNVFCYWLDGDMDLSISMTACSSILALGMMPLCLLIYTTIWTAGDAIQIPYDNIGITLVSLLVPVGLGMLVKHKWPKAAKKILKVGSVVGIVLIIVIAVIGGVLYQSSWT---IAPSLWI--IGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGMQNAQLASTITQLSFSPAELEVMFAFPLIYSIFQLVVAGIAVSIHYSIKRCRHQTLVEEDGE 326          
BLAST of slc10a-3 vs. Ensembl Zebrafish
Match: slc10a2 (solute carrier family 10 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1328])

HSP 1 Score: 124.79 bits (312), Expect = 3.928e-31
Identity = 90/282 (31.91%), Postives = 153/282 (54.26%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF----TPIPLYVLYLIIFIKKRYFTKEKLE 1377
            MGC ++  +++ ++++P    IGF  QF  MP  +  L+ L+ +     + ++ +GC PGG SSNV+     GD++LS++MT  SS  AL MMPL L I + I+     I+IP+DNI   L+ +++PV LG+L + K+   A KI+K   V+G+  ++ I   G  +Y + +    +A  +++  +G   P++GF LG+LL+    +   +   I+LETG QN  +A  I + S    E ++     +I SIF      I + + Y I   + +   +E  E
Sbjct:   50 MGCTVEARKLWGHVRRPWGIFIGFLCQFGIMPFTAFILSLLFNVLPVQAVVIIIMGCCPGGSSSNVFCYWLDGDMDLSISMTACSSILALGMMPLCLLIYTTIWTAGDAIQIPYDNIGITLVSLLVPVGLGMLVKHKWPKAAKKILKVGSVVGIVLIIVIAVIGGVLYQSSWT---IAPSLWI--IGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGMQNAQLASTITQLSFSPAELEVMFAFPLIYSIFQLVVAGIAVSIHYSIKRCRHQTLVEEDGE 326          
BLAST of slc10a-3 vs. Ensembl Zebrafish
Match: slc10a4 (solute carrier family 10 member 4 [Source:ZFIN;Acc:ZDB-GENE-041014-249])

HSP 1 Score: 123.25 bits (308), Expect = 3.676e-30
Identity = 79/238 (33.19%), Postives = 132/238 (55.46%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVD-PTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMK---WAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIP 1251
            +GC ++  ++ ++I+KPI   +    QFV MPL++  LA  + ++    + +L  GC PGG  SN+ T++  GD+NLS+ MT  S+  ALV+MPL L++ SR +++ P +  +PF  I   L   +IP+ LG+  R ++   A  I+K   W+ ++ L  ++FI+T G      +   +   VYL  V   +P  G++ GY L+ +          +SLETG QN+ +   ILK + P
Sbjct:   91 LGCTVELSQLGEHIRKPIGVLLAAVCQFVLMPLIAFLLALAFSLNDVAAMAVLLCGCCPGGNLSNIMTLLVNGDMNLSIIMTISSTLLALVLMPLCLWMYSRAWINTPVVDLLPFGPIILTLCSTLIPIGLGVWLRQRYIHVAEVIIKVSLWSLLVTL-LMLFIMT-GTMLGPELLATIPASVYL--VAVLMPMAGYTAGYGLATLFDLPPNSRRTVSLETGCQNIQLCTAILKLAFP 324          
BLAST of slc10a-3 vs. Ensembl Zebrafish
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 98.2117 bits (243), Expect = 4.746e-22
Identity = 72/236 (30.51%), Postives = 126/236 (53.39%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIK-IPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFI-LTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIP 1251
            +GC +D  ++  ++ KP    I   +Q+  MP  +  LAKL+ +     L +L  GC PGG  SN++ +   GD+NLS+ MT  S+  AL MMPL L++ S  F +  L+  +PF  I ++L+++++P  +GIL  ++    +  I +    + L   + I +  G+     IF++++    L+   A +P  G+  GY+LS + R  +     +S+E G QN+ +   ILK + P
Sbjct:   52 LGCTMDISKIKDHLMKPKGVVIAVGAQYGIMPFTAFCLAKLFRLSPMESLSVLICGCCPGGNLSNIFALALQGDMNLSIVMTACSTVLALAMMPLLLYLYSWGFSN--LVDFVPFTGIIFSLILILVPCGIGILLNYRVPQYSKIITQAGLTLMLISCIVIGVLAGVADGGQIFKVLSS--QLVATAALMPLTGYIFGYILSALFRMNEPCRRTVSMEVGCQNIQLCTTILKVAFP 283          
BLAST of slc10a-3 vs. Ensembl Zebrafish
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 98.2117 bits (243), Expect = 4.746e-22
Identity = 72/236 (30.51%), Postives = 126/236 (53.39%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIK-IPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFI-LTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIP 1251
            +GC +D  ++  ++ KP    I   +Q+  MP  +  LAKL+ +     L +L  GC PGG  SN++ +   GD+NLS+ MT  S+  AL MMPL L++ S  F +  L+  +PF  I ++L+++++P  +GIL  ++    +  I +    + L   + I +  G+     IF++++    L+   A +P  G+  GY+LS + R  +     +S+E G QN+ +   ILK + P
Sbjct:   52 LGCTMDISKIKDHLMKPKGVVIAVGAQYGIMPFTAFCLAKLFRLSPMESLSVLICGCCPGGNLSNIFALALQGDMNLSIVMTACSTVLALAMMPLLLYLYSWGFSN--LVDFVPFTGIIFSLILILVPCGIGILLNYRVPQYSKIITQAGLTLMLISCIVIGVLAGVADGGQIFKVLSS--QLVATAALMPLTGYIFGYILSALFRMNEPCRRTVSMEVGCQNIQLCTTILKVAFP 283          
BLAST of slc10a-3 vs. Ensembl Xenopus
Match: ENSXETT00000008686.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 139.813 bits (351), Expect = 2.432e-36
Identity = 86/253 (33.99%), Postives = 142/253 (56.13%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF 1302
            MGC +D  + + +IK+P   A+GF  QF  MPL +  L+  + I     + +L +GC PGG SSN+      GD++LS++MT  S+  AL MMPL LF+ ++ +VD   I IP+D+I  +L+ +V+PV +GI    K+  +A KI+K   V G   +V I   G  +Y   +    +A  +++  VG   P  G++ G+ L+ ++++T ++   ++LETG QN  +   I++ S    +  L     +I SIF
Sbjct:   59 MGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGGVLYKGSWT---IAPSLWI--VGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 306          
BLAST of slc10a-3 vs. Ensembl Xenopus
Match: ENSXETT00000008944.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 139.043 bits (349), Expect = 2.992e-36
Identity = 86/253 (33.99%), Postives = 142/253 (56.13%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF 1302
            MGC +D  + + +IK+P   A+GF  QF  MPL +  L+  + I     + +L +GC PGG SSN+      GD++LS++MT  S+  AL MMPL LF+ ++ +VD   I IP+D+I  +L+ +V+PV +GI    K+  +A KI+K   V G   +V I   G  +Y   +    +A  +++  VG   P  G++ G+ L+ ++++T ++   ++LETG QN  +   I++ S    +  L     +I SIF
Sbjct:   49 MGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGGVLYKGSWT---IAPSLWI--VGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 296          
BLAST of slc10a-3 vs. Ensembl Xenopus
Match: ENSXETT00000008699.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 138.658 bits (348), Expect = 3.757e-36
Identity = 86/253 (33.99%), Postives = 142/253 (56.13%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF 1302
            MGC +D  + + +IK+P   A+GF  QF  MPL +  L+  + I     + +L +GC PGG SSN+      GD++LS++MT  S+  AL MMPL LF+ ++ +VD   I IP+D+I  +L+ +V+PV +GI    K+  +A KI+K   V G   +V I   G  +Y   +    +A  +++  VG   P  G++ G+ L+ ++++T ++   ++LETG QN  +   I++ S    +  L     +I SIF
Sbjct:   44 MGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGGVLYKGSWT---IAPSLWI--VGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 291          
BLAST of slc10a-3 vs. Ensembl Xenopus
Match: ENSXETT00000008959.1 (solute carrier family 10 (sodium/bile acid cotransporter), member 2 [Source:NCBI gene;Acc:100487141])

