UTP--glucose-1-phosphate uridylyltransferase

Overview
NameUTP--glucose-1-phosphate uridylyltransferase
Smed IDSMED30026043
Length (bp)1782
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of UTP--glucose-1-phosphate uridylyltransferase (SMED30026043) t-SNE clustered cells

Violin plots show distribution of expression levels for UTP--glucose-1-phosphate uridylyltransferase (SMED30026043) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of UTP--glucose-1-phosphate uridylyltransferase (SMED30026043) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for UTP--glucose-1-phosphate uridylyltransferase (SMED30026043) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026043

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30026043SMESG000043519.1 dd_Smed_v4_3057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30026043SMESG000043519.1 dd_Smed_v4_3057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30026043SMESG000043519.1 dd_Smed_v4_3057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026043SMESG000043519.1 dd_Smed_v4_3057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30026043SMESG000043519.1 dd_Smed_v4_3057_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026043SMESG000043519.1 dd_Smed_v6_3057_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026043SMESG000043519.1 dd_Smed_v4_3057_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Human
Match: UGP2 (UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:12527])

HSP 1 Score: 597.045 bits (1538), Expect = 0.000e+0
Identity = 298/519 (57.42%), Postives = 376/519 (72.45%), Query Frame = 1
Query:   43 EKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E   +    D A +F+E+ R++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVNAKTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:    6 EDLSKAMSQDGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Human
Match: UGP2 (UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:12527])

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 297/510 (58.24%), Postives = 374/510 (73.33%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVNAKTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Human
Match: UGP2 (UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:12527])

HSP 1 Score: 596.275 bits (1536), Expect = 0.000e+0
Identity = 297/510 (58.24%), Postives = 374/510 (73.33%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVNAKTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   24 DGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 517          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Human
Match: UGP2 (UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:12527])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 297/510 (58.24%), Postives = 374/510 (73.33%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVNAKTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:    4 DGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Human
Match: UGP2 (UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbol;Acc:HGNC:12527])

HSP 1 Score: 595.89 bits (1535), Expect = 0.000e+0
Identity = 297/510 (58.24%), Postives = 374/510 (73.33%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVNAKTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:    4 DGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Celegans
Match: K08E3.5 (UTP--glucose-1-phosphate uridylyltransferase [Source:UniProtKB/TrEMBL;Acc:Q86D12])

HSP 1 Score: 601.282 bits (1549), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 382/502 (76.10%), Query Frame = 1
Query:   82 EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI-DYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E+K  T+ +A   M   L +L+ T      +H + EL GF+ LF R+L    T + W  I+ L E  ++PY++L  + D  ++ + L KL+V+KLNGGLGTSMGC GPKS+ISVRNDLTFLDL +QQI+ LN  Y  D+PL+LMNSFNT EDT +VL+KYA + V++ TF QS YPRI+RE+++PI K +                +++ WYPPGHG+ Y +  NSG+LDK L +GKE+ F+SNIDNMGATVDL IL+F++     +  PEF+MEVT+KTRADVKGGTL++YE +L LLE+AQVPK+  +EF S+ KFRIFNTNNLWA L ++++ ++E+ L+MEVIVN K LD G +++QLE AAG+AIKSF+ A+G+NVPR+RFLPVK+++DL+L+MSNLY +  G L +S  RSFP+ PLVKLG  F++VKD+L RF+ IPD+LELDHLTVSGDV+FG+DV LKGTVIIIANHGDRIDIP G+IL+NKIVSGNLRIL+H
Sbjct:   24 EWKTSTKLEALGSMEGELAHLLSTCKPETLNHNKTELSGFRNLFARFLRAKPT-VDWSKIEPLPEGAIRPYKSLGHVVDKELIASQLRKLVVVKLNGGLGTSMGCKGPKSVISVRNDLTFLDLTMQQIQTLNKTYGVDVPLVLMNSFNTNEDTQKVLKKYANVKVSVHTFSQSQYPRINRETLLPIVKSLEAD-------------DNECWYPPGHGNFYEAFHNSGLLDKFLADGKEYCFLSNIDNMGATVDLSILNFVLNPSPDQTAPEFLMEVTDKTRADVKGGTLIQYEGRLMLLEIAQVPKDYVDEFKSISKFRIFNTNNLWAKLDAMRKIVVENKLEMEVIVNPKHLDRGLDVIQLETAAGAAIKSFSGAVGVNVPRSRFLPVKKTSDLLLLMSNLYDIDNGSLTLSHQRSFPTTPLVKLGSSFDKVKDYLGRFNGIPDLLELDHLTVSGDVWFGKDVSLKGTVIIIANHGDRIDIPPGSILENKIVSGNLRILEH 511          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Celegans
Match: K08E3.5 (UTP--glucose-1-phosphate uridylyltransferase [Source:UniProtKB/TrEMBL;Acc:Q86D12])

HSP 1 Score: 600.512 bits (1547), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 382/502 (76.10%), Query Frame = 1
Query:   82 EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI-DYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E+K  T+ +A   M   L +L+ T      +H + EL GF+ LF R+L    T + W  I+ L E  ++PY++L  + D  ++ + L KL+V+KLNGGLGTSMGC GPKS+ISVRNDLTFLDL +QQI+ LN  Y  D+PL+LMNSFNT EDT +VL+KYA + V++ TF QS YPRI+RE+++PI K +                +++ WYPPGHG+ Y +  NSG+LDK L +GKE+ F+SNIDNMGATVDL IL+F++     +  PEF+MEVT+KTRADVKGGTL++YE +L LLE+AQVPK+  +EF S+ KFRIFNTNNLWA L ++++ ++E+ L+MEVIVN K LD G +++QLE AAG+AIKSF+ A+G+NVPR+RFLPVK+++DL+L+MSNLY +  G L +S  RSFP+ PLVKLG  F++VKD+L RF+ IPD+LELDHLTVSGDV+FG+DV LKGTVIIIANHGDRIDIP G+IL+NKIVSGNLRIL+H
Sbjct:   35 EWKTSTKLEALGSMEGELAHLLSTCKPETLNHNKTELSGFRNLFARFLRAKPT-VDWSKIEPLPEGAIRPYKSLGHVVDKELIASQLRKLVVVKLNGGLGTSMGCKGPKSVISVRNDLTFLDLTMQQIQTLNKTYGVDVPLVLMNSFNTNEDTQKVLKKYANVKVSVHTFSQSQYPRINRETLLPIVKSLEAD-------------DNECWYPPGHGNFYEAFHNSGLLDKFLADGKEYCFLSNIDNMGATVDLSILNFVLNPSPDQTAPEFLMEVTDKTRADVKGGTLIQYEGRLMLLEIAQVPKDYVDEFKSISKFRIFNTNNLWAKLDAMRKIVVENKLEMEVIVNPKHLDRGLDVIQLETAAGAAIKSFSGAVGVNVPRSRFLPVKKTSDLLLLMSNLYDIDNGSLTLSHQRSