NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13

Overview
NameNADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Smed IDSMED30026073
Length (bp)597
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (SMED30026073) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (SMED30026073) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (SMED30026073) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 (SMED30026073) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026073

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30026073SMESG000081249.1 dd_Smed_v4_1256_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026073SMESG000081249.1 Contig51013newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30026073SMESG000081249.1 Contig51013uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Human
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:HGNC Symbol;Acc:HGNC:17194])

HSP 1 Score: 66.6254 bits (161), Expect = 1.217e-13
Identity = 37/117 (31.62%), Postives = 59/117 (50.43%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPR 407
            +   KQ+MPPPGGY P  +     +R + G+ +L    G            +   +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+VG+     VF+  R
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGE----SVFHTTR 115          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Human
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:HGNC Symbol;Acc:HGNC:17194])

HSP 1 Score: 65.4698 bits (158), Expect = 3.612e-13
Identity = 34/105 (32.38%), Postives = 54/105 (51.43%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVG 371
            +   KQ+MPPPGGY P  +     +R + G+ +L    G            +   +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+VG
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVG 107          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Human
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:HGNC Symbol;Acc:HGNC:17194])

HSP 1 Score: 62.7734 bits (151), Expect = 2.290e-12
Identity = 34/109 (31.19%), Postives = 55/109 (50.46%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNH------SERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWE 365
            +   KQ+MPPPGGY P  +     +R + G+ +L    G       L + H      +   +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGT------LIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWK 105          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Human
Match: AC011448.1 (novel protein)

HSP 1 Score: 64.6994 bits (156), Expect = 4.519e-12
Identity = 39/132 (29.55%), Postives = 61/132 (46.21%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNH-------SERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASA 431
            +   KQ+MPPPGGY P  +     +R + G+ +L    G       L + H        ER +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W   K F  P  +  +   +    
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGT------LIYGHWSIMKWNRER-RRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDW---KAFPLPALSRKQRTVLVVCG 124          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Celegans
Match: C34B2.8 (pep chromosome:WBcel235:I:10685825:10687058:-1 gene:WBGene00016393.1 transcript:C34B2.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C34B2.8)

HSP 1 Score: 77.7962 bits (190), Expect = 4.489e-18
Identity = 42/132 (31.82%), Postives = 71/132 (53.79%), Query Frame = 3
Query:   63 SYKQEMPPPGGYDPFHWWHRTAKRPIRGW---IILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAH 449
             ++Q+MPP GGY  F++ HRT  + +  W    ++ A++G +A  V       ++     +E+ ++  A+ PFL AE  R +LK + K R  E+ IM DVPGW+ G W+  PV+    + +   +A +   H
Sbjct:    6 EFRQDMPPKGGYRAFNF-HRTFPKLV--WSPGTVVAAIFGATAYGVYAALEGKKKDITEKFEDVDINNAMEPFLTAERDRYWLKLLAKNRALEEEIMKDVPGWKTGTWYGEPVYFTLGDKWWDPTATEVFVH 134          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Fly
Match: ND-B16.6 (gene:FBgn0029868 transcript:FBtr0070924)

HSP 1 Score: 87.0409 bits (214), Expect = 1.034e-21
Identity = 41/128 (32.03%), Postives = 70/128 (54.69%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNN-PRNLYITASANDYLAH 449
            KQ++PPPGGY    +     K    G+  +G    V+A+ + +Y+  ++++K+   E    +  I P L+AE  R +L+ + + R+ E  +M +VPGWEVG W+  PVF   P +  +T    ++ AH
Sbjct:   11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKVKRDEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAH 138          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Fly
Match: ND-B16.6 (gene:FBgn0029868 transcript:FBtr0340026)

HSP 1 Score: 87.0409 bits (214), Expect = 1.034e-21
Identity = 41/128 (32.03%), Postives = 70/128 (54.69%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNN-PRNLYITASANDYLAH 449
            KQ++PPPGGY    +     K    G+  +G    V+A+ + +Y+  ++++K+   E    +  I P L+AE  R +L+ + + R+ E  +M +VPGWEVG W+  PVF   P +  +T    ++ AH
Sbjct:   11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKVKRDEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAH 138          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Fly
Match: ND-B16.6 (gene:FBgn0029868 transcript:FBtr0347282)