HSP 1 Score: 138.658 bits (348), Expect = 4.203e-36
Identity = 86/253 (33.99%), Postives = 142/253 (56.13%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF 1302
            MGC +D  + + +IK+P   A+GF  QF  MPL +  L+  + I     + +L +GC PGG SSN+      GD++LS++MT  S+  AL MMPL LF+ ++ +VD   I IP+D+I  +L+ +V+PV +GI    K+  +A KI+K   V G   +V I   G  +Y   +    +A  +++  VG   P  G++ G+ L+ ++++T ++   ++LETG QN  +   I++ S    +  L     +I SIF
Sbjct:   46 MGCTVDIKKFWGHIKRPWGIAVGFLCQFGIMPLTAFVLSIAFDILPVQAVAVLIMGCCPGGTSSNILAYWVDGDMDLSISMTTCSTLLALGMMPLCLFLYTKKWVDSNDIVIPYDSIGISLVTLVVPVGIGIFVNHKWPKQAKKILKVGSVTGAILIVLIAVIGGVLYKGSWT---IAPSLWI--VGTIFPAAGYTFGFFLAYISKQTWRRCRTVALETGMQNTQLCTTIVQLSFSPDDLALMFTFPLIYSIF 293          
BLAST of slc10a-3 vs. Ensembl Xenopus
Match: ENSXETT00000008675.1 (ileal sodium/bile acid cotransporter-like [Source:NCBI gene;Acc:100498575])

HSP 1 Score: 127.487 bits (319), Expect = 3.483e-32
Identity = 79/253 (31.23%), Postives = 138/253 (54.55%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF 1302
            +GC ++  + + +I+ P    +GF  QF  MPL    L+  + I     + +L +GC PGG  SN+ T    GD++LS++MT  S+  AL MMPL LF+ ++ +VD + I IP+D+I  +L  +V+PV +G+   +K+  KA KI+K   ++G   +V +   G  +Y   +        +++L  G   P +G+++G+ L+ ++  T  +   ++LETG QN  +   I++ S    +  L     +I SIF
Sbjct:   47 LGCSVEFQKFWGHIRHPWGIVVGFLCQFGIMPLAGFVLSLAFNILPIQAVVVLIMGCCPGGTGSNILTYWIDGDMDLSLSMTTCSTLLALGMMPLCLFLYTKKWVDSSAIIIPYDSIGISLATLVVPVAVGMFVNYKWPEKAKKILKVGSIVGGILIVLVAVIGGVLYRGSWTID---PKLWIL--GTIFPAIGYTVGFTLAYISNLTPSRCRTVALETGMQNTQLCSTIVQLSFTPEQLGLIFTFPLIYSIF 294          
BLAST of slc10a-3 vs. Ensembl Mouse
Match: Slc10a2 (solute carrier family 10, member 2 [Source:MGI Symbol;Acc:MGI:1201406])

HSP 1 Score: 129.798 bits (325), Expect = 4.580e-33
Identity = 86/279 (30.82%), Postives = 145/279 (51.97%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEY 1380
            MGC ++  +   +IK+P    +GF  QF  MPL    L+   GI     + +L +GC PGG  SN+      GD++LS++MT  S+  AL MMPL LF+ ++++VD   I IP+D+I  +L+ +VIPV  G+    K+  KA  I+K   + G+  +V I   G  +Y + +I +       L  +G   P  G+SLG+ L+ +  +   +   ++LETG QN  +   I++ S    + +L     +I ++F  +   V+  I    ++ + K   E+
Sbjct:   49 MGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIE-----PKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAVILGIYVTYRKCYGKNDAEF 322          
BLAST of slc10a-3 vs. Ensembl Mouse
Match: Slc10a1 (solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Source:MGI Symbol;Acc:MGI:97379])

HSP 1 Score: 122.479 bits (306), Expect = 2.363e-30
Identity = 84/240 (35.00%), Postives = 128/240 (53.33%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLI-KIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVI--GLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            +GC ++  ++  +  KP    I   +Q+  MPL +  L K++ +     L +L  GCSPGG  SN++T+   GD+NLS+ MT  SS  AL MMPL L+I S+   D  L  K+P+  I  +L+MV+IP  +GI  + K       ++K   +I   L   V +L+     N  +F +     +LL   + +P+ GF +GY+LS + R        IS+ETGFQNV +   IL  + P PE
Sbjct:   42 LGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTP---HLLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFP-PE 277          
BLAST of slc10a-3 vs. Ensembl Mouse
Match: Slc10a1 (solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Source:MGI Symbol;Acc:MGI:97379])

HSP 1 Score: 122.479 bits (306), Expect = 2.363e-30
Identity = 84/240 (35.00%), Postives = 128/240 (53.33%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLI-KIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVI--GLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            +GC ++  ++  +  KP    I   +Q+  MPL +  L K++ +     L +L  GCSPGG  SN++T+   GD+NLS+ MT  SS  AL MMPL L+I S+   D  L  K+P+  I  +L+MV+IP  +GI  + K       ++K   +I   L   V +L+     N  +F +     +LL   + +P+ GF +GY+LS + R        IS+ETGFQNV +   IL  + P PE
Sbjct:   42 LGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTP---HLLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFP-PE 277          
BLAST of slc10a-3 vs. Ensembl Mouse
Match: Slc10a1 (solute carrier family 10 (sodium/bile acid cotransporter family), member 1 [Source:MGI Symbol;Acc:MGI:97379])

HSP 1 Score: 121.709 bits (304), Expect = 2.419e-30
Identity = 84/240 (35.00%), Postives = 128/240 (53.33%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLI-KIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVI--GLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            +GC ++  ++  +  KP    I   +Q+  MPL +  L K++ +     L +L  GCSPGG  SN++T+   GD+NLS+ MT  SS  AL MMPL L+I S+   D  L  K+P+  I  +L+MV+IP  +GI  + K       ++K   +I   L   V +L+     N  +F +     +LL   + +P+ GF +GY+LS + R        IS+ETGFQNV +   IL  + P PE
Sbjct:   42 LGCTMEFSKIKAHFWKPKGVIIAIVAQYGIMPLSAFLLGKVFHLTSIEALAILICGCSPGGNLSNLFTLAMKGDMNLSIVMTTCSSFTALGMMPLLLYIYSKGIYDGDLKDKVPYKGIMLSLVMVLIPCAIGIFLKSKRPHYVPYVLKAGMIITFSLSVAVTVLSVINVGNSIMFVMTP---HLLATSSLMPFTGFLMGYILSALFRLNPSCRRTISMETGFQNVQLCSTILNVTFP-PE 277          
BLAST of slc10a-3 vs. Ensembl Mouse
Match: Slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter family), member 6 [Source:MGI Symbol;Acc:MGI:1923000])

HSP 1 Score: 120.553 bits (301), Expect = 1.430e-29
Identity = 75/232 (32.33%), Postives = 131/232 (56.47%), Query Frame = 1
Query:  553 GCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVI-GLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYS 1245
            GC ++  +++ ++++P   A+G  SQF  MPL +  LA  +G+     + +L +G  PGG  SNV T    GD++LS++MT  S+ AAL MMPL L+I +R +     + IP+ +I   L+ +V+PV  G+   +++  +A  I+K   ++ G+  +V  +T  + A  +        V LL +    P VG   G+LL+ +T ++ ++   IS+ETG QN+ + I +L+ S
Sbjct:   50 GCSVESQKLWLHLRRPWGIAVGLLSQFGLMPLTAYLLAIGFGLKPFQAIAVLMMGSCPGGTISNVLTFWVDGDMDLSISMTTCSTVAALGMMPLCLYIYTRSWTLTQNLVIPYQSIGITLVSLVVPVASGVYVNYRWPKQATVILKVGAILGGMLLLVVAVTGMVLAKGW-----NTDVTLLVISCIFPLVGHVTGFLLAFLTHQSWQRCRTISIETGAQNIQLCIAMLQLS 276          
BLAST of slc10a-3 vs. UniProt/SwissProt
Match: sp|Q28727|NTCP2_RABIT (Ileal sodium/bile acid cotransporter OS=Oryctolagus cuniculus OX=9986 GN=SLC10A2 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 4.828e-33
Identity = 92/272 (33.82%), Postives = 148/272 (54.41%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMS--VIVSIFTPIPLYVLYLIIFIKKR 1353
            MGC ++  +   +I++P    IGF  QF  MPL    LA  +GI     + +L +GC PGG +SN+      GD++LS++MT  S+  AL MMPL L++ ++++VD   I IP+DNI  +L+ +V+PV +G+    K+  KA  I+K   + G   +V I   G  +Y + +I +       L  +G   P  G+SLG+ L+ +  +   +   ++LETG QN  +   I++ S   PE DL  V +  +I SIF  I    ++L I++  R
Sbjct:   50 MGCNVEIKKFLGHIRRPWGIFIGFLCQFGIMPLTGFVLAVAFGIMPIQAVVVLIMGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLYVYTKMWVDSGTIVIPYDNIGTSLVALVVPVSIGMFVNHKWPQKAKIILKVGSIAGAVLIVLIAVVGGILYQSAWIIE-----PKLWIIGTIFPMAGYSLGFFLARIAGQPWYRCRTVALETGMQNTQLCSTIVQLSF-SPE-DLTYVFTFPLIYSIFQ-IAFAAIFLGIYVAYR 313          
BLAST of slc10a-3 vs. UniProt/SwissProt
Match: sp|P70172|NTCP2_MOUSE (Ileal sodium/bile acid cotransporter OS=Mus musculus OX=10090 GN=Slc10a2 PE=1 SV=2)

