SMED30026051

Overview
NameSMED30026051
Smed IDSMED30026051
Length (bp)1686
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026051

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30026051SMESG000012235.1 PL06011B2C12_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026051 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000672:105683..109836 -8419
Homology
BLAST of SMED30026051 vs. TrEMBL
Match: A7M6E0 (Uncharacterized protein OS=Dugesia ryukyuensis OX=79738 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.014e-7
Identity = 31/95 (32.63%), Postives = 61/95 (64.21%), Query Frame = 3
Query: 1308 KCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERMII 1592
            + F++  +D+++KS+ + SDRR++AV +++ C+I + GP    ++   ++  +    +  Y   +   TKE ++K LKC+Q+TFP++CLNE+  I
Sbjct:  483 RIFELNPYDDLIKSYQSHSDRRIKAVGNKMKCKIVIEGPI---RIYDSTNACWNMRNKIAYRCSLNGPTKEAVEKCLKCLQDTFPQSCLNEKHNI 574          
BLAST of SMED30026051 vs. TrEMBL
Match: A0A068WQZ7 (Uro adherence factor A OS=Echinococcus granulosus OX=6210 GN=EgrG_000228200 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.368e-7
Identity = 33/105 (31.43%), Postives = 60/105 (57.14%), Query Frame = 3
Query: 1302 YRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERMIIQNNLENYG 1616
            Y +  ++   DE+V S     DRR++AV  +  C + L GP  R  +D       +  E+ +Y L+I  ++KE+ D+ +  +++TFP+A L ++M I++N+ N G
Sbjct: 1000 YEQIIEIAPHDELVHSHQNVHDRRIKAVGMKTGCYLNLKGPIKRPPIDGD-----MRREREVYELIIGAQSKEKADRCINYLRDTFPRAVLTKKM-IRSNIFNKG 1098          
BLAST of SMED30026051 vs. TrEMBL
Match: A0A0R3W5U4 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5515 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.248e-6
Identity = 30/95 (31.58%), Postives = 53/95 (55.79%), Query Frame = 3
Query: 1302 YRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERM 1586
            Y +  ++   DE+V S+    DRR++AV  +  C + + GP  RS VD       +  E+ +Y L I   +KE+ D+ +  +++TFP+A L ++M
Sbjct: 1003 YEQIIEIAPHDELVHSYQNVHDRRIKAVGMKTGCFLDIKGPIKRSPVDGN-----MRREREVYELTIGASSKEKADRCINYLRDTFPRAVLTKKM 1092          
BLAST of SMED30026051 vs. TrEMBL
Match: A0A087W1K4 (Uro adherence factor A OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000228200 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.594e-6
Identity = 32/105 (30.48%), Postives = 58/105 (55.24%), Query Frame = 3
Query: 1302 YRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERMIIQNNLENYG 1616
            Y +  ++   DE+V S     DRR++AV  +  C + L GP  R  +D       +  E+ +Y L+I   +K + D+ +  +++TFP+A L ++M I++N+ N G
