Phosducin like 3

Overview
NamePhosducin like 3
Smed IDSMED30026097
Length (bp)878
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosducin like 3 (SMED30026097) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosducin like 3 (SMED30026097) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosducin like 3 (SMED30026097) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosducin like 3 (SMED30026097) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026097

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30026097h1SMcG0001663 Contig30190newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026097h1SMcG0001663 Contig30190uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30026097h1SMcG0001663 dd_Smed_v4_1472_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30026097h1SMcG0001663 dd_Smed_v4_1472_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30026097h1SMcG0001663 dd_Smed_v4_1472_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026097h1SMcG0001663 dd_Smed_v4_1472_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30026097h1SMcG0001663 dd_Smed_v4_1472_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosducin like 3 vs. Ensembl Human
Match: PDCL3 (phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860])

HSP 1 Score: 137.117 bits (344), Expect = 1.387e-38
Identity = 68/165 (41.21%), Postives = 106/165 (64.24%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP--IAKDVEVNSSGILIGRRKRGESEED 781
            R +RLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C +IN  ++ LA KF  VKF++ +S+TCIPNYP +N+PT  +Y  G++  Q+IG   FGG   + + LEWKL + G + T + +NP    +DV ++S    +  ++  +SE D
Sbjct:   75 RRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGGMNLTRDELEWKLSESGAIMTDLEENPKKPIEDVLLSSVRRSVLMKRDSDSEGD 239          
BLAST of Phosducin like 3 vs. Ensembl Human
Match: PDCL3 (phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860])

HSP 1 Score: 117.472 bits (293), Expect = 4.486e-32
Identity = 53/112 (47.32%), Postives = 78/112 (69.64%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGG 628
            R +RLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C +IN  ++ LA KF  VKF++ +S+TCIPNYP +N+PT  +Y  G++  Q+IG   FGG
Sbjct:   23 RRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTIFVYLEGDIKAQFIGPLVFGG 134          
BLAST of Phosducin like 3 vs. Ensembl Human
Match: PDCL2 (phosducin like 2 [Source:HGNC Symbol;Acc:HGNC:29524])

HSP 1 Score: 115.546 bits (288), Expect = 3.418e-30
Identity = 74/215 (34.42%), Postives = 126/215 (58.60%), Query Frame = 2
Query:   98 TEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGI 742
            TEW+  ++ FGI    E ++D+I EM+    + +  +  E  TL +L + ED  D+E+ + +E  R +RL E KA   K KFG + EI+ + +  +V +A ED++V++ +Y     +C ++N  ++ LA KF   KFV+ + ++CI +Y    +PT  +YKNG++  ++IG  E GG    +E LEWKL + G ++T + +NP    V++  S I
Sbjct:    8 TEWNDILRDFGILPPKEESKDEIEEMVLRLQKEAMVKPFEKMTLAQLKEAEDEFDEEDMQAVETYRKKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEEDVWVIIHLYRSSIPMCLLVNQHLSLLARKFPETKFVKAIVNSCIQHYHDNCLPTIFVYKNGQIEAKFIGIIECGGINLKLEELEWKLAEVGAIQTDLEENPRKDMVDMMVSSI 222          
BLAST of Phosducin like 3 vs. Ensembl Human
Match: PDCL3 (phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860])

HSP 1 Score: 58.151 bits (139), Expect = 1.573e-10
Identity = 28/63 (44.44%), Postives = 43/63 (68.25%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKL 481
            R +RLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C +IN  ++ L
Sbjct:   25 RRRRLAEWKATKLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSGL 87          
BLAST of Phosducin like 3 vs. Ensembl Human
Match: PDCL (phosducin like [Source:HGNC Symbol;Acc:HGNC:8770])

HSP 1 Score: 53.5286 bits (127), Expect = 1.284e-7
Identity = 39/139 (28.06%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSK-DKFGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSST--CIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIV 697
            R QR+ EM+ +L K  +F  V EI+  + +   ++   + I ++V IYE G      +N  +  LA ++ +VKF +  SS       +    +P  +IYK GE++  ++  ++  G+ F    LE  L + G++  K V
Sbjct:  141 RKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEV 279          
BLAST of Phosducin like 3 vs. Ensembl Fly
Match: viaf (gene:FBgn0036237 transcript:FBtr0076062)

HSP 1 Score: 144.436 bits (363), Expect = 1.271e-41
Identity = 83/213 (38.97%), Postives = 133/213 (62.44%), Query Frame = 2
Query:   98 TEWDAAMQKFGI----GREAEITEDKIIEMIEEKVENSRE------QHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP 706
            TEW+  ++  GI     +EAEITED+I +++++ ++   +      Q  +      LD+L++  D E+E +LE+ R +R+AEM+A   K +FG+V EI+  D+  +V  AGE I+VV+ +Y  G  +C +I+  + +LA +F   KFVR +++TCIPN+P KN+PT  IY  G +  Q+IG  E  G+K + E LE+ LGQ G V T+I ++P
Sbjct:    8 TEWNDVLRAKGIIGPKAKEAEITEDQIQKLMDDAIQRRTDLPLNEGQRDKKIDDMSLDELDELEDSEDEAVLEQYRQRRIAEMRATAEKARFGSVREISGQDYVNEVTKAGEGIWVVLHLYANGVPLCALIHHHMQQLAVRFPQTKFVRSVATTCIPNFPEKNLPTIFIYHEGALRKQYIGPLELRGDKLTAEELEFMLGQAGAVPTEITEDP 220          
BLAST of Phosducin like 3 vs. Ensembl Fly
Match: CG7650 (gene:FBgn0036519 transcript:FBtr0075591)

HSP 1 Score: 49.2914 bits (116), Expect = 1.304e-6
Identity = 33/139 (23.74%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  299 QRLAEM-KAKLSKDKFGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTC--IPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKN 703
            QR+AEM +      +FG V ++T  + +   V    +   +++ IYE+    C  +N  +  LA  + S+KF +  SS      ++ +K +P  ++YK   V+  ++  ++   + F    +E  L + GI+  + + N
Sbjct:  138 QRMAEMLRQTGHHQQFGQVQQLTSHEEFLACVEQENKHTTIIIHIYERQLAACATLNKCLDSLASDYPSIKFAKICSSVAGMSRDFRTKGLPALLVYKAQAVIGNFVRLTDDLSDDFFASDVESFLIEHGIIVDRALYN 276          
BLAST of Phosducin like 3 vs. Ensembl Zebrafish
Match: PDCL3 (phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860])