HSP 1 Score: 129.798 bits (325), Expect = 3.204e-32
Identity = 86/279 (30.82%), Postives = 145/279 (51.97%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEY 1380
            MGC ++  +   +IK+P    +GF  QF  MPL    L+   GI     + +L +GC PGG  SN+      GD++LS++MT  S+  AL MMPL LF+ ++++VD   I IP+D+I  +L+ +VIPV  G+    K+  KA  I+K   + G+  +V I   G  +Y + +I +       L  +G   P  G+SLG+ L+ +  +   +   ++LETG QN  +   I++ S    + +L     +I ++F  +   V+  I    ++ + K   E+
Sbjct:   49 MGCNVEVHKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFVYTKMWVDSGTIVIPYDSIGISLVALVIPVSFGMFVNHKWPQKAKIILKIGSITGVILIVLIAVIGGILYQSAWIIE-----PKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAVILGIYVTYRKCYGKNDAEF 322          
BLAST of slc10a-3 vs. UniProt/SwissProt
Match: sp|Q12908|NTCP2_HUMAN (Ileal sodium/bile acid cotransporter OS=Homo sapiens OX=9606 GN=SLC10A2 PE=1 SV=2)

HSP 1 Score: 127.872 bits (320), Expect = 1.716e-31
Identity = 89/284 (31.34%), Postives = 150/284 (52.82%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIK-KRYFTKEKLEYEAAQ 1392
            MGC ++  +   +IK+P    +GF  QF  MPL    L+  + I     + +L IGC PGG +SN+      GD++LS++MT  S+  AL MMPL L I ++++VD   I IP+DNI  +L+ +V+PV +G+    K+  KA  I+K   + G   +V I   G  +Y + +I   +A  +++  +G   P  G+SLG+LL+ +      +   ++ ETG QN  +   I++ S    E ++     +I SIF  +    ++L  ++  K+   K K E   ++
Sbjct:   49 MGCNVEIKKFLGHIKRPWGICVGFLCQFGIMPLTGFILSVAFDILPLQAVVVLIIGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLLIYTKMWVDSGSIVIPYDNIGTSLVSLVVPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWI---IAPKLWI--IGTIFPVAGYSLGFLLARIAGLPWYRCRTVAFETGMQNTQLCSTIVQLSFTPEELNVVFTFPLIYSIFQ-LAFAAIFLGFYVAYKKCHGKNKAEIPESK 326          
BLAST of slc10a-3 vs. UniProt/SwissProt
Match: sp|Q62633|NTCP2_RAT (Ileal sodium/bile acid cotransporter OS=Rattus norvegicus OX=10116 GN=Slc10a2 PE=2 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 3.718e-31
Identity = 86/279 (30.82%), Postives = 144/279 (51.61%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEY 1380
            MGC ++  +   +IK+P    +GF  QF  MPL    L+   GI     + +L +GC PGG  SN+      GD++LS++MT  S+  AL MMPL LFI ++++VD   I IP+D+I  +L+ +VIPV +G+    K+  KA  I+K   + G   +V I   G  +Y + +I +       L  +G   P  G+SLG+ L+ +  +   +   ++LETG QN  +   I++ S    + +L     +I ++F  +   ++  +    K+   K   E+
Sbjct:   49 MGCNVEINKFLGHIKRPWGIFVGFLCQFGIMPLTGFILSVASGILPVQAVVVLIMGCCPGGTGSNILAYWIDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGISLVALVIPVSIGMFVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWIIE-----PKLWIIGTIFPIAGYSLGFFLARLAGQPWYRCRTVALETGMQNTQLCSTIVQLSFSPEDLNLVFTFPLIYTVFQLVFAAIILGMYVTYKKCHGKNDAEF 322          
BLAST of slc10a-3 vs. UniProt/SwissProt
Match: sp|Q60414|NTCP2_CRIGR (Ileal sodium/bile acid cotransporter OS=Cricetulus griseus OX=10029 GN=SLC10A2 PE=2 SV=1)

HSP 1 Score: 126.331 bits (316), Expect = 5.416e-31
Identity = 88/286 (30.77%), Postives = 144/286 (50.35%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTP------IPLYVLYLIIFIKKRYFTKEKLEYE 1383
            MGC ++  +   ++++P    +GF  QF  MPL    L+  +GI     + +L  GC PGG +SN+      GD++LS++MT  S+  AL MMPL LFI ++++VD   I IP+D+I  +L+ +VIPV +G+    K+  KA  I+K   + G   +V I   G  +Y + +  +       L  +G   P  G+ LG+ L+ +  +   +   ++LETG QN  +   I++ S    + +L     +I SIF        +  YV Y     K     +EK + E
Sbjct:   49 MGCNVELHKFLGHLRRPWGIVVGFLCQFGIMPLTGFVLSVAFGILPVQAVVVLIQGCCPGGTASNILAYWVDGDMDLSVSMTTCSTLLALGMMPLCLFIYTKMWVDSGTIVIPYDSIGTSLVALVIPVSIGMYVNHKWPQKAKIILKIGSIAGAILIVLIAVVGGILYQSAWTIE-----PKLWIIGTIYPIAGYGLGFFLARIAGQPWYRCRTVALETGLQNTQLCSTIVQLSFSPEDLNLVFTFPLIYSIFQIAFAAILLGAYVAYKKCHGKNNTELQEKTDNE 329          
BLAST of slc10a-3 vs. TrEMBL
Match: A0A0H3YEZ4 (Slc10a-3 OS=Schmidtea mediterranea OX=79327 GN=slc10a-3 PE=2 SV=1)

HSP 1 Score: 855.514 bits (2209), Expect = 0.000e+0
Identity = 444/444 (100.00%), Postives = 444/444 (100.00%), Query Frame = 1
Query:   73 MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQVELT 1404
            MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVELVFRILITIFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQVELT
Sbjct:    1 MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVELVFRILITIFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQVELT 444          
BLAST of slc10a-3 vs. TrEMBL
Match: A0A0H3YF76 (Slc10a-5 OS=Schmidtea mediterranea OX=79327 GN=slc10a-5 PE=2 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 5.433e-149
Identity = 227/402 (56.47%), Postives = 304/402 (75.62%), Query Frame = 1
Query:  178 HLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYE 1383
             L EGE      +   S  N+TF     F  C  DY KVG+L NW + +  + S +    NF++ + AKRLG + L C L  ++N ++  ++K+ ++IV R+ TV EL+FRI+++IFV+ +TFVMGCG+D+  +  Y+KKPISP IGFCSQFVFMPL+SA L K  GI  AFGLGLLTIGCSPGGG+SN+WT++FGGD++LS+TMTFISSCAAL MMP W+FILSR F+DP  ++IP+ +I  NLL +V+PV +GI F+WK++  A  ++K  K++GL FV+FILT+G YANFYI++LM DY YLLP+GA LPW+GF  G++LS+VTRR K Q+IAISLETGFQN+GIAI+ILK+S+PQP+GDLG+VM +IV++FTP+PLYV  L I+IKK     E+L  E
Sbjct:   38 KLFEGEKVFFSNNFNLSPSNETFLGNATF-KCWMDYEKVGVLINWKNKQIQIGSTSNVSVNFSVLVLAKRLGGSNLICSLNLSNNSRVKMEKKLIEIIVSRKQTVAELIFRIVVSIFVIFLTFVMGCGLDKEIILGYLKKPISPLIGFCSQFVFMPLVSAALGKFTGIHPAFGLGLLTIGCSPGGGASNIWTILFGGDMDLSITMTFISSCAALAMMPFWMFILSRFFIDPNSVQIPYGSIGLNLLQIVLPVGIGIAFQWKWDKAAETLVKKVKIMGLVFVIFILTYGSYANFYIYKLMGDYTYLLPIGALLPWLGFFFGFILSVVTRRKKSQAIAISLETGFQNIGIAILILKFSMPQPDGDLGSVMPIIVALFTPMPLYVGMLFIYIKKCLSKPEQLATE 438          
BLAST of slc10a-3 vs. TrEMBL
Match: A0A0H3YJ17 (Slc10a-2 OS=Schmidtea mediterranea OX=79327 GN=slc10a-2 PE=2 SV=1)