HSP 1 Score: 87.0409 bits (214), Expect = 1.034e-21
Identity = 41/128 (32.03%), Postives = 70/128 (54.69%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNN-PRNLYITASANDYLAH 449
            KQ++PPPGGY    +     K    G+  +G    V+A+ + +Y+  ++++K+   E    +  I P L+AE  R +L+ + + R+ E  +M +VPGWEVG W+  PVF   P +  +T    ++ AH
Sbjct:   11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKVKRDEIEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTPIFKEFYAH 138          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Xenopus
Match: ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:Xenbase;Acc:XB-GENE-961231])

HSP 1 Score: 71.2478 bits (173), Expect = 1.829e-15
Identity = 39/143 (27.27%), Postives = 71/143 (49.65%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHWF 497
            KQ++PPPGGY P  +     +R + G+ +     GV        F  +   +++  E+ E R+A+ P   AE+ R  L+ + +  E E ++M DVPGW+VG+      F+  R  ++T + N+     P +   + ++   W+
Sbjct:    7 KQDLPPPGGYGPVDYKRNLPRRGLSGYSMFALGAGVMLFGYWSIFRWNRERRRLQIEDLETRVALLPLFQAEADRRILRLMQQNLEEEAILMKDVPGWKVGE----STFHTDR--WVTPTLNELYNLRPKEELIKKKFGCQWY 143          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Mouse
Match: Ndufa13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:MGI Symbol;Acc:MGI:1914434])

HSP 1 Score: 64.6994 bits (156), Expect = 4.579e-13
Identity = 32/106 (30.19%), Postives = 53/106 (50.00%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGK 374
            +   KQ+MPPPGGY P  +     +R + G+ +     G            ++  +++  E+ E R+A+ P   AE  R  L+ + +  E E +IM DVP W+VG+
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGALIFGYWRMMRWNQERRRLLIEDLEARIALMPLFQAEKDRRTLQILRENLEEEAIIMKDVPNWKVGE 108          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. UniProt/SwissProt
Match: sp|Q0MQ88|NDUAD_PONPY (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Pongo pygmaeus OX=9600 GN=NDUFA13 PE=2 SV=3)

HSP 1 Score: 67.0106 bits (162), Expect = 4.408e-13
Identity = 40/123 (32.52%), Postives = 62/123 (50.41%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLK------KIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPR 407
            +   KQ+MPPPGGY P  +     +R + G+ +L    G       L + H   +K      ++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+VG+     VF+  R
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLALGIGT------LIYGHWSMMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGE----SVFHTTR 115          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. UniProt/SwissProt
Match: sp|Q9P0J0|NDUAD_HUMAN (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Homo sapiens OX=9606 GN=NDUFA13 PE=1 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 5.846e-13
Identity = 37/117 (31.62%), Postives = 59/117 (50.43%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPR 407
            +   KQ+MPPPGGY P  +     +R + G+ +L    G            +   +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+VG+     VF+  R
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGE----SVFHTTR 115          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. UniProt/SwissProt
Match: sp|Q0MQ89|NDUAD_GORGO (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Gorilla gorilla gorilla OX=9595 GN=NDUFA13 PE=2 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 6.224e-13
Identity = 37/117 (31.62%), Postives = 59/117 (50.43%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPR 407
            +   KQ+MPPPGGY P  +     +R + G+ +L    G            +   +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+VG+     VF+  R
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGE----SVFHTTR 115          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. UniProt/SwissProt
Match: sp|Q0MQ90|NDUAD_PANTR (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Pan troglodytes OX=9598 GN=NDUFA13 PE=2 SV=3)

HSP 1 Score: 66.6254 bits (161), Expect = 6.290e-13
Identity = 37/117 (31.62%), Postives = 59/117 (50.43%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPR 407
            +   KQ+MPPPGGY P  +     +R + G+ +L    G            +   +++  E+ E R+A+ P L AE+ R  L+ + +  E E +IM DVP W+VG+     VF+  R
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGE----SVFHTTR 115          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. UniProt/SwissProt
Match: sp|Q4R6H1|NDUAD_MACFA (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Macaca fascicularis OX=9541 GN=NDUFA13 PE=2 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 1.795e-12
Identity = 33/102 (32.35%), Postives = 53/102 (51.96%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGK 374
            KQ+MPPPGGY P  +     +R + G+ +L    G            +   +++  E+ E R+A+ P   AE+ R  L+ + +  E E +IM DVP W+VG+
Sbjct:   26 KQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLVYGHWSIMKWNRERRRLQIEDFEARIALMPLFQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGE 127          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. TrEMBL
Match: A0A0R3UL17 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS8345 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 2.699e-36
Identity = 63/129 (48.84%), Postives = 87/129 (67.44%), Query Frame = 3
Query:   63 SYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAH 449
            +YKQEMPPPGG+  F+ +++  ++P+ G  I+ ALY  + + + L     ER +  H EN E+RLA+SPFLIAE QR +LKH+ K RE E  +M DVPGWEVG W  TPV++NPR L+   +  +Y AH
Sbjct:    3 TYKQEMPPPGGFAAFNVFNKAVRKPLNGLYIIAALYACTFVGLKLRDWGKERRQARHNENREVRLALSPFLIAEQQRMFLKHLIKNREYESELMKDVPGWEVGHWHDTPVYHNPRGLWCEPNIYEYYAH 131          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. TrEMBL
Match: A0A564Y1K8 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS1561 PE=4 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 8.911e-36
Identity = 64/144 (44.44%), Postives = 91/144 (63.19%), Query Frame = 3
Query:   63 SYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHW 494
             YKQEMPPPGG+ P  ++++  ++ + G  I+  LY  S + + L     E+ + I  EN E+RLA++PFL+AE QR YLK + K RE E  +M DVPGWEVG WF TPV+ NPR L+   +  ++ AHL  + Q E Q  +H+
Sbjct:    3 KYKQEMPPPGGFAPLDFFYKGTRKHLNGLYIIAGLYACSYVGIKLRHWQREKNEAIANENKEVRLALTPFLLAEQQRMYLKQLVKNREYETELMKDVPGWEVGHWFDTPVYYNPRGLWCEPNLYEFYAHL-TRRQAERQLTVHF 145          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. TrEMBL
Match: A0A0R3SXD5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS10400 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 9.485e-35
Identity = 64/143 (44.76%), Postives = 91/143 (63.64%), Query Frame = 3
Query:   66 YKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHW 494
            YKQEMPPPGG+ P  ++++  ++ + G  I+  LY  S + + L     E+ + I  EN E+RLA++PFL+AE QR YLK + K RE E  +M DVPGWEVG WF TPV+ NPR L+   +  ++ AHL  + Q E Q  +H+
Sbjct:  528 YKQEMPPPGGFAPLDFFYKGTRKHLNGLYIIAGLYACSYVGIKLRHWQREKNEAIANENKEVRLALTPFLLAEQQRMYLKQLVKNREYETELMKDVPGWEVGHWFDTPVYYNPRGLWCEPNLYEFYAHL-TRRQAERQLTVHF 669          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. TrEMBL
Match: A0A0R3VY38 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS2333 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 1.246e-34
Identity = 61/130 (46.92%), Postives = 88/130 (67.69%), Query Frame = 3
Query:   63 SYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHL 452
            +YKQEMPPPGG+  F+ +++  ++ + G  ++GALY  S + + L     ER +    EN E+RLA++PFLIAE QR YLK + K R+ E  +M DVPGWEVG W +TPV++NPR+L+   +  +Y AHL
Sbjct:    3 AYKQEMPPPGGFAAFNVFNKGVRKHLNGLYLIGALYACSFVGIKLRLWGKERKEARDNENREVRLALTPFLIAEQQRMYLKQLVKNRDYETELMKDVPGWEVGHWHNTPVYHNPRDLWCEPNYYEYYAHL 132          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. TrEMBL
Match: A0A0X3Q322 (NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 OS=Schistocephalus solidus OX=70667 GN=NDUAD PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 4.680e-34
Identity = 58/139 (41.73%), Postives = 95/139 (68.35%), Query Frame = 3
Query:   63 SYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLY-FNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEH 476
            ++KQEMPPPGGY  F+ +++T ++P+ G  ++ ALY  + + + L  + ++ R  +++ EN E+R+A++PFL+AE QR YLKH+ + ++ EK +M DVPGWEVG W   PV++NPR+L+   S  +Y AH     + +H
Sbjct:    3 TFKQEMPPPGGYALFNVFNKTVRKPLNGLYLIAALYACTFVGIKLRDWGYARREARLN-ENREVRIALTPFLLAEQQRMYLKHLVRNQDYEKELMKDVPGWEVGHWHDCPVYHNPRDLWCEPSMQEYYAHQSKNIREKH 140          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Cavefish
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:NCBI gene;Acc:103047340])