HSP 1 Score: 101.293 bits (251), Expect = 1.781e-26
Identity = 43/115 (37.39%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  446 ICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDND 790
            +C++IN  + +LA KF   KF++ +SSTCIPNYP +N+PT  +Y++GE+  Q+IG   FGG   + + LEW+L + G V+T + +NP  +  +   + I        + EED ++
Sbjct:    3 LCSLINQHLAQLARKFPQSKFLKSISSTCIPNYPDRNLPTLFVYRDGEMKAQFIGPLVFGGMNLTCDELEWRLSESGAVKTDLEENPRKQIQDQLMTSIRCSTHTHRDGEEDSDE 117          
BLAST of Phosducin like 3 vs. Ensembl Zebrafish
Match: PDCL3 (phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860])

HSP 1 Score: 101.679 bits (252), Expect = 2.864e-25
Identity = 43/115 (37.39%), Postives = 71/115 (61.74%), Query Frame = 2
Query:  446 ICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDND 790
            +C++IN  + +LA KF   KF++ +SSTCIPNYP +N+PT  +Y++GE+  Q+IG   FGG   + + LEW+L + G V+T + +NP  +  +   + I        + EED ++
Sbjct:  118 LCSLINQHLAQLARKFPQSKFLKSISSTCIPNYPDRNLPTLFVYRDGEMKAQFIGPLVFGGMNLTCDELEWRLSESGAVKTDLEENPRKQIQDQLMTSIRCSTHTHRDGEEDSDE 232          
BLAST of Phosducin like 3 vs. Ensembl Zebrafish
Match: pdcl (phosducin-like [Source:ZFIN;Acc:ZDB-GENE-030131-2365])

HSP 1 Score: 55.4546 bits (132), Expect = 2.080e-8
Identity = 36/140 (25.71%), Postives = 72/140 (51.43%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDK-FGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKF--VRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVK 700
            R QR+ +M+ +L   + F  V++I+  + +   V++ G+   V+V IYE     C  ++ ++  LA ++  VKF  VRG +      + S  +P  ++Y+ G++V   +  S+  G+ F    +E  L + G++  K  +
Sbjct:  142 RLQRMEQMRRQLCGGRRFEKVMDISSGEEFLRAVDEEGKSTLVLVHIYEPEVPACQAMDGSLLCLALQYPMVKFCRVRGSAVGTSALFRSSALPALLLYRGGDLVGNLVRVSDQLGDDFYATDVEALLQEYGLLPEKYAQ 281          
BLAST of Phosducin like 3 vs. Ensembl Zebrafish
Match: pdca (phosducin a [Source:ZFIN;Acc:ZDB-GENE-031023-1])

HSP 1 Score: 53.1434 bits (126), Expect = 8.416e-8
Identity = 35/139 (25.18%), Postives = 71/139 (51.08%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKF--VRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETK 691
            + R Q + +M  +LS   KF +V ++   + +   + +      VVV IYE G   C+ +N+ +T LA ++ +VKF  +R  ++     +    +PT ++YK GE++  ++  ++    +F    +E  L + G++  K
Sbjct:   83 KYRKQCMQDMHERLSFGPKFDSVFDLESGEAFLDVIENEHRLTLVVVHIYEDGIRGCDALNNCLTCLAAEYSTVKFCRIRASATGAGERFSEDVLPTLLVYKAGEMLGNFLCVTKHMNEEFFATDVENFLNEYGLLPEK 221          
BLAST of Phosducin like 3 vs. Ensembl Xenopus
Match: pdcl3 (phosducin like 3 [Source:NCBI gene;Acc:496850])

HSP 1 Score: 149.443 bits (376), Expect = 1.487e-43
Identity = 72/165 (43.64%), Postives = 111/165 (67.27%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIA--KDVEVNSSGILIGRRKRGESEED 781
            R QR+A+ +A   K+KFG VLEI+  D+  ++  AG+D++V++ +Y+QG  +C++IN  +T LA KFK VKFV+ +S+TCIPNYP KN+PT  +Y +GE+  Q+IG   FGG   + + LEWKL + G V+T + +NP    +D  + S  + I  +K  +SE+D
Sbjct:   59 RQQRMAQWQATQIKNKFGEVLEISGQDYVQEITKAGKDLWVILHLYKQGIPLCSLINKHLTALARKFKDVKFVKSISTTCIPNYPDKNLPTIFVYVDGEIRAQFIGPLVFGGMNLTQDELEWKLAESGAVKTDLEENPKKQIQDHLMTSIRVSIPTKKDSDSEDD 223          
BLAST of Phosducin like 3 vs. Ensembl Xenopus
Match: pdcl3 (phosducin like 3 [Source:NCBI gene;Acc:496850])

HSP 1 Score: 149.828 bits (377), Expect = 1.999e-43
Identity = 72/165 (43.64%), Postives = 111/165 (67.27%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIA--KDVEVNSSGILIGRRKRGESEED 781
            R QR+A+ +A   K+KFG VLEI+  D+  ++  AG+D++V++ +Y+QG  +C++IN  +T LA KFK VKFV+ +S+TCIPNYP KN+PT  +Y +GE+  Q+IG   FGG   + + LEWKL + G V+T + +NP    +D  + S  + I  +K  +SE+D
Sbjct:   73 RQQRMAQWQATQIKNKFGEVLEISGQDYVQEITKAGKDLWVILHLYKQGIPLCSLINKHLTALARKFKDVKFVKSISTTCIPNYPDKNLPTIFVYVDGEIRAQFIGPLVFGGMNLTQDELEWKLAESGAVKTDLEENPKKQIQDHLMTSIRVSIPTKKDSDSEDD 237          
BLAST of Phosducin like 3 vs. Ensembl Xenopus
Match: selenot (selenoprotein T [Source:Xenbase;Acc:XB-GENE-5780991])

HSP 1 Score: 53.9138 bits (128), Expect = 9.595e-8
Identity = 43/145 (29.66%), Postives = 71/145 (48.97%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDK-FGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSST--CIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIV-ETKIVKNPIA 712
            R QR+ EMK +LS+ + F  V +I   + +   V+       V++LIYE   L C   N ++  LA ++  VKF R  SS       + +  +P  ++YK GE++  ++  ++  G  F    LE  L + G++ E  IV   I 
Sbjct:  133 RKQRIEEMKKQLSQPQLFKKVFDIASGEEFLDMVDKEHMKTRVLILIYEDDVLGCEAANGSIICLASEYPGVKFCRVKSSLLGTSAKFTTYALPALLVYKAGELIGNFVRITDQLGVDFFAVDLEAFLHECGLLPEKDIVATSIC 277          
BLAST of Phosducin like 3 vs. Ensembl Xenopus
Match: lrp6 (LDL receptor related protein 6 [Source:Xenbase;Acc:XB-GENE-481820])