HSP 1 Score: 420.239 bits (1079), Expect = 1.201e-139
Identity = 223/400 (55.75%), Postives = 300/400 (75.00%), Query Frame = 1
Query:  133 NISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSND-NLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLY 1329
            N SS F  + F       E +S  L  +  Y L +   +   F +NC  DY KVG L NWTD++    ++  +       +++KRLGS+ + C +   D N   V++QKI +LIV+R  T+ ELVFRI+++IFV+ +TFVMGCG+DR  +  Y+KKPISP IGF SQF+FMPL+SA L KL GI+ +F LGLL IGCSPGGG+SN+WTV++GGDLNLSMTMTFISSCAAL MMPLWLF L R+F+DP  + IP+D+IA NLL VV+PV +GI  RWK+E K+  ++K  K++G+ F++F+L++G YAN YI++L+ DY++LLP+GA LPW+GF  GYLL+L TRR KKQ+IAI+LETGFQN+GIAI+ILK+S+PQP+GD+GAVM +IV++FTP+PLYV Y
Sbjct:   31 NSSSFFKLKTF-------EMDSVILNETFTYYLNSTFVNVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFRIIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALGMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWKWEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGY 423          
BLAST of slc10a-3 vs. TrEMBL
Match: A0A074ZB96 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14429 PE=4 SV=1)

HSP 1 Score: 296.975 bits (759), Expect = 3.447e-90
Identity = 160/312 (51.28%), Postives = 216/312 (69.23%), Query Frame = 1
Query:  466 LIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFR-WKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQVE 1398
            +IV+R   VV+LVFRI++   V I TF MGC +D   +  Y ++PI PAIGFC QF+ MPL+S  +AKL  I   FG GLLTIGCSPGGG+SN W+++ GGD+NLS+ MTFISS +AL MMPL LF   R F+D   ++IP+ NI   LL + IP L G+  R WK E  A +  K  + + +FF++F LTFGIYAN  IF+L+  Y  ++P GA LPW+GF++  L++ + R+++   I I+LETG QN+G A+++L YS+PQPEGDLGAVM + VSIFTP+PLY + L + IK+R   K     EA +VE
Sbjct:  198 VIVLRGQGVVQLVFRIVVVSMVTIFTFTMGCELDPGLLKAYFRRPIGPAIGFCCQFIIMPLISFTIAKLVPIKQEFGFGLLTIGCSPGGGASNAWSLMLGGDINLSILMTFISSFSALFMMPLLLFAFGRFFIDVNRVRIPYGNICIQLLQIAIPALFGLGLRCWKPEI-AKRFTKITRPMFVFFILFFLTFGIYANLSIFRLIGSYPIVMPTGALLPWIGFAMAALVAFILRQSRPIIITIALETGIQNIGAAVLVLLYSMPQPEGDLGAVMPITVSIFTPVPLYFILLGVTIKRRCCRKRPPPSEAHEVE 508          
BLAST of slc10a-3 vs. TrEMBL
Match: A0A419Q4H5 (Ileal sodium/bile acid cotransporter OS=Clonorchis sinensis OX=79923 GN=Slc10a2 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 5.995e-89
Identity = 158/312 (50.64%), Postives = 214/312 (68.59%), Query Frame = 1
Query:  466 LIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFR-WKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQVE 1398
            +IV+R   VV+LVFRI++   V I TF MGC +D   +  Y ++PI PAIGFC QF+ MPL+S  +AKL  I   FG GLLTIGCSPGGG+SN W+++ GGD+NLS+ MTFISS +AL MMPL LF   R F+D   ++IP+ NI   LL + IP L G+  R WK E  A +  K  + + +FF++F LTFGIYAN  IF+L+  Y  ++P GA LPW+GF+L  L++ +  + +   I I+LETG QN+G A+++L YS+PQPEGDLGAVM + VS+FTP+PLY + L + IK+R   K+    E  +VE
Sbjct:  198 VIVLRGQGVVQLVFRIVVVSMVTIFTFTMGCELDPGLLKAYFRRPIGPAIGFCCQFIIMPLISLAIAKLVPIKQEFGFGLLTIGCSPGGGASNAWSLMLGGDINLSILMTFISSFSALFMMPLLLFAFGRFFIDVNRVRIPYGNICLQLLQIAIPALFGLGLRCWKPEI-AKRFTKITRPMFVFFILFFLTFGIYANLSIFRLIGSYPIVMPTGALLPWIGFALAALVAFILHQPRPIIITIALETGIQNIGAAVLVLLYSMPQPEGDLGAVMPITVSLFTPVPLYFILLGVTIKRRCCRKKAPPSEIHEVE 508          
BLAST of slc10a-3 vs. Ensembl Cavefish
Match: slc10a2 (solute carrier family 10 member 2 [Source:NCBI gene;Acc:103029770])

HSP 1 Score: 126.331 bits (316), Expect = 9.534e-32
Identity = 81/253 (32.02%), Postives = 142/253 (56.13%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFG--IYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIF 1302
            MGC +D  +++ +I++P    IGF  QF  MP ++  L+  + +     + ++ +GC PGG SSN+      GD++LS++MT  SS  AL MMPL L I + ++     I+IP+D+I   L+ ++IPV +G+  + K+   A KI+K   ++G+  ++ I   G  +Y + +    +A  +++  +G   P++GF LG+LL+    +   +   I+LETGFQN  +   I++ S    E ++     +I SIF
Sbjct:   50 MGCTVDAPKLWSHIRRPWGIFIGFLCQFGIMPFVAFALSLAFQVLPVQAVVIMIMGCCPGGSSSNIIAYWLEGDMDLSISMTTCSSILALGMMPLCLLIYTSVWTSADTIQIPYDSIGITLVSLLIPVSVGMFVKHKWPKVAKKILKVGSIVGILLIIIIAVVGGVLYQSSWT---IAPALWI--IGTIYPFIGFGLGFLLARFVGQPWHRCRTIALETGFQNSQLCSTIVQLSFAPEELEVMFAFPLIYSIF 297          
BLAST of slc10a-3 vs. Ensembl Cavefish
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 120.553 bits (301), Expect = 1.494e-29
Identity = 88/277 (31.77%), Postives = 143/277 (51.62%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIK-IPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWA-KVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIF-IKKRYFTKEK 1371
            +GC +D  ++  +I KP   AI   +Q+  MPL +  LAKL  +     + +L  GCSPGG  SN+  +   GD+NLS+ MT  S+  AL MMPL L++  + F  P L   +P+ NI  +L+M ++P  +GI   +K    A  + K    ++GL F    +   I     I  + +    L+   A +P +G+ LGYLLS + R        +++ETG QN  +   IL+ + P PE      +   V +F  +   ++ +I+F   +R+F+K+K
Sbjct:  108 LGCTMDVWKIKDHIWKPKGVAIAVVAQYGIMPLSAFSLAKLLQLGPMETVAVLVCGCSPGGNLSNILALAIKGDMNLSIVMTTCSTVLALGMMPLLLYLYCQSF--PGLENAVPYGNITISLVMTLVPCAVGIFINYKVPKYAKIVTKVGMSIMGLAFTALAILASITLGKTILTVTSP--ALMTTAALMPLIGYVLGYLLSALFRLNPACRRTVAVETGCQNNQLCASILRVAFP-PEVIGPFYLFPFVYVFFQVSEALVLIILFRCHERFFSKKK 379          
BLAST of slc10a-3 vs. Ensembl Cavefish
Match: ENSAMXT00000012978.2 (sodium/bile acid cotransporter-like [Source:NCBI gene;Acc:103037734])