HSP 1 Score: 76.6406 bits (187), Expect = 1.128e-17
Identity = 40/106 (37.74%), Postives = 56/106 (52.83%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGK 374
            +   KQ+MPPPGGY P  +     +R + G+ + G   GV        F  +   +++  E  E R+AI P L AE  R  LK + +  E E VIM DVPGW+VG+
Sbjct:    3 ASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYAMFGIGIGVMLFGYWRMFKWNRERRRLLIEELESRIAILPLLQAERDRQMLKMLRENLEEEAVIMKDVPGWKVGE 108          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Sea Lamprey
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:HGNC Symbol;Acc:HGNC:17194])

HSP 1 Score: 71.633 bits (174), Expect = 1.960e-16
Identity = 40/113 (35.40%), Postives = 58/113 (51.33%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPR 407
            KQ+MPPPGGY P  +     KR + G+ +     G+        F  +   +++  E  E R+AI P L AE  R  L+ + +  E E  IM DVPGW+VG+     V+N+ R
Sbjct:   12 KQDMPPPGGYGPVDYKRNLPKRGLSGYSMFAIGIGLMLYGQYRIFKWNRERRRLQIEELESRIAILPLLQAEQDRHVLQQVRENLEEEAKIMKDVPGWKVGE----SVYNSNR 120          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Nematostella
Match: EDO40111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S864])

HSP 1 Score: 68.9366 bits (167), Expect = 1.759e-15
Identity = 34/104 (32.69%), Postives = 53/104 (50.96%), Query Frame = 3
Query:   63 SYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGK 374
            + KQE+PP GGY P  +     KR + GW+ +     V      +    + +  ++  E  + R+A+ P L AES R  L+ + +  E E +IM DV GW VG+
Sbjct:    3 TIKQELPPKGGYAPLGFTKNLPKRGVSGWLTILGGAAVMTGGFAMVIRGNRQRCELRKEQLQARIALLPLLQAESDRRVLRGLKENEELEALIMKDVKGWNVGE 106          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Medaka
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:NCBI gene;Acc:101165258])

HSP 1 Score: 75.8702 bits (185), Expect = 2.092e-17
Identity = 44/139 (31.65%), Postives = 70/139 (50.36%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYY 485
            KQ+MPPPGGY  F +     KR + G+ + G   G+        F+ +   +++  E  E R+A+ P L AE  R  L+ + +  E E ++M DVPGW+VG+     VF+  R    T    + L HL  + +  H+ +
Sbjct:    7 KQDMPPPGGYAAFDYKRNLPKRGLSGYSMFGIGIGIMVFGYWRLFSWNRERRRLQIEELEARIALLPLLQAEQDRRTLRMLRENLEEEAIVMKDVPGWKVGE----SVFHTDR---WTTPLTEELFHLRPREELLHKRF 138          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Medaka
Match: NDUFA13 (NADH:ubiquinone oxidoreductase subunit A13 [Source:NCBI gene;Acc:101165258])

HSP 1 Score: 68.9366 bits (167), Expect = 8.509e-15
Identity = 45/140 (32.14%), Postives = 70/140 (50.00%), Query Frame = 3
Query:   69 KQEMPPPGGYDPFHWWHRTAKRPIRGWIILGAL-YGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYY 485
            KQ+MPPPGGY  F +     KR + G  ++  L  GV  +   + F      +++  E  E R+A+ P L AE  R  L+ + +  E E ++M DVPGW+VG+     VF+  R    T    + L HL  + +  H+ +
Sbjct:    7 KQDMPPPGGYAAFDYKRNLPKRGLSGTYVMHFLGRGVVKVTAAIVF-----YRRLQIEELEARIALLPLLQAEQDRRTLRMLRENLEEEAIVMKDVPGWKVGE----SVFHTDR---WTTPLTEELFHLRPREELLHKRF 134          
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Planmine SMEST
Match: SMESG000081249.1 (SMESG000081249.1)

HSP 1 Score: 306.605 bits (784), Expect = 3.395e-108
Identity = 147/147 (100.00%), Postives = 147/147 (100.00%), Query Frame = 3
Query:   57 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHWF 497
            SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHWF
Sbjct:    2 SKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYFNHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDVPGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHWF 148          
The following BLAST results are available for this feature:
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
NDUFA131.217e-1331.62NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
NDUFA133.612e-1332.38NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
NDUFA132.290e-1231.19NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
AC011448.14.519e-1229.55novel protein[more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
C34B2.84.489e-1831.82pep chromosome:WBcel235:I:10685825:10687058:-1 gen... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ND-B16.61.034e-2132.03gene:FBgn0029868 transcript:FBtr0070924[more]
ND-B16.61.034e-2132.03gene:FBgn0029868 transcript:FBtr0340026[more]
ND-B16.61.034e-2132.03gene:FBgn0029868 transcript:FBtr0347282[more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs11.829e-1527.27NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ndufa134.579e-1330.19NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q0MQ88|NDUAD_PONPY4.408e-1332.52NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
sp|Q9P0J0|NDUAD_HUMAN5.846e-1331.62NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
sp|Q0MQ89|NDUAD_GORGO6.224e-1331.62NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
sp|Q0MQ90|NDUAD_PANTR6.290e-1331.62NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
sp|Q4R6H1|NDUAD_MACFA1.795e-1232.35NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UL172.699e-3648.84Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A564Y1K88.911e-3644.44Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3SXD59.485e-3544.76Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A0R3VY381.246e-3446.92Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A0X3Q3224.680e-3441.73NADH dehydrogenase [ubiquinone] 1 alpha subcomplex... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NDUFA131.128e-1737.74NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NDUFA131.960e-1635.40NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO401111.759e-1532.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NDUFA132.092e-1731.65NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
NDUFA138.509e-1532.14NADH:ubiquinone oxidoreductase subunit A13 [Source... [more]
back to top
BLAST of NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000081249.13.395e-108100.00SMESG000081249.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026073 ID=SMED30026073|Name=NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13|organism=Schmidtea mediterranea sexual|type=transcript|length=597bp
TCTTTTTAAATAATCAAAAATTTTGAAACTTGATGTAAATAAATAATAAT
TTAATGTCTAAATCATATAAGCAAGAAATGCCTCCGCCAGGAGGATATGA
CCCATTTCACTGGTGGCATAGAACTGCTAAAAGGCCAATACGAGGTTGGA
TCATTCTTGGTGCTCTTTATGGCGTATCTGCGCTGGCAGTACCGCTTTAC
TTTAATCATTCAGAAAGATTAAAGAAAATACATTATGAAAATAATGAATT
GAGACTAGCGATTTCACCCTTTTTAATAGCCGAAAGTCAAAGAGCATATT
TGAAGCATATTAACAAAGCACGAGAAGCTGAAAAAGTAATAATGAGTGAT
GTACCTGGCTGGGAAGTTGGAAAATGGTTTAGTACTCCAGTTTTCAACAA
TCCTCGTAATTTATATATAACGGCGAGTGCTAACGATTACTTAGCTCATT
TACCAATTAAAACTCAACATGAACATCAATATTATATGCATTGGTTTTAA
TAGTTTTAGTCATATTGATAGATTTGCGATGGTAGAATAAAATATAGACT
GATTTGTTAAATAATTATTTGATAAGTCTTATTAAAGTATAATGAAC
back to top

protein sequence of SMED30026073-orf-1

>SMED30026073-orf-1 ID=SMED30026073-orf-1|Name=SMED30026073-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=149bp
MSKSYKQEMPPPGGYDPFHWWHRTAKRPIRGWIILGALYGVSALAVPLYF
NHSERLKKIHYENNELRLAISPFLIAESQRAYLKHINKAREAEKVIMSDV
PGWEVGKWFSTPVFNNPRNLYITASANDYLAHLPIKTQHEHQYYMHWF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR009346GRIM-19
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009346GRIM-19PFAMPF06212GRIM-19coord: 5..132
e-value: 2.4E-38
score: 131.1
IPR009346GRIM-19PANTHERPTHR12966NADH DEHYDROGENASE UBIQUINONE 1 ALPHA SUBCOMPLEX SUBUNIT 13coord: 2..144
NoneNo IPR availableTMHMMTMhelixcoord: 28..50