HSP 1 Score: 50.8322 bits (120), Expect = 6.661e-7
Identity = 33/136 (24.26%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKF--VRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIV 682
            + R Q + +M  +LS   K+G ++E+   D +   +    +   V+V I+      C  +N+ +T LA ++ +VKF  ++   +     + S+ +PT ++YK GE+++ +I  +E   ++F    +E  L + G++
Sbjct:   96 KYRKQCMHDMHQRLSFGPKYGYLVELKSGDEFLEAIEKESKTTTVIVHIFADDIKGCEALNNCLTCLALEYPTVKFCKIKAADTGAGERFSSEVLPTLLVYKAGELISNFISVTENLNDEFFAVDVESFLNEYGLL 231          
BLAST of Phosducin like 3 vs. Ensembl Xenopus
Match: lrp6 (LDL receptor related protein 6 [Source:Xenbase;Acc:XB-GENE-481820])

HSP 1 Score: 50.8322 bits (120), Expect = 9.123e-7
Identity = 33/136 (24.26%), Postives = 71/136 (52.21%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKF--VRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIV 682
            + R Q + +M  +LS   K+G ++E+   D +   +    +   V+V I+      C  +N+ +T LA ++ +VKF  ++   +     + S+ +PT ++YK GE+++ +I  +E   ++F    +E  L + G++
Sbjct:  134 KYRKQCMHDMHQRLSFGPKYGYLVELKSGDEFLEAIEKESKTTTVIVHIFADDIKGCEALNNCLTCLALEYPTVKFCKIKAADTGAGERFSSEVLPTLLVYKAGELISNFISVTENLNDEFFAVDVESFLNEYGLL 269          
BLAST of Phosducin like 3 vs. Ensembl Mouse
Match: Pdcl3 (phosducin-like 3 [Source:MGI Symbol;Acc:MGI:1916083])

HSP 1 Score: 147.902 bits (372), Expect = 8.643e-43
Identity = 69/165 (41.82%), Postives = 111/165 (67.27%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP--IAKDVEVNSSGILIGRRKRGESEED 781
            R QRLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C++IN  ++ LA KF  VKF++ +S+TCIPNYP +N+PT  +Y+ G++  Q+IG   FGG   +++ LEWKL + G ++T + +NP    +D+ ++S    +  R+  +SE+D
Sbjct:   76 RQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTALEENPKKPIQDLLLSSVRGPVPMRRDSDSEDD 240          
BLAST of Phosducin like 3 vs. Ensembl Mouse
Match: Pdcl2 (phosducin-like 2 [Source:MGI Symbol;Acc:MGI:1890655])

HSP 1 Score: 109.383 bits (272), Expect = 4.160e-28
Identity = 70/203 (34.48%), Postives = 120/203 (59.11%), Query Frame = 2
Query:   98 TEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP 706
            TEW+  ++ FGI    E  +D+I EM+    + +  +  E  TL +L + ED  D+E+ + +E  R +RL E KA   K KFG + EI+ + +  +V +A +D++VV+ +Y     +C ++N  ++ LA KF   KFV+ + ++CI +Y    +PT  +YKNG++  ++IG  E GG    +E LEWKL + G +++ + +NP
Sbjct:    8 TEWNEILRNFGILPPKEEPKDEIEEMVLRLQQEAMVKPYEKMTLAQLKEAEDEFDEEDIKAIEIYREKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVPMCLVVNQHLSVLARKFPETKFVKAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLSEVGAIQSDLEENP 210          
BLAST of Phosducin like 3 vs. Ensembl Mouse
Match: Pdcl2 (phosducin-like 2 [Source:MGI Symbol;Acc:MGI:1890655])

HSP 1 Score: 105.145 bits (261), Expect = 5.794e-27
Identity = 50/138 (36.23%), Postives = 85/138 (61.59%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP 706
            R +RL E KA   K KFG + EI+ + +  +V +A +D++VV+ +Y     +C ++N  ++ LA KF   KFV+ + ++CI +Y    +PT  +YKNG++  ++IG  E GG    +E LEWKL + G +++ + +NP
Sbjct:   25 REKRLQEWKALKKKQKFGELREISGNQYVNEVTNAEKDLWVVIHLYRSSVPMCLVVNQHLSVLARKFPETKFVKAIVNSCIEHYHDNCLPTIFVYKNGQIEGKFIGIIECGGINLKLEELEWKLSEVGAIQSDLEENP 162          
BLAST of Phosducin like 3 vs. Ensembl Mouse
Match: Pdcl3 (phosducin-like 3 [Source:MGI Symbol;Acc:MGI:1916083])

HSP 1 Score: 70.4774 bits (171), Expect = 4.832e-15
Identity = 35/73 (47.95%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFV 511
            R QRLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C++IN  ++ LA KF  VKF+
Sbjct:   25 RQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCSLINHHLSGLARKFPDVKFI 97          
BLAST of Phosducin like 3 vs. Ensembl Mouse
Match: Pdc (phosducin [Source:MGI Symbol;Acc:MGI:98090])