HSP 1 Score: 100.138 bits (248), Expect = 1.038e-22
Identity = 84/284 (29.58%), Postives = 145/284 (51.06%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFI-LTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGA--VMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQ 1392
            +GC ++  ++  ++ +P    I   SQF  MPL +  LAK++ +     + +L  GC PGG  SN++ +   GD+NLS+ MT  S+  AL  MP  LF+  + F       +P+  I   L+M ++P  +GI         +  I+K    I L     I +  GI     ++ +++    L+ V + +P +G+ LGY+LS V ++  +    I++ETG QN+ +   ILK +  +PE D+G   +  +I  IF      +L++IIF   R++ + K   E A+
Sbjct:   55 LGCTMEIAKIKAHVLRPKGVGIALVSQFGIMPLTAFSLAKVFQLGAIEAVTVLICGCCPGGNLSNIFALALQGDMNLSIVMTTCSTVTALGAMPFLLFLYCQGF-SGLENAVPYAGIIIALIMTLVPCAIGIAINHWAPRYSPLIIKVGISILLIASAAIGVMAGITIGGTVWVVLSP--KLMAVASLMPLIGYLLGYILSTVFKQNGQCKRTIAVETGCQNIQLCSTILKVAF-RPE-DIGPLYLFPLIYIIFQG-GEALLFIIIF---RWYQRCKPTTEEAE 329          
BLAST of slc10a-3 vs. Ensembl Cavefish
Match: slc10a3 (solute carrier family 10 member 3 [Source:NCBI gene;Acc:103043696])

HSP 1 Score: 78.5666 bits (192), Expect = 3.147e-15
Identity = 72/274 (26.28%), Postives = 135/274 (49.27%), Query Frame = 1
Query:  553 GCGIDRLEVFK-YIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAK------VIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKR 1353
            GC ++ +EV +  +K+P+   +G   QF+ MPL   G A+L  +  A  LGL+    +PGGG   +++++ GGD+ L++ MT +S+  A   MPL   +   +      +++PF  I   LL + IP+ LG+L + +    A  ++   +      ++G  F+ + +   I A+     ++        VGA+ P +G  LG  L+ +      Q   + +E G QN  +A+ +++ S  + E D  +    IV++ +   + +L L  F  +R
Sbjct:  188 GCKVE-VEVLRGLLKRPVPLLLGVLGQFLVMPLYGYGAARLASLPKALSLGLVITCSAPGGGGGYLYSLLLGGDVTLAICMTLVSTVVATAAMPLSSALYGHLLGVHATLRVPFVKILGTLLFIAIPISLGVLVKLRLPGLARVLLALIRPFSFVLIVGGIFMAYQMGASILADVRPRVVL--------VGAAAPVLGLLLGLGLAWLAGLPAPQRKTVGIEVGVQNSLLALAVMQLSFRRAEADFASQAPFIVALSSTSEMLLLVLGHFAHRR 452          
BLAST of slc10a-3 vs. Ensembl Cavefish
Match: slc10a4 (solute carrier family 10 member 4 [Source:ZFIN;Acc:ZDB-GENE-041014-249])

HSP 1 Score: 67.0106 bits (162), Expect = 4.426e-12
Identity = 50/161 (31.06%), Postives = 82/161 (50.93%), Query Frame = 1
Query:  790 MTFISSCAALVMMPLWLFILSRIFVD-PTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTF---GIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            MT  S+  ALV  PL L+I SR ++  P +  +P   I   +   ++P+ LG+  R+++   A K++K +  + L FV  I+ F   G+     +   +   VY+  V   +P  G++ GY L+++          +SLETG QNV +   ILK + P PE
Sbjct:    1 MTISSTLLALVFTPLCLWIYSRAWISAPAVQLLPLGAITLTVCSTLVPIGLGLAIRYRYPRAADKVLKVS--LWLLFVTLIMLFIMTGVMLGPELLATIPPSVYV--VAVLMPLTGYAAGYGLAMLFDLPPNSCRTVSLETGCQNVQLCTAILKLAFP-PE 156          
BLAST of slc10a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007971.1 (pep scaffold:Pmarinus_7.0:GL476805:176592:179698:-1 gene:ENSPMAG00000007193.1 transcript:ENSPMAT00000007971.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 140.584 bits (353), Expect = 3.591e-38
Identity = 83/238 (34.87%), Postives = 141/238 (59.24%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISP-AIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            +GC +    + +++K+P +   +GF  QF  MPL +  LA+   +  A    +L +GC PGG +SN+ +    GD++LS++MT +S+   L MMPL L+I SR ++D T   IP++ I   L ++VIPV+LG+L R K    A +++K   V+G   +V     GI  ++   Q M+ +++   + A+LP +GF LGY+L+++ R+   +   IS+ETG Q++ +   +L+ S P PE
Sbjct:   49 LGCSVCLDRILQHLKRPWAGLTVGFVCQFGVMPLAAFALARGLRLGSAEASAVLILGCCPGGLASNLISYWLDGDMDLSISMTIVSTILGLGMMPLCLYIYSRSWLDDTTFVIPYNTIGITLALLVIPVILGMLLRHKCPVHACRMLKLGTVVGSLVLVVTAVLGII-SYNSLQNMSMHIWF--IAAALPLIGFLLGYVLAMLFRQPPFRCRTISVETGAQSIHLCSGVLQISFP-PE 282          
BLAST of slc10a-3 vs. Ensembl Sea Lamprey
Match: slc10a1 (solute carrier family 10 member 1 [Source:ZFIN;Acc:ZDB-GENE-041001-190])

HSP 1 Score: 113.235 bits (282), Expect = 3.257e-28
Identity = 82/243 (33.74%), Postives = 132/243 (54.32%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFF--VVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSI-PQPEGDL 1269
            +GC ++   +  +++KP    I   +QF  MPL +  LAK++ ++    + +L  GC PGG  SNV+ +   GD+NLS+ MT  S+  AL MMPL L+  S    D T   IP+  I+  L ++++P   GI    KF  K +++M  A +  L    +VFI+   +Y    I+ + +    L+ +G  +P +GF LG+ L+ +   + K   AIS+ETGFQN+ +   IL+ +  PQ  G L
Sbjct:   56 LGCTMELEHIGAHLRKPRGIFIAVLAQFGIMPLTAFALAKVFRLNPVEAVTVLICGCCPGGNLSNVFALALDGDMNLSILMTTCSNVLALGMMPLLLWAYSHGLSD-TRFVIPYGKISITLALILLPCAAGIFINAKFP-KYSRMMLRAGMALLLVTGIVFIVLMALYMGSIIWLVFSP--TLISIGVLMPLLGFMLGFFLAGLFHLSYKCRRAISMETGFQNLQLCSAILRLTFDPQVIGPL 294          
BLAST of slc10a-3 vs. Ensembl Sea Lamprey
Match: slc10a2 (solute carrier family 10 member 2 [Source:ZFIN;Acc:ZDB-GENE-040426-1328])

HSP 1 Score: 66.6254 bits (161), Expect = 4.123e-13
Identity = 47/160 (29.38%), Postives = 85/160 (53.12%), Query Frame = 1
Query:  784 MTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADY-VYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPE 1260
            ++MT  S+   + MMPL LFI ++ + D   I IP+D+I   L+ +V+PV  G+  ++K+  KA  ++K   V+G   ++ I      A   ++Q   D    +  +G   P +G+ LG+ L+ +  +  ++   I++ETG QN  +   I++ S   PE
Sbjct:    1 ISMTVCSTLLGMGMMPLCLFIYTQTWTDSASIAIPYDSIGITLVSLVVPVAFGMFVQYKWPKKAKILVKIGSVLGGILIIAISV----AGALLYQGAWDTEPAMWIIGCIFPIIGYVLGFGLAKLVNQPWQRCRTIAMETGAQNSQLCTTIVQLSF-TPE 155          
BLAST of slc10a-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011394.1 (pep scaffold:Pmarinus_7.0:GL476582:173651:174025:-1 gene:ENSPMAG00000010367.1 transcript:ENSPMAT00000011394.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 5.575e-11
Identity = 29/77 (37.66%), Postives = 44/77 (57.14%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNL 780
            MGC +   +V  +++ P    IGF  QF FMPL +  LA  + I+    + +L +GC PGG +SN+ T    GD++L
Sbjct:   49 MGCTVQIHKVIAHLRNPWGIIIGFVCQFGFMPLTAFALAIAFKIEPIQAIAVLIMGCCPGGTTSNIITYWLDGDMDL 125          
BLAST of slc10a-3 vs. Ensembl Medaka
Match: slc10a4 (solute carrier family 10 member 4 [Source:NCBI gene;Acc:101175384])

HSP 1 Score: 118.627 bits (296), Expect = 2.245e-29
Identity = 75/242 (30.99%), Postives = 125/242 (51.65%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVD-PTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVI-------GLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIP 1251
            +GC ++  ++ ++I++PI   +    QFV MPL++  LA  + +D    + +L  GC PGG  SN+ +++  G++NLS+ MT  S+  ALV+MPL L+I SR +++ P +  +PF  I   L   +IP+ LG+L R++    A  ++K  +V         LF+ V +L                          +P  G++ GY L+++         A+SLETG QNV +   ILK + P
Sbjct:   58 LGCTVEVSQLREHIRRPIGVLLALLCQFVIMPLVAFLLALAFSLDDVAAMAVLLCGCCPGGNLSNIMSLLVHGEMNLSIIMTISSTLLALVLMPLCLWIYSRAWINTPVVELLPFGAITLTLCSTLIPIGLGVLLRYRHTRVADVVLKVGEVTVCVCVWESLFYAVAVL--------------------------MPLCGYAAGYGLAVLFDLPPSSRRAVSLETGCQNVQLCTAILKMAFP 273          
BLAST of slc10a-3 vs. Ensembl Medaka
Match: slc10a4 (solute carrier family 10 member 4 [Source:NCBI gene;Acc:101175384])

HSP 1 Score: 116.316 bits (290), Expect = 2.002e-28
Identity = 74/235 (31.49%), Postives = 121/235 (51.49%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVD-PTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIP 1251
            +GC ++  ++ ++I++PI   +    QFV MPL++  LA  + +D    + +L  GC PGG  SN+ +++  G++NLS+ MT  S+  ALV+MPL L+I SR +++ P +  +PF  I   L   +IP+ LG+L R++                   V  +L   I A+ Y             V   +P  G++ GY L+++         A+SLETG QNV +   ILK + P
Sbjct:   52 LGCTVEVSQLREHIRRPIGVLLALLCQFVIMPLVAFLLALAFSLDDVAAMAVLLCGCCPGGNLSNIMSLLVHGEMNLSIIMTISSTLLALVLMPLCLWIYSRAWINTPVVELLPFGAITLTLCSTLIPIGLGVLLRYRHTR----------------VADVLLSTIPASVYA------------VAVLMPLCGYAAGYGLAVLFDLPPSSRRAVSLETGCQNVQLCTAILKMAFP 258          
BLAST of slc10a-3 vs. Ensembl Medaka
Match: SLC10A1 (sodium/bile acid cotransporter [Source:NCBI gene;Acc:101171045])

HSP 1 Score: 103.99 bits (258), Expect = 4.420e-24
Identity = 71/199 (35.68%), Postives = 113/199 (56.78%), Query Frame = 1
Query:  667 KLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIK-IPFDNIAYNLLMVVIPVLLGIL---FRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIP 1251
            K+  +D    + +L  GC PGG  SN++++I  GD+NLS+ MT  S+ AAL +MPL L IL + F  P L K +P+  I   +L  ++   +GIL   ++ K+     K   W  +I     +FIL+  +  +     +MAD   LL   A +P +GF+LGY+LS++ + + + S  +S+ETGFQN+ +   ILK + P
Sbjct:   70 KVLQMDPIKAVTVLICGCCPGGTLSNIFSLIVKGDMNLSIVMTTCSTFAALGLMPLLLCILCQGF--PGLQKAVPYVGIVTTILCTLLASTIGILINHYKPKYSLIVKKTGLWILLIS-SITLFILSAYVVKDVLWMIVMAD---LLTAAALMPLIGFTLGYVLSVICKLSPQCSRTVSMETGFQNIQLCTAILKVAFP 262          
BLAST of slc10a-3 vs. Ensembl Medaka
Match: slc10a3 (solute carrier family 10 member 3 [Source:NCBI gene;Acc:101169937])

HSP 1 Score: 83.9593 bits (206), Expect = 6.984e-17
Identity = 71/284 (25.00%), Postives = 141/284 (49.65%), Query Frame = 1
Query:  553 GCGIDRLEVFK-YIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVY-----LLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEA 1386
            GC ++ +EV +  ++ P+   +G   QF+ MP  +  +++L  +  A  LGL+    +PGGG   +++++ GGD+ L+++MT +S+  A   MPL   +  R+      + +PF  I   LL + IP+ LG+L + +            +V+ +    F +   I   F  +Q+ A  +      ++ VG ++P +G ++G +L+ +      Q   +S+E G QN  +A+ +++ S  + E D  +    IV++ +   + ++ L  FI +R      L  +A
Sbjct:  196 GCKVE-VEVLRGLLRSPVPLLLGVVGQFLVMPFYAYCVSRLISLPTALSLGLVITCSAPGGGGGYLYSLLLGGDVTLAISMTLVSTLVATAAMPLSSALYGRLLGVHAALHVPFVKILGTLLFIAIPISLGMLIKLRLPG-------LTRVLLVLIRPFSIVLMIGGIFMAYQMGASILANVSPEIVVVGVTVPLLGLAVGAVLAKLAGLPLPQKKTVSIEVGVQNSLLALAVMQLSFRRVEADFASQAPFIVALSSTSEMLLMVLGNFIHRRLCGSAVLRSDA 471          
BLAST of slc10a-3 vs. Planmine SMEST
Match: SMESG000064829.1 (SMESG000064829.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 309/314 (98.41%), Postives = 313/314 (99.68%), Query Frame = 1
Query:   73 MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLF 1014
            MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVELVFRILITIFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAK++ ++
Sbjct:    1 MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVELVFRILITIFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKIMSIY 314          
BLAST of slc10a-3 vs. Planmine SMEST
Match: SMESG000064830.1 (SMESG000064830.1)

HSP 1 Score: 443.736 bits (1140), Expect = 1.511e-152
Identity = 227/402 (56.47%), Postives = 304/402 (75.62%), Query Frame = 1
Query:  178 HLNEGESQALGGSLIYSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYE 1383
             L EGE      +   S  N+TF     F  C  DY KVG+L NW + +  + S +    NF++ + AKRLG + L C L  ++N ++  ++K+ ++IV R+ TV EL+FRI+++IFV+ +TFVMGCG+D+  +  Y+KKPISP IGFCSQFVFMPL+SA L K  GI  AFGLGLLTIGCSPGGG+SN+WT++FGGD++LS+TMTFISSCAAL MMP W+FILSR F+DP  ++IP+ +I  NLL +V+PV +GI F+WK++  A  ++K  K++GL FV+FILT+G YANFYI++LM DY YLLP+GA LPW+GF  G++LS+VTRR K Q+IAISLETGFQN+GIAI+ILK+S+PQP+GDLG+VM +IV++FTP+PLYV  L I+IKK     E+L  E
Sbjct:   38 KLFEGEKVFFSNNFNLSPSNETFLGNATF-KCWMDYEKVGVLINWKNKQIQIGSTSNVSVNFSVLVLAKRLGGSNLICSLNLSNNSRVKMEKKLIEIIVSRKQTVAELIFRIVVSIFVIFLTFVMGCGLDKEIILGYLKKPISPLIGFCSQFVFMPLVSAALGKFTGIHPAFGLGLLTIGCSPGGGASNIWTILFGGDMDLSITMTFISSCAALAMMPFWMFILSRFFIDPNSVQIPYGSIGLNLLQIVLPVGIGIAFQWKWDKAAETLVKKVKIMGLVFVIFILTYGSYANFYIYKLMGDYTYLLPIGALLPWLGFFFGFILSVVTRRKKSQAIAISLETGFQNIGIAILILKFSMPQPDGDLGSVMPIIVALFTPMPLYVGMLFIYIKKCLSKPEQLATE 438          
BLAST of slc10a-3 vs. Planmine SMEST
Match: SMESG000064833.1 (SMESG000064833.1)

HSP 1 Score: 421.394 bits (1082), Expect = 9.897e-144
Identity = 227/406 (55.91%), Postives = 304/406 (74.88%), Query Frame = 1
Query:  133 NISSLFNFQGFPNETHLNEGESQALGGSLIYSLKNDTFSQ-ETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTINLYAKRLGSAYLECQLKSND-NLKIVYKQKISKLIVIRQDTVVEXXXXXXXXXXXXXXXXXMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYLIIFI 1344
            N SS F  + F       E +S  L  +  Y L N TF+    F +NC  DY KVG L NWTD++    ++  +       +++KRLGS+ + C +   D N   V++QKI +LIV+R  T+ ELVFRI+++IFV+ +TFVMGCG+DR  +  Y+KKPISP IGF SQF+FMPL+SA L KL GI+ +F LGLL IGCSPGGG+SN+WTV++GGDLNLSMTMTFISSCAAL MMPLWLF L R+F+DP  + IP+D+IA NLL VV+PV +GI  RWK+E K+  ++K  K++G+ F++F+L++G YAN YI++L+ DY++LLP+GA LPW+GF  GYLL+L TRR KKQ+IAI+LETGFQN+GIAI+ILK+S+PQP+GD+GAVM +IV++FTP+PLYV Y  + I
Sbjct:   31 NSSSFFKLKTF-------EMDSVILNETFTYYL-NSTFANVSNFKLNCRSDYLKVGYLVNWTDIQLPPVTMENSVMKLNFTVFSKRLGSSNIICTIYLPDSNSTKVFEQKIGQLIVLRHPTIAELVFRIIVSIFVIFLTFVMGCGLDRDIILNYLKKPISPFIGFVSQFLFMPLISAALGKLSGIENSFALGLLVIGCSPGGGASNIWTVLYGGDLNLSMTMTFISSCAALAMMPLWLFALGRLFIDPKNVVIPYDSIAINLLQVVLPVGIGIFVRWKWEEKSKVLVKKVKIMGIIFIIFVLSYGTYANLYIYKLIGDYIFLLPIGAFLPWLGFIFGYLLALATRRNKKQAIAIALETGFQNIGIAILILKFSMPQPDGDMGAVMPLIVAMFTPLPLYVGYAALVI 428          
BLAST of slc10a-3 vs. Planmine SMEST
Match: SMESG000060981.1 (SMESG000060981.1)

HSP 1 Score: 187.193 bits (474), Expect = 1.928e-54
Identity = 104/268 (38.81%), Postives = 176/268 (65.67%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWVGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYL--IIFIK 1347
            +GC  +   ++ + KKP+   I   +Q+V MPLL+ G++KL+ ++  FG GLL + CSP   +SN+WT+++ G+ +L +T+TF+S+  +L M+P W+F L R + D  + +IP  NI   +L VV+PV+LG++FR+K++    K++K  K++ + F+ F+LTFG+Y N Y+F+++ DY +L+P+ A LPW GF  G L+ + ++    QS  IS++ G QN+G AI+I+KYS+     D G ++  I+ I +   L V Y+  +IF+K
Sbjct:   20 VGCSTEIESIWSHSKKPMPLLIVLFAQYVIMPLLAFGISKLFFLNNEFGFGLLAVSCSPSCITSNMWTILYKGEKDLGLTLTFVSTLFSLFMIPFWVFCLGRFYFDFKIAQIPIRNIFLGVLQVVVPVVLGLIFRYKWKRWGLKLLKVFKILSIIFIWFLLTFGLYVNLYVFEVILDYPHLVPIVAVLPWCGFLFGLLIGIGSKHGFVQSKTISIKIGVQNIGFAILIVKYSMQGLYSDFGILIPFIILISSHALLLVGYICKLIFVK 287          
BLAST of slc10a-3 vs. Planmine SMEST
Match: SMESG000046910.1 (SMESG000046910.1)