Sbjct:  955 YEQIIEIAPHDELVHSHQNVHDRRIKAVGMKTGCYLNLKGPIKRPPIDGD-----MRREREVYELIIGAPSKGKADRCINYLRDTFPRAVLTKKM-IRSNIFNKG 1053          
BLAST of SMED30026051 vs. TrEMBL
Match: A0A0R3WQH8 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS3003 PE=4 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.549e-6
Identity = 29/95 (30.53%), Postives = 51/95 (53.68%), Query Frame = 3
Query: 1302 YRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERM 1586
            Y +  +V   DE+V S     DRR++AV  +  C + + GP  R  +D       +  E+ +Y L+I    KE+ D+ +  +++TFP+A L ++M
Sbjct:  972 YEQIIEVAPHDELVHSHQNAHDRRIKAVSMKTGCHLDIKGPIKRPPIDGN-----MRREREVYELIIGAPNKEKADRCINYLRDTFPRAVLTKKM 1061          
BLAST of SMED30026051 vs. Planmine SMEST
Match: SMESG000012235.1 (SMESG000012235.1)

HSP 1 Score: 1061.6 bits (2744), Expect = 0.000e+0
Identity = 536/536 (100.00%), Postives = 536/536 (100.00%), Query Frame = 3
Query:   24 MNIVEVNLNESNYAKSSLCCNEENIEIYSPLCNTVLTDNSRVSLFENGXXXXXXXXXXXXXXXXYQTKATNLSMGCSNKSLDQSHNSNYSTPKLNKSPNISLQNILITDDLLGNNSLPILNEPSKTFTPNKEEIVKITKAVSLEFTCSTRITPPYINDCPEVVRSRYETDVITHENEQQSIKTTPGSLQLISDQNKLTKSEFMNPASEQPSIDEKSDYFDSSKFYPSREIQTLPVLILPLCTEDKMVETEESEMIQKKTKAERKDSQLKDFENSVPIGRAPVEICHKETQASAKSKQRTRTSSEHPSILKTKETSDELALRNSEGNSMQKQFWGDVYNDYKLTKKERDKEKLRIRKLQRAASAVTPKLSSLSRKDTNLTGDDVENKFVNVETEKSSNLAKLTTQRTSKNKIDAKGLLLPTKDEMKCYRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERMIIQNNLENYGDEILL 1631
            MNIVEVNLNESNYAKSSLCCNEENIEIYSPLCNTVLTDNSRVSLFENGSNNTRDSSLSSSSSNSYQTKATNLSMGCSNKSLDQSHNSNYSTPKLNKSPNISLQNILITDDLLGNNSLPILNEPSKTFTPNKEEIVKITKAVSLEFTCSTRITPPYINDCPEVVRSRYETDVITHENEQQSIKTTPGSLQLISDQNKLTKSEFMNPASEQPSIDEKSDYFDSSKFYPSREIQTLPVLILPLCTEDKMVETEESEMIQKKTKAERKDSQLKDFENSVPIGRAPVEICHKETQASAKSKQRTRTSSEHPSILKTKETSDELALRNSEGNSMQKQFWGDVYNDYKLTKKERDKEKLRIRKLQRAASAVTPKLSSLSRKDTNLTGDDVENKFVNVETEKSSNLAKLTTQRTSKNKIDAKGLLLPTKDEMKCYRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERMIIQNNLENYGDEILL
Sbjct:    1 MNIVEVNLNESNYAKSSLCCNEENIEIYSPLCNTVLTDNSRVSLFENGSNNTRDSSLSSSSSNSYQTKATNLSMGCSNKSLDQSHNSNYSTPKLNKSPNISLQNILITDDLLGNNSLPILNEPSKTFTPNKEEIVKITKAVSLEFTCSTRITPPYINDCPEVVRSRYETDVITHENEQQSIKTTPGSLQLISDQNKLTKSEFMNPASEQPSIDEKSDYFDSSKFYPSREIQTLPVLILPLCTEDKMVETEESEMIQKKTKAERKDSQLKDFENSVPIGRAPVEICHKETQASAKSKQRTRTSSEHPSILKTKETSDELALRNSEGNSMQKQFWGDVYNDYKLTKKERDKEKLRIRKLQRAASAVTPKLSSLSRKDTNLTGDDVENKFVNVETEKSSNLAKLTTQRTSKNKIDAKGLLLPTKDEMKCYRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERMIIQNNLENYGDEILL 536          
BLAST of SMED30026051 vs. Planmine SMEST
Match: SMESG000071919.1 (SMESG000071919.1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.405e-16