HSP 1 Score: 50.8322 bits (120), Expect = 5.495e-7
Identity = 35/143 (24.48%), Postives = 73/143 (51.05%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEI-TKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKF--VRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKN 703
            + R Q + +M  KLS   ++G V E+ T   +   +    +   +VV IYE G   C+ +N ++  LA ++  VKF  ++  ++     + +  +PT ++YK GE+++ +I  +E    +F    +E  L + G++  + + +
Sbjct:   90 KYRRQCMQDMHQKLSFGPRYGFVYELETGEQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLACLAVEYPMVKFCKIKASNTGAGDRFSTDVLPTLLVYKGGELISNFISVAEQFAEEFFAVDVESFLNEYGLLPEREIHD 232          
BLAST of Phosducin like 3 vs. UniProt/SwissProt
Match: sp|Q4KLJ8|PDCL3_RAT (Phosducin-like protein 3 OS=Rattus norvegicus OX=10116 GN=Pdcl3 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.258e-43
Identity = 71/165 (43.03%), Postives = 112/165 (67.88%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP--IAKDVEVNSSGILIGRRKRGESEED 781
            R QRLAE KA   ++KFG VLEI+  D+  +V  AGE ++VV+ +Y+QG  +C++IN  ++ LA KF  VKF++ +S+TCIPNYP +N+PT  +Y+ G++  Q+IG   FGG   +++ LEWKL + G ++T++ +NP    KDV ++S    +  R+  +SE+D
Sbjct:   76 RQQRLAEWKATQLRNKFGEVLEISGKDYVQEVTKAGEGLWVVLHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTELEENPKKAIKDVLLSSVRDPVPMRRDSDSEDD 240          
BLAST of Phosducin like 3 vs. UniProt/SwissProt
Match: sp|Q8BVF2|PDCL3_MOUSE (Phosducin-like protein 3 OS=Mus musculus OX=10090 GN=Pdcl3 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 6.046e-42
Identity = 69/165 (41.82%), Postives = 111/165 (67.27%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP--IAKDVEVNSSGILIGRRKRGESEED 781
            R QRLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C++IN  ++ LA KF  VKF++ +S+TCIPNYP +N+PT  +Y+ G++  Q+IG   FGG   +++ LEWKL + G ++T + +NP    +D+ ++S    +  R+  +SE+D
Sbjct:   76 RQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCSLINHHLSGLARKFPDVKFIKAISTTCIPNYPDRNLPTVFVYREGDIKAQFIGPLVFGGMNLTIDELEWKLSESGAIKTALEENPKKPIQDLLLSSVRGPVPMRRDSDSEDD 240          
BLAST of Phosducin like 3 vs. UniProt/SwissProt
Match: sp|Q8MR62|VIAF1_DROME (Viral IAP-associated factor homolog OS=Drosophila melanogaster OX=7227 GN=viaf PE=1 SV=1)

HSP 1 Score: 144.436 bits (363), Expect = 1.274e-40
Identity = 83/213 (38.97%), Postives = 133/213 (62.44%), Query Frame = 2
Query:   98 TEWDAAMQKFGI----GREAEITEDKIIEMIEEKVENSRE------QHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP 706
            TEW+  ++  GI     +EAEITED+I +++++ ++   +      Q  +      LD+L++  D E+E +LE+ R +R+AEM+A   K +FG+V EI+  D+  +V  AGE I+VV+ +Y  G  +C +I+  + +LA +F   KFVR +++TCIPN+P KN+PT  IY  G +  Q+IG  E  G+K + E LE+ LGQ G V T+I ++P
Sbjct:    8 TEWNDVLRAKGIIGPKAKEAEITEDQIQKLMDDAIQRRTDLPLNEGQRDKKIDDMSLDELDELEDSEDEAVLEQYRQRRIAEMRATAEKARFGSVREISGQDYVNEVTKAGEGIWVVLHLYANGVPLCALIHHHMQQLAVRFPQTKFVRSVATTCIPNFPEKNLPTIFIYHEGALRKQYIGPLELRGDKLTAEELEFMLGQAGAVPTEITEDP 220          
BLAST of Phosducin like 3 vs. UniProt/SwissProt
Match: sp|Q0VCW8|PDCL3_BOVIN (Phosducin-like protein 3 OS=Bos taurus OX=9913 GN=PDCL3 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.995e-40
Identity = 67/165 (40.61%), Postives = 109/165 (66.06%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP--IAKDVEVNSSGILIGRRKRGESEED 781
            R QRLAE KA   K+KFG VLEI+  D+  +V  AGE ++V++ +Y+QG  +C +IN  ++ LA KF  VKF++ +S+TCIP+YP +N+PT  +Y  G++  Q+IG   FGG   +++ LEWKL + G ++T + +NP    +DV +++    +  ++  +SE+D
Sbjct:   76 RQQRLAEWKATQLKNKFGEVLEISGKDYVQEVTKAGEGLWVILHLYKQGIPLCALINQHLSALARKFPDVKFIKAISTTCIPSYPDRNLPTVFVYLEGDIKAQFIGPLVFGGMNLTLDELEWKLSESGAIKTSLEENPKKPVEDVLLSAVRCSVPAKRDSDSEDD 240          
BLAST of Phosducin like 3 vs. UniProt/SwissProt
Match: sp|Q6P268|PDCL3_DANRE (Phosducin-like protein 3 OS=Danio rerio OX=7955 GN=pdcl3 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 3.585e-39
Identity = 67/166 (40.36%), Postives = 105/166 (63.25%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDND 790
            R +RLAE KA   K+ FG + EI+  D+  +VN AGE I+VV+ +Y+QG  +C++IN  + +LA KF   KF++ +SSTCIPNYP +N+PT  +Y++GE+  Q+IG   FGG   + + LEW+L + G V+T + +NP  +  +   + I        + EED ++
Sbjct:   73 RLKRLAEWKANQMKNVFGELKEISGQDYVQEVNKAGEGIWVVLHLYKQGIPLCSLINQHLAQLARKFPQSKFLKSISSTCIPNYPDRNLPTLFVYRDGEMKAQFIGPLVFGGMNLTCDELEWRLSESGAVKTDLEENPRKQIQDQLMTSIRCSANTHRDGEEDSDE 238          
BLAST of Phosducin like 3 vs. TrEMBL
Match: A0A3Q0K3T0 (phosducin-like protein 3 OS=Ciona intestinalis OX=7719 GN=LOC100187534 PE=4 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 8.353e-48
Identity = 89/228 (39.04%), Postives = 139/228 (60.96%), Query Frame = 2
Query:   98 TEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEED 781
            TEW+ A++K GI  + E+    +++  EE     ++ + +    +  +  ++  +   +      R +RLAE+KA   K KFG+V EI+  D+  +VN AGEDI+VV+ +Y+QG  +C++IN  +T+LA KF  VKF++ +S+TCIPN+P KN+PT  IYKNG++V QWIG   FGG   + + LEWK  Q  IV++ +  NP +K  +V SS I    R    S+E+
Sbjct:    8 TEWNDALRKHGILPKKEV----VVQPPEEDESEPKQNYDDMSLDELAEFEDEEEERIMDL----YRQKRLAELKALQMKSKFGDVREISAQDYVQEVNKAGEDIWVVLHLYKQGIPLCSLINQHITRLAAKFPEVKFLKSISTTCIPNFPDKNLPTLFIYKNGDLVHQWIGALHFGGMNLTQDQLEWKFHQADIVKSNLESNPTSKVFDVMSSSIRSSNRDGDSSDEE 227          
BLAST of Phosducin like 3 vs. TrEMBL
Match: F7B496 (Phosducin domain-containing protein OS=Ciona intestinalis OX=7719 PE=4 SV=2)