HSP 1 Score: 90.5077 bits (223), Expect = 5.043e-19
Identity = 74/264 (28.03%), Postives = 127/264 (48.11%), Query Frame = 1
Query:  550 MGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKLYGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALVMMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESKAAKIMKW-AKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPW--VGFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLGAVMSVIVSIFTPIPLYVLYL 1332
            +GC +D      Y K+      G  SQ + +P +   + K+  +  A G GL  + CSPGGG  ++   +  GD +LS  ++ I+         LW++ L+ ++     I+     +A  L ++ I   +G+L  +   S A  IM W  + + L   +  +T G+Y N Y F  +   + L  +   L    VG   GY  S   +++K  + ++S+ET   N  I I  L+YS+ QPE DL +   +    F+P+PL+++YL
Sbjct:  247 VGCSLDLSVAKTYFKQSRCLIFGLTSQHLILPTIGISIYKMLQLKNAVGYGLFALSCSPGGGLGHIIVFLMKGDEDLSALLSTINCFMNAGFTLLWMYALNSLYQ----IEFSTYTMALWLGIIPIIQGIGVLVNFWSYSTAQAIMTWFTRPLLLLAGILFVTLGVYINHYAFNQINQSMLLGVLLLMLSGFLVGSISGYFSS--GKQSKDVTCSLSVETALSNGLILIPALRYSLYQPEADLASSACLWSIFFSPLPLFLIYL 504          
The following BLAST results are available for this feature:
BLAST of slc10a-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC10A23.574e-3231.34solute carrier family 10 member 2 [Source:HGNC Sym... [more]
SLC10A16.059e-2833.61solute carrier family 10 member 1 [Source:HGNC Sym... [more]
SLC10A66.972e-2529.31solute carrier family 10 member 6 [Source:HGNC Sym... [more]
SLC10A39.857e-2429.20solute carrier family 10 member 3 [Source:HGNC Sym... [more]
SLC10A32.539e-2329.20solute carrier family 10 member 3 [Source:HGNC Sym... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y71G10AR.43.973e-6042.21pep chromosome:WBcel235:IV:2199041:2209051:1 gene:... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG116552.114e-4031.30gene:FBgn0030638 transcript:FBtr0074031[more]
CG99033.372e-1725.70gene:FBgn0030756 transcript:FBtr0074297[more]
back to top
BLAST of slc10a-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc10a23.525e-3131.91solute carrier family 10 member 2 [Source:ZFIN;Acc... [more]
slc10a23.928e-3131.91solute carrier family 10 member 2 [Source:ZFIN;Acc... [more]
slc10a43.676e-3033.19solute carrier family 10 member 4 [Source:ZFIN;Acc... [more]
slc10a14.746e-2230.51solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
slc10a14.746e-2230.51solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000008686.12.432e-3633.99solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008944.12.992e-3633.99solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008699.13.757e-3633.99solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008959.14.203e-3633.99solute carrier family 10 (sodium/bile acid cotrans... [more]
ENSXETT00000008675.13.483e-3231.23ileal sodium/bile acid cotransporter-like [Source:... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc10a24.580e-3330.82solute carrier family 10, member 2 [Source:MGI Sym... [more]
Slc10a12.363e-3035.00solute carrier family 10 (sodium/bile acid cotrans... [more]
Slc10a12.363e-3035.00solute carrier family 10 (sodium/bile acid cotrans... [more]
Slc10a12.419e-3035.00solute carrier family 10 (sodium/bile acid cotrans... [more]
Slc10a61.430e-2932.33solute carrier family 10 (sodium/bile acid cotrans... [more]
back to top
BLAST of slc10a-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28727|NTCP2_RABIT4.828e-3333.82Ileal sodium/bile acid cotransporter OS=Oryctolagu... [more]
sp|P70172|NTCP2_MOUSE3.204e-3230.82Ileal sodium/bile acid cotransporter OS=Mus muscul... [more]
sp|Q12908|NTCP2_HUMAN1.716e-3131.34Ileal sodium/bile acid cotransporter OS=Homo sapie... [more]
sp|Q62633|NTCP2_RAT3.718e-3130.82Ileal sodium/bile acid cotransporter OS=Rattus nor... [more]
sp|Q60414|NTCP2_CRIGR5.416e-3130.77Ileal sodium/bile acid cotransporter OS=Cricetulus... [more]
back to top
BLAST of slc10a-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YEZ40.000e+0100.00Slc10a-3 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YF765.433e-14956.47Slc10a-5 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A0H3YJ171.201e-13955.75Slc10a-2 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A074ZB963.447e-9051.28Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A419Q4H55.995e-8950.64Ileal sodium/bile acid cotransporter OS=Clonorchis... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc10a29.534e-3232.02solute carrier family 10 member 2 [Source:NCBI gen... [more]
slc10a11.494e-2931.77solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
ENSAMXT00000012978.21.038e-2229.58sodium/bile acid cotransporter-like [Source:NCBI g... [more]
slc10a33.147e-1526.28solute carrier family 10 member 3 [Source:NCBI gen... [more]
slc10a44.426e-1231.06solute carrier family 10 member 4 [Source:ZFIN;Acc... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000007971.13.591e-3834.87pep scaffold:Pmarinus_7.0:GL476805:176592:179698:-... [more]
slc10a13.257e-2833.74solute carrier family 10 member 1 [Source:ZFIN;Acc... [more]
slc10a24.123e-1329.38solute carrier family 10 member 2 [Source:ZFIN;Acc... [more]
ENSPMAT00000011394.15.575e-1137.66pep scaffold:Pmarinus_7.0:GL476582:173651:174025:-... [more]
back to top
BLAST of slc10a-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc10a-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc10a-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
slc10a42.245e-2930.99solute carrier family 10 member 4 [Source:NCBI gen... [more]
slc10a42.002e-2831.49solute carrier family 10 member 4 [Source:NCBI gen... [more]
SLC10A14.420e-2435.68sodium/bile acid cotransporter [Source:NCBI gene;A... [more]
slc10a36.984e-1725.00solute carrier family 10 member 3 [Source:NCBI gen... [more]
back to top
BLAST of slc10a-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064829.10.000e+098.41SMESG000064829.1[more]
SMESG000064830.11.511e-15256.47SMESG000064830.1[more]
SMESG000064833.19.897e-14455.91SMESG000064833.1[more]
SMESG000060981.11.928e-5438.81SMESG000060981.1[more]
SMESG000046910.15.043e-1928.03SMESG000046910.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30026098
GenBankAKN21470.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026098 ID=SMED30026098|Name=slc10a-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1543bp
CACTTATTAAAGAATATCATATTCAAGTGATATAAAATTTGAGTTATAAA
TTGTTCATTTATTCTATACATTATGCATATTATTATGGACATTTCATTGT
TAATGGTATTATTACAGCCTCTTAGCTCAACCAATATCTCATCTCTTTTC
AATTTTCAAGGATTTCCAAATGAGACACATTTAAATGAGGGAGAATCGCA
AGCTCTCGGAGGCTCTCTGATCTATTCTCTGAAAAATGATACTTTTAGCC
AAGAAACATTTTTCATAAATTGCCTATTCGATTATTCTAAAGTTGGTTTA
CTTAAAAACTGGACAGATTTAGAATTTTCAGTTCATTCTATCAATCTTAC
ACAATTCAATTTCACTATTAACTTATATGCAAAACGATTGGGAAGTGCCT
ATTTGGAATGCCAATTAAAATCGAATGACAACCTGAAAATTGTATATAAA
CAGAAAATATCTAAGCTCATAGTCATTAGACAAGATACGGTTGTTGAATT
GGTGTTTAGGATTCTCATAACAATTTTTGTACTTATTATAACATTTGTCA
TGGGATGCGGCATAGACCGACTGGAAGTTTTCAAATATATAAAAAAACCA
ATTTCGCCAGCTATTGGATTCTGTTCACAATTTGTATTCATGCCTTTGCT
TTCTGCTGGATTAGCTAAACTTTACGGAATTGATGGAGCTTTCGGACTTG
GTTTGTTAACAATTGGCTGTTCTCCAGGAGGAGGCTCGAGTAACGTTTGG
ACAGTTATTTTCGGAGGAGATCTAAATTTAAGCATGACAATGACATTTAT
CAGTTCATGTGCCGCTCTTGTCATGATGCCATTGTGGCTATTTATTCTTA
GTAGAATATTCGTTGATCCAACCTTAATAAAAATTCCATTTGATAATATA
GCTTATAATTTATTAATGGTGGTTATACCAGTGCTTTTAGGTATATTGTT
TCGTTGGAAATTCGAATCAAAAGCAGCAAAAATAATGAAATGGGCAAAAG
TAATTGGTTTATTTTTTGTTGTTTTTATCTTAACTTTTGGAATTTACGCT
AATTTTTACATTTTTCAATTAATGGCAGATTATGTCTATTTATTGCCAGT
CGGAGCCTCTCTTCCTTGGGTTGGATTTTCTCTAGGCTATCTTTTATCAT
TGGTAACTAGACGAACTAAAAAACAATCCATTGCTATTTCATTAGAAACG
GGATTTCAGAATGTAGGAATTGCTATAATAATTCTCAAATACTCAATTCC
CCAACCTGAAGGAGATTTAGGAGCAGTTATGTCAGTGATTGTGTCTATTT
TCACTCCTATACCTTTGTACGTTTTATATTTGATTATTTTTATTAAAAAG
CGTTATTTCACAAAAGAGAAATTGGAATATGAGGCTGCACAAGTAGAGTT
AACGTGATTTTAATAAAAGATTTTGTTATTAAATGATGATATATCAAAAA
TCCTAAGAACAACAAATTTGGATGTAATTTATAAAATTTTTATTAACAGA
TCAATTATGTGCAATTTTATTATCAGTAAATTTTTTTTTATTT
back to top

protein sequence of SMED30026098-orf-1

>SMED30026098-orf-1 ID=SMED30026098-orf-1|Name=SMED30026098-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=445bp
MHIIMDISLLMVLLQPLSSTNISSLFNFQGFPNETHLNEGESQALGGSLI
YSLKNDTFSQETFFINCLFDYSKVGLLKNWTDLEFSVHSINLTQFNFTIN
LYAKRLGSAYLECQLKSNDNLKIVYKQKISKLIVIRQDTVVELVFRILIT
IFVLIITFVMGCGIDRLEVFKYIKKPISPAIGFCSQFVFMPLLSAGLAKL
YGIDGAFGLGLLTIGCSPGGGSSNVWTVIFGGDLNLSMTMTFISSCAALV
MMPLWLFILSRIFVDPTLIKIPFDNIAYNLLMVVIPVLLGILFRWKFESK
AAKIMKWAKVIGLFFVVFILTFGIYANFYIFQLMADYVYLLPVGASLPWV
GFSLGYLLSLVTRRTKKQSIAISLETGFQNVGIAIIILKYSIPQPEGDLG
AVMSVIVSIFTPIPLYVLYLIIFIKKRYFTKEKLEYEAAQVELT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
Vocabulary: INTERPRO
TermDefinition
IPR038770Na+/solute_symporter_sf
IPR004710Bilac:Na_transpt
IPR002657BilAc:Na_symport/Acr3
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR038770Sodium/solute symporter superfamilyGENE3DG3DSA:1.20.1530.20coord: 122..423
e-value: 4.2E-68
score: 231.6
IPR002657Bile acid:sodium symporter/arsenical resistance protein Acr3PFAMPF01758SBFcoord: 150..321
e-value: 1.7E-28
score: 99.7
NoneNo IPR availablePANTHERPTHR10361:SF28RH04535Pcoord: 141..422
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.73
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 142..164
NoneNo IPR availableTMHMMTMhelixcoord: 339..361
NoneNo IPR availableTMHMMTMhelixcoord: 310..329
NoneNo IPR availableTMHMMTMhelixcoord: 275..297
NoneNo IPR availableTMHMMTMhelixcoord: 402..424
NoneNo IPR availableTMHMMTMhelixcoord: 370..392
NoneNo IPR availableTMHMMTMhelixcoord: 208..230
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
IPR004710Bile acid:sodium symporterPANTHERPTHR10361SODIUM-BILE ACID COTRANSPORTERcoord: 141..422