Identity = 34/97 (35.05%), Postives = 66/97 (68.04%), Query Frame = 3
Query: 1302 YRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGP--TSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACLNERM 1586
            Y + F++++FDEI+KS    SDRR++A+ +R+ C++ + GP  ++ SQ +S++ + +       Y+L+++   K +L+KS+ CIQ +FP +C NE++
Sbjct:  183 YYRVFELKKFDEIIKSHQARSDRRLKAISNRMLCKLDIIGPYQSTNSQQNSRTAVDW-------YNLIVYASNKLRLEKSINCIQLSFPSSCFNEKL 272          
BLAST of SMED30026051 vs. Planmine SMEST
Match: SMESG000024364.1 (SMESG000024364.1)

HSP 1 Score: 71.633 bits (174), Expect = 5.069e-13
Identity = 33/87 (37.93%), Postives = 54/87 (62.07%), Query Frame = 3
Query: 1302 YRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFP 1562
            ++K F +  FDEI+KS   P+DRR+RAV +++ C+I +FGP   S         +   E+ ++H ++   +K  L+K LKCI++TFP
Sbjct:  332 FQKVFVLSPFDEIIKSHTCPNDRRLRAVANKMRCKIDIFGPMKVSHFTPS---FYTTREKIIFHCVLSGDSKYNLEKCLKCIKDTFP 415          
BLAST of SMED30026051 vs. Planmine SMEST
Match: SMESG000076818.1 (SMESG000076818.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.048e-6
Identity = 30/95 (31.58%), Postives = 51/95 (53.68%), Query Frame = 3
Query: 1290 EMKCYRKCFQVQQFDEIVKSFNTPSDRRMRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQLDKSLKCIQETFPKACL 1574
              K +R  F++  +D+I+K+   P DRR+++V ++  C+I + GP   +  D  S  +F N  +  Y   +    KE LDK +  ++ETFP   L
Sbjct:  687 NFKVFR-SFELSPYDDIIKAHLNPIDRRVKSVAAKNGCRIAIDGPI--NSYDPLSCQAFRN--KVTYRCTVAGPNKENLDKCMNYLKETFPNTFL 776          
The following BLAST results are available for this feature:
BLAST of SMED30026051 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7M6E01.014e-732.63Uncharacterized protein OS=Dugesia ryukyuensis OX=... [more]
A0A068WQZ72.368e-731.43Uro adherence factor A OS=Echinococcus granulosus ... [more]
A0A0R3W5U41.248e-631.58Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
A0A087W1K41.594e-630.48Uro adherence factor A OS=Echinococcus multilocula... [more]
A0A0R3WQH82.549e-630.53Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of SMED30026051 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026051 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000012235.10.000e+0100.00SMESG000012235.1[more]
SMESG000071919.11.405e-1635.05SMESG000071919.1[more]
SMESG000024364.15.069e-1337.93SMESG000024364.1[more]
SMESG000076818.11.048e-631.58SMESG000076818.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026051 ID=SMED30026051|Name=SMED30026051|organism=Schmidtea mediterranea sexual|type=transcript|length=1686bp
TCTGATATAAAGTTGAATGCGCAATGAACATCGTTGAAGTGAATCTTAAT
GAATCCAATTATGCGAAAAGCTCATTGTGCTGCAACGAAGAGAACATAGA
AATATACAGTCCATTGTGCAATACTGTTCTCACTGACAATTCTCGAGTGA
GCCTTTTTGAGAATGGATCTAATAACACAAGAGATTCGTCTTTATCTTCT
TCATCCAGCAATTCCTATCAAACGAAAGCAACAAATCTATCAATGGGCTG
CAGCAATAAGAGTTTGGACCAGAGTCACAATTCAAATTATTCAACTCCAA
AGCTTAACAAGAGTCCGAATATATCCCTTCAAAACATTCTAATTACAGAT
GATTTACTCGGCAATAATTCCCTTCCGATACTGAATGAACCTTCGAAAAC
CTTTACTCCAAACAAAGAAGAAATTGTAAAAATAACTAAAGCTGTGTCTT
TGGAATTTACGTGTTCAACTCGAATTACCCCGCCATACATTAATGACTGT
CCGGAAGTGGTCAGATCACGGTATGAAACGGACGTGATCACTCATGAGAA
TGAACAACAGTCAATAAAGACTACTCCAGGGTCTTTGCAGTTAATTTCAG
ATCAAAATAAATTAACTAAGTCCGAGTTTATGAATCCTGCTTCCGAGCAA
CCGTCTATAGATGAAAAGAGTGACTATTTCGACAGTTCTAAATTCTATCC
GAGTAGAGAAATACAAACTTTACCAGTTCTCATTTTGCCATTATGTACGG
AGGATAAGATGGTCGAAACCGAAGAAAGTGAAATGATTCAGAAGAAGACA
AAGGCAGAGAGGAAAGACTCACAATTGAAAGATTTCGAAAATTCAGTTCC
AATCGGAAGAGCTCCTGTTGAAATCTGTCACAAAGAGACGCAAGCATCCG
CCAAATCTAAACAACGCACTAGAACCAGTTCTGAACATCCTTCAATTCTT
AAAACTAAAGAAACTTCTGATGAATTAGCACTACGAAATTCCGAGGGAAA
CAGTATGCAAAAACAATTCTGGGGCGATGTGTACAATGACTACAAATTGA
CAAAGAAAGAACGAGATAAAGAAAAGTTACGAATAAGAAAACTTCAAAGA
GCAGCAAGTGCGGTAACACCTAAGCTTTCTTCTCTGTCTCGAAAAGATAC
TAATCTAACTGGGGATGATGTTGAGAACAAATTTGTTAATGTTGAGACAG
AAAAGTCATCCAACCTAGCCAAACTTACAACACAAAGAACAAGTAAAAAT
AAAATCGATGCTAAAGGTTTACTTTTACCGACTAAAGATGAAATGAAATG
CTATAGGAAATGTTTTCAAGTTCAACAATTTGATGAGATTGTCAAATCCT
TTAATACTCCAAGTGATAGACGCATGCGTGCCGTCTGTAGCAGAGTAAAC
TGCCAAATCAAGTTATTTGGACCGACCTCTCGTAGCCAGGTAGACTCAAA
ATCCCATATATCATTCGTCAACCATGAGCAACCTCTGTATCATTTGCTGA
TTTTTACAAAGACTAAAGAACAATTAGATAAATCCTTGAAGTGCATCCAA
GAAACATTTCCAAAAGCCTGCCTCAATGAAAGAATGATAATCCAAAATAA
TTTAGAAAATTATGGAGATGAAATTCTTTTGTAACTTCGGTTAAAAATAG
ACTTTTTAATTTATATTTCGTTCTCATATAATACTG
back to top

protein sequence of SMED30026051-orf-1

>SMED30026051-orf-1 ID=SMED30026051-orf-1|Name=SMED30026051-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=537bp
MNIVEVNLNESNYAKSSLCCNEENIEIYSPLCNTVLTDNSRVSLFENGSN
NTRDSSLSSSSSNSYQTKATNLSMGCSNKSLDQSHNSNYSTPKLNKSPNI
SLQNILITDDLLGNNSLPILNEPSKTFTPNKEEIVKITKAVSLEFTCSTR
ITPPYINDCPEVVRSRYETDVITHENEQQSIKTTPGSLQLISDQNKLTKS
EFMNPASEQPSIDEKSDYFDSSKFYPSREIQTLPVLILPLCTEDKMVETE
ESEMIQKKTKAERKDSQLKDFENSVPIGRAPVEICHKETQASAKSKQRTR
TSSEHPSILKTKETSDELALRNSEGNSMQKQFWGDVYNDYKLTKKERDKE
KLRIRKLQRAASAVTPKLSSLSRKDTNLTGDDVENKFVNVETEKSSNLAK
LTTQRTSKNKIDAKGLLLPTKDEMKCYRKCFQVQQFDEIVKSFNTPSDRR
MRAVCSRVNCQIKLFGPTSRSQVDSKSHISFVNHEQPLYHLLIFTKTKEQ
LDKSLKCIQETFPKACLNERMIIQNNLENYGDEILL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 340..360
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 288..323
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 289..319