HSP 1 Score: 167.548 bits (423), Expect = 2.909e-47
Identity = 79/163 (48.47%), Postives = 111/163 (68.10%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEED 781
            R +RLAE+KA   K KFG+V EI+  D+  +VN AGEDI+VV+ +Y+QG  +C++IN  +T+LA KF  VKF++ +S+TCIPN+P KN+PT  IYKNG++V QWIG   FGG   + + LEWK  Q  IV++ +  NP +K  +V SS I    R    S+E+
Sbjct:   73 RQKRLAELKALQMKSKFGDVREISAQDYVQEVNKAGEDIWVVLHLYKQGIPLCSLINQHITRLAAKFPEVKFLKSISTTCIPNFPDKNLPTLFIYKNGDLVHQWIGALHFGGMNLTQDQLEWKFHQADIVKSNLESNPTSKVFDVMSSSIRSSNRDGDSSDEE 235          
BLAST of Phosducin like 3 vs. TrEMBL
Match: H2YLY7 (Phosducin domain-containing protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.850e-46
Identity = 96/232 (41.38%), Postives = 148/232 (63.79%), Query Frame = 2
Query:   98 TEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDNDW 793
            TEW+ A++K GI  + E   +   E  + +++N+ E+         LD+L +  D+EE+RI+E  R +R+AEMKA   K KFG+V EI+  D+  QVN AGED++VV+ +Y+QG  +C+++N  VT+LA KF  +KF++ +S+TCIPN+P KN+PT  +YKNG+++ QWIG   FGG     + LEWK  + GIV++ +  NP  K  +V SS I   R    ++  DD ++
Sbjct:    8 TEWNDALRKHGILPQKEKAPELPEEEDQTEIKNNYEE-------MSLDELGEFEDEEEDRIMEMYRQKRIAEMKAMQMKAKFGDVREISADDYVQQVNQAGEDVWVVLHLYKQGIPLCSLLNQYVTRLAQKFPYIKFLKSISTTCIPNFPDKNLPTLFVYKNGDLIHQWIGALHFGGMNLKQDQLEWKFHEAGIVKSTLESNPTPKIHDVLSSAI---RSSNKDNSSDDEEY 229          
BLAST of Phosducin like 3 vs. TrEMBL
Match: A0A210QN93 (Phosducin-like protein 3 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT06739 PE=4 SV=1)

HSP 1 Score: 162.54 bits (410), Expect = 3.247e-45
Identity = 102/235 (43.40%), Postives = 150/235 (63.83%), Query Frame = 2
Query:   98 TEWDAAMQKFGI--GREAEITEDKIIEMIEEKVEN-SREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDNDW 793
            TEW+  ++  GI   +E E+TED ++ M+E+ +++ ++ + L D +L ELDD ED +DDEEERI E  R QR+ EMKA  +K KFGNVLEI+K DW  ++N AG+ I+VV+ +Y+ G  +C ++N  + +LA KF  VKFV+ +SS CIPNYP KN+PT  +Y   E+  QW+G   FGG  F  + LEW L Q G+++T +   P     +V S  +    R+     +D+NDW
Sbjct:    8 TEWNDILRAKGIIPEKEQEVTEDDVVSMLEQTIQDKAKGKDLCDMSLQELDDKEDDIDDEEERIFEAYRRQRIEEMKASAAKSKFGNVLEISKEDWVREINKAGDGIWVVLHVYKPGVPLCTLLNQHILELARKFPEVKFVKSVSSVCIPNYPDKNLPTIFVYHENEMKKQWVGPHNFGGMNFKKDELEWMLSQNGVLKTDLEGPPRQGVDDVMSRAV----RESAIDSDDENDW 238          
BLAST of Phosducin like 3 vs. TrEMBL
Match: R7U7U8 (Phosducin domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_202604 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 5.028e-45
Identity = 107/235 (45.53%), Postives = 152/235 (64.68%), Query Frame = 2
Query:   98 TEWDAAMQKFGI---GREAEITEDKIIEMIEEKVEN-SREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDND 790
            TEW+  ++  GI     E EITE+ ++ M+E+ ++  S+ + + D  LDEL+DLED +D+EEERI E  R QR+ E+K   S  KFG++ EI+KSDW T+VN AGE I+VVV IY+QG  +C+++N+ + +LA KF   KF++G++STCIPNYP KN+PT  +Y    +  QWIG   FGG     + LEW LGQ G V T + +NP  +  +V +SGI      R   EED +D
Sbjct:    8 TEWNDVLRSKGILPPKEEKEITEEDLVRMVEQTIDQKSKGKEMGDMDLDELNDLEDDVDEEEERIFEAYRRQRMQELKQAQSLAKFGDIKEISKSDWITEVNKAGEGIWVVVHIYQQGIPMCSLMNNYLAQLARKFPQTKFLKGVASTCIPNYPDKNLPTIFVYFEDNMKKQWIGAPTFGGMNLKQDELEWMLGQIGAVPTTLEENPRKEVKDVMTSGI------RSAVEEDSDD 236          
BLAST of Phosducin like 3 vs. Ensembl Cavefish
Match: PDCL3 (phosducin like 3 [Source:NCBI gene;Acc:103040693])

HSP 1 Score: 135.576 bits (340), Expect = 2.685e-38
Identity = 67/166 (40.36%), Postives = 101/166 (60.84%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDND 790
            R +RLAE KA   K+ FG V EI+  D+  +VN AG  I+VV+ +Y+ G  +C +IN  +++LA KF   KF++ +S+TCIPNYP +N+PT  +Y  GE+  Q+IG   FGG     + LEW+L + G V+T + +NP  +  +   + I      R +S+E D D
Sbjct:   72 RQKRLAEWKANQIKNVFGEVNEISGQDYVQEVNKAGSGIWVVLHLYKPGIPLCTLINQHLSELARKFPQTKFLKSISTTCIPNYPDRNLPTIFVYHEGEMKAQFIGPLVFGGMNLKCDELEWRLSESGAVKTDLEENPKKQIQDQLLTSIRCSMPNRKDSDESDED 237          
BLAST of Phosducin like 3 vs. Ensembl Cavefish
Match: pdcl (phosducin like [Source:NCBI gene;Acc:103045383])

HSP 1 Score: 55.0694 bits (131), Expect = 2.377e-8
Identity = 36/137 (26.28%), Postives = 69/137 (50.36%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDK-FGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPN--YPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETK 691
            R QR+ EM+ +LS  + F  V+ IT  + +   +++ G+   V+V I+E     C  +  ++  LA ++  VKF +   S    +  + S  +P  ++Y+ GE+V   +  S+  G+ F    +E  L + G++  K
Sbjct:  131 RLQRMEEMRRQLSGGRRFEQVINITSGEEFLHAIDEEGKGTLVLVHIFEPDVPACQAMEGSLLCLALQYPQVKFCQARGSVLGTSTLFRSSALPALLLYRGGELVGNLVRVSDQLGDDFYATDVEALLQEYGLLPEK 267          
BLAST of Phosducin like 3 vs. Ensembl Cavefish
Match: pdca (phosducin [Source:NCBI gene;Acc:103031387])

HSP 1 Score: 51.6026 bits (122), Expect = 2.247e-7
Identity = 37/139 (26.62%), Postives = 70/139 (50.36%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEITKSD-WKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPN--YPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETK 691
            + R Q + EM  +LS   +F +VLE+   + +   + +      VVV IY+     C  +N+ +T LA ++ +VKF R  +S    +  +    +PT ++YK GE++  +I  ++    +F    +E  L + G++  K
Sbjct:   85 KYRKQCMQEMHERLSFGPRFDSVLELESGEAFLEAIENEHHLTLVVVHIYDNSIKGCEALNNCLTCLAAEYCTVKFCRIQASVTGADEKFTDDVLPTVLVYKGGEMLGNFICVTKHLSEEFFATDVENFLNEYGLLPEK 223          
BLAST of Phosducin like 3 vs. Ensembl Sea Lamprey
Match: PDCL3 (phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:28860])

HSP 1 Score: 147.132 bits (370), Expect = 2.570e-43
Identity = 66/138 (47.83%), Postives = 95/138 (68.84%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNP 706
            R +RLAE KA+  K+KFG+VLEI+  D+  +V  AG DIFVV+ +Y+QG  +C +IN  +T LA KF   KF++ +S+TCIPNYP KN+PT  +YK+G++  Q+IG   FGG     + LEW+L + G + T + +NP
Sbjct:   73 RQKRLAEWKAQQMKNKFGDVLEISGQDYVHEVTKAGPDIFVVLHLYKQGIPLCALINQHLTALARKFPDTKFLKSISTTCIPNYPDKNLPTIFVYKDGDIRAQFIGPLVFGGMNLKQDELEWRLSESGAITTDLEENP 210          
BLAST of Phosducin like 3 vs. Ensembl Yeast
Match: PLP2 (Protein that interacts with the CCT complex to stimulate actin folding; has similarity to phosducins; null mutant lethality is complemented by mouse phosducin-like protein MgcPhLP; CCT is short for chaperonin containing TCP-1; essential gene [Source:SGD;Acc:S000005807])

HSP 1 Score: 71.633 bits (174), Expect = 5.233e-15
Identity = 44/137 (32.12%), Postives = 63/137 (45.99%), Query Frame = 2
Query:  299 QRLAEMKAKLSKDKFGNVLEITKSDWK--------------TQVNDAGED----IFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLE 655
            +RL E++    + KFG V  I K ++                Q ND GE+    ++V V +  Q  L   I++      A KF+ +KFV   ++  I NYP  N PT I+Y  GEV+   I   E GGN   +E  E
Sbjct:   82 KRLNEIRKLQERSKFGEVFHINKPEYNKEVTLASQGKKYEGAQTNDNGEEDDGGVYVFVHLSLQSKLQSRILSHLFQSAACKFREIKFVEIPANRAIENYPESNCPTLIVYYRGEVIKNMITLLELGGNNSKMEDFE 218          
BLAST of Phosducin like 3 vs. Ensembl Nematostella
Match: EDO36673 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI18])

HSP 1 Score: 149.443 bits (376), Expect = 6.032e-44
Identity = 91/234 (38.89%), Postives = 145/234 (61.97%), Query Frame = 2
Query:   98 TEWDAAMQKFGI----GREAEITEDKIIEMIEEKVENSREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDV--EVNSSGILIGRRKRGESEED 781
            TEW+ A+++ GI     +EAEI+ED+I++M+E+ ++  +    +      LD+LE   D+E+E I++R R QRLAE KA     KFG+V EI+  D+  +VN AGE ++VV+ +Y+ G  +C ++N  + +LA KF S KF++ +S+ CIPNYP KN+PT  IY  G++  Q++G   FGG     + LEW L +   V T + ++P  K+   +V +S  L GR    +S++D
Sbjct:    8 TEWNDALRRHGIIPEKPKEAEISEDQIVDMLEKTIKQ-KCTEGKPIEDMSLDELEAMEDEEDEAIIQRYRHQRLAEFKALQKTAKFGDVREISAQDYVAEVNQAGEGVWVVLHLYKTGVPLCTLVNQYLVQLAQKFPSTKFLKSVSTVCIPNYPDKNLPTLFIYYEGDMKKQFVGPFAFGGMNLKKDVLEWMLAEANAVVTDLEEDPRKKNAIHDVMTSS-LRGRAHDSDSDDD 239          
BLAST of Phosducin like 3 vs. Ensembl Medaka
Match: PDCL3 (phosducin like 3 [Source:NCBI gene;Acc:101174233])

HSP 1 Score: 142.124 bits (357), Expect = 1.654e-40
Identity = 73/166 (43.98%), Postives = 107/166 (64.46%), Query Frame = 2
Query:  293 RAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAK--DVEVNSSGILIGRRKRGESEEDD 784
            R +RLAE KA   K+ FG + EI+  D+  +VN AG+ I+VV+ +Y+QG  +C +IN  +  LA KF   KF++ +S+TCIPNYP +N+PT  +Y  GE+  Q+IG   FGG    VE LEW+L + G V+T++ +NP  +  D  ++S    +  RK G+SEEDD
Sbjct:   88 RQKRLAEWKATQLKNVFGELGEISGQDYVKEVNKAGDGIWVVLHLYKQGIPLCTLINQHLNMLARKFPQTKFLKSISTTCIPNYPDRNLPTIFVYFEGEMKAQFIGPLVFGGMNLKVEELEWRLSESGAVKTELEENPRKQIEDKLMSSIRNSLPTRKDGDSEEDD 253          
BLAST of Phosducin like 3 vs. Ensembl Medaka
Match: ENSORLT00000017423.2 (rod type phosducin [Source:NCBI gene;Acc:100422797])

HSP 1 Score: 53.5286 bits (127), Expect = 4.606e-8
Identity = 38/139 (27.34%), Postives = 71/139 (51.08%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEITKSDWKTQVNDAGEDI-FVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVR--GLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETK 691
            R R Q + EM  +LS   KF  V E+   +   +V +    +  VVV IY+Q    C  +N  +  LA ++ +VKF R   +++     + S+ +PT ++YK+GE++  ++  ++    +F    +E  L + G++  K
Sbjct:   81 RYRKQCMQEMHERLSFGPKFECVHELESGEAFLEVIEKEHRLTLVVVNIYQQDVKGCEQMNSCLDCLATEYPTVKFCRIDAVATGAAERFSSEVLPTLLVYKSGELLGNFLSITKHFNEEFFATDVEAFLNEYGLLPEK 219          
BLAST of Phosducin like 3 vs. Ensembl Medaka
Match: pdc (phosducin [Source:NCBI gene;Acc:100422798])

HSP 1 Score: 50.0618 bits (118), Expect = 7.317e-7
Identity = 41/152 (26.97%), Postives = 72/152 (47.37%), Query Frame = 2
Query:  287 RIRAQRLAEMKAKLS-KDKFGNVLEITKSDWKTQV-NDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVR--GLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVN 730
            + R Q + EM  KLS   +F  V ++   +   +V         VVV IY+ G   C  +N  +  LA ++ +VKF R   +SS     +  + +PT ++YK GE++  ++  ++    +F    +E  L   G++  K +  P  +D E N
Sbjct:  101 KYRRQCMEEMHNKLSFGPRFEGVHDLDSGEAFLEVIEKEHHSTVVVVHIYKIGIKGCEQLNSCLDCLATEYPTVKFCRIDAVSSGAAERFSDEYLPTLLVYKAGELLGNFLSCTQHLSEEFFATDVEAFLNSYGLLPEKEL--PKLEDEEEN 250          
BLAST of Phosducin like 3 vs. Planmine SMEST
Match: SMESG000022403.1 (SMESG000022403.1)

HSP 1 Score: 422.55 bits (1085), Expect = 4.936e-151
Identity = 237/238 (99.58%), Postives = 238/238 (100.00%), Query Frame = 2
Query:   80 MSAAPKTEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHXXXXXXXXXXXXXXXXXXXXXXXXXRIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDNDW 793
            MSAAPKTEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHLEDKTLDELDDLEDSLDDEEERILERIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGE+VTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDNDW
Sbjct:    1 MSAAPKTEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHLEDKTLDELDDLEDSLDDEEERILERIRAQRLAEMKAKLSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPSKNIPTFIIYKNGELVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDNDW 238          
BLAST of Phosducin like 3 vs. Planmine SMEST
Match: SMESG000016822.1 (SMESG000016822.1)

HSP 1 Score: 58.151 bits (139), Expect = 1.445e-9
Identity = 37/136 (27.21%), Postives = 67/136 (49.26%), Query Frame = 2
Query:  293 RAQRLAEMKAK-LSKDKFGNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPN--YPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGIVETK 691
            R +R+ EM+   L+   F +V E+    + + +++  + I V++ +YE     CN +N  +  LA ++  +KF R  +S    +  +    +P FIIY+ GE++   I   ++ G  F    LE  L Q G +  K
Sbjct:  137 REKRMNEMRQMFLNLPTFDSVFELDAQTFVSAIDNEHKQINVIIHLYEPNITACNAVNGGLICLAQQYPYIKFCRMRASDAKMSRKFLDVALPAFIIYRGGELIGNLIQIDKYLGEDFYANELEAFLLQYGFIPDK 272          
BLAST of Phosducin like 3 vs. Planmine SMEST
Match: SMESG000006205.1 (SMESG000006205.1)

HSP 1 Score: 53.9138 bits (128), Expect = 2.398e-8
Identity = 56/189 (29.63%), Postives = 90/189 (47.62%), Query Frame = 2
Query:  287 RIRAQRLAEMKA--KLSKDKF-----GNVLEITKSDWKTQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSSTCIPNYPS----KNIPTFIIYKNGEVVTQWIGKSEFGG-NKFSVEYLEWKLGQQGIVETK--IVKNPIAKDVEVNSS-GILIGRR-------KRGESEEDDN 787
            +IR +R+A+MK   KL KDK+     G   EI  S+ +   ++      VV   Y +    C I++  +  LA K    KF++ L +   P   +    + IPT +I KN + V   +G  + G  ++FS E +EW++ Q  ++E    ++  P  K   V+SS   L  RR       K  +S ED+N
Sbjct:   37 QIRKRRIAQMKENNKL-KDKWIANDHGKYYEI--SEERNFFDECKRSTNVVCHFYRECTFRCKIVDKHLHLLANKHLECKFIK-LDAEKSPFLTTRLNIRVIPTILIIKNEKTVDYIVGFDDLGAVDEFSTEMMEWRIAQADVIEYSGDLLTPPDMKKETVSSSINHLRNRRNKKTLRDKTQDSSEDEN 221          
The following BLAST results are available for this feature:
BLAST of Phosducin like 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDCL31.387e-3841.21phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:2886... [more]
PDCL34.486e-3247.32phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:2886... [more]
PDCL23.418e-3034.42phosducin like 2 [Source:HGNC Symbol;Acc:HGNC:2952... [more]
PDCL31.573e-1044.44phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:2886... [more]
PDCL1.284e-728.06phosducin like [Source:HGNC Symbol;Acc:HGNC:8770][more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosducin like 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
viaf1.271e-4138.97gene:FBgn0036237 transcript:FBtr0076062[more]
CG76501.304e-623.74gene:FBgn0036519 transcript:FBtr0075591[more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PDCL31.781e-2637.39phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:2886... [more]
PDCL32.864e-2537.39phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:2886... [more]
pdcl2.080e-825.71phosducin-like [Source:ZFIN;Acc:ZDB-GENE-030131-23... [more]
pdca8.416e-825.18phosducin a [Source:ZFIN;Acc:ZDB-GENE-031023-1][more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdcl31.487e-4343.64phosducin like 3 [Source:NCBI gene;Acc:496850][more]
pdcl31.999e-4343.64phosducin like 3 [Source:NCBI gene;Acc:496850][more]
selenot9.595e-829.66selenoprotein T [Source:Xenbase;Acc:XB-GENE-578099... [more]
lrp66.661e-724.26LDL receptor related protein 6 [Source:Xenbase;Acc... [more]
lrp69.123e-724.26LDL receptor related protein 6 [Source:Xenbase;Acc... [more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdcl38.643e-4341.82phosducin-like 3 [Source:MGI Symbol;Acc:MGI:191608... [more]
Pdcl24.160e-2834.48phosducin-like 2 [Source:MGI Symbol;Acc:MGI:189065... [more]
Pdcl25.794e-2736.23phosducin-like 2 [Source:MGI Symbol;Acc:MGI:189065... [more]
Pdcl34.832e-1547.95phosducin-like 3 [Source:MGI Symbol;Acc:MGI:191608... [more]
Pdc5.495e-724.48phosducin [Source:MGI Symbol;Acc:MGI:98090][more]
back to top
BLAST of Phosducin like 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q4KLJ8|PDCL3_RAT2.258e-4343.03Phosducin-like protein 3 OS=Rattus norvegicus OX=1... [more]
sp|Q8BVF2|PDCL3_MOUSE6.046e-4241.82Phosducin-like protein 3 OS=Mus musculus OX=10090 ... [more]
sp|Q8MR62|VIAF1_DROME1.274e-4038.97Viral IAP-associated factor homolog OS=Drosophila ... [more]
sp|Q0VCW8|PDCL3_BOVIN2.995e-4040.61Phosducin-like protein 3 OS=Bos taurus OX=9913 GN=... [more]
sp|Q6P268|PDCL3_DANRE3.585e-3940.36Phosducin-like protein 3 OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of Phosducin like 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q0K3T08.353e-4839.04phosducin-like protein 3 OS=Ciona intestinalis OX=... [more]
F7B4962.909e-4748.47Phosducin domain-containing protein OS=Ciona intes... [more]
H2YLY71.850e-4641.38Phosducin domain-containing protein OS=Ciona savig... [more]
A0A210QN933.247e-4543.40Phosducin-like protein 3 OS=Mizuhopecten yessoensi... [more]
R7U7U85.028e-4545.53Phosducin domain-containing protein OS=Capitella t... [more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PDCL32.685e-3840.36phosducin like 3 [Source:NCBI gene;Acc:103040693][more]
pdcl2.377e-826.28phosducin like [Source:NCBI gene;Acc:103045383][more]
pdca2.247e-726.62phosducin [Source:NCBI gene;Acc:103031387][more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PDCL32.570e-4347.83phosducin like 3 [Source:HGNC Symbol;Acc:HGNC:2886... [more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PLP25.233e-1532.12Protein that interacts with the CCT complex to sti... [more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO366736.032e-4438.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosducin like 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
PDCL31.654e-4043.98phosducin like 3 [Source:NCBI gene;Acc:101174233][more]
ENSORLT00000017423.24.606e-827.34rod type phosducin [Source:NCBI gene;Acc:100422797... [more]
pdc7.317e-726.97phosducin [Source:NCBI gene;Acc:100422798][more]
back to top
BLAST of Phosducin like 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000022403.14.936e-15199.58SMESG000022403.1[more]
SMESG000016822.11.445e-927.21SMESG000016822.1[more]
SMESG000006205.12.398e-829.63SMESG000006205.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026097 ID=SMED30026097|Name=Phosducin like 3|organism=Schmidtea mediterranea sexual|type=transcript|length=878bp
GTTTTAAATTGTACACGCGAAAACTATTTCAAATTTTAATTACTTAATTA
TAATTTTAATTTTTAATTGATTATTTATAATGAGTGCTGCACCTAAAACA
GAATGGGACGCTGCTATGCAAAAGTTTGGTATAGGAAGAGAAGCAGAAAT
AACAGAAGATAAAATCATTGAAATGATTGAAGAAAAAGTTGAAAATTCTC
GTGAACAACATCTAGAAGACAAAACTCTTGACGAGCTAGATGATCTGGAA
GATTCATTAGATGACGAAGAAGAAAGAATATTGGAAAGGATAAGAGCTCA
GAGATTAGCTGAAATGAAAGCTAAATTGTCCAAAGATAAATTTGGGAATG
TTCTTGAAATTACTAAATCTGATTGGAAAACTCAAGTTAATGACGCTGGG
GAAGATATATTTGTTGTTGTTTTAATTTACGAGCAAGGAAATCTCATTTG
CAACATCATAAATGATGCAGTGACAAAACTTGCCTACAAATTCAAATCTG
TGAAATTTGTACGTGGTCTCAGTTCTACTTGCATTCCCAATTATCCAAGT
AAGAATATCCCAACATTTATCATTTATAAGAACGGTGAGGTCGTTACTCA
ATGGATTGGAAAATCGGAATTTGGTGGAAATAAATTTTCCGTTGAATATC
TTGAATGGAAACTTGGTCAACAAGGAATAGTAGAAACTAAAATAGTCAAG
AATCCTATTGCTAAAGATGTAGAAGTAAATAGTTCAGGAATTCTAATCGG
ACGAAGGAAGAGAGGTGAAAGTGAAGAAGATGACAACGATTGGTAGAGAT
TAAATTCCCACCTTTATTTTATGCATGTTTCAAGTTTATTAATAAAGATA
TCTGTTTTATTTTTCAAAAAAAAAGATC
back to top

protein sequence of SMED30026097-orf-1

>SMED30026097-orf-1 ID=SMED30026097-orf-1|Name=SMED30026097-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=239bp
MSAAPKTEWDAAMQKFGIGREAEITEDKIIEMIEEKVENSREQHLEDKTL
DELDDLEDSLDDEEERILERIRAQRLAEMKAKLSKDKFGNVLEITKSDWK
TQVNDAGEDIFVVVLIYEQGNLICNIINDAVTKLAYKFKSVKFVRGLSST
CIPNYPSKNIPTFIIYKNGEVVTQWIGKSEFGGNKFSVEYLEWKLGQQGI
VETKIVKNPIAKDVEVNSSGILIGRRKRGESEEDDNDW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0001525angiogenesis
GO:0001938positive regulation of endothelial cell proliferation
GO:0010628positive regulation of gene expression
GO:0030036actin cytoskeleton organization
GO:0045766positive regulation of angiogenesis
GO:0050730regulation of peptidyl-tyrosine phosphorylation
GO:0050821protein stabilization
GO:0061077chaperone-mediated protein folding
GO:1903645negative regulation of chaperone-mediated protein folding
GO:2000059negative regulation of protein ubiquitination involved in ubiquitin-dependent protein catabolic process
Vocabulary: cellular component
TermDefinition
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005783endoplasmic reticulum
GO:0005829cytosol
GO:0032991macromolecular complex
GO:0097356perinucleolar compartment
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0043184vascular endothelial growth factor receptor 2 binding
GO:0044183protein binding involved in protein folding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR012336Thioredoxin-like_fold
IPR024253Phosducin_thioredoxin-like_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 46..73
NoneNo IPR availablePANTHERPTHR45809FAMILY NOT NAMEDcoord: 6..225
IPR024253Phosducin, thioredoxin-like domainPFAMPF02114Phosducincoord: 35..205
e-value: 3.9E-18
score: 65.4
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 81..212
e-value: 1.0E-32
score: 114.9
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 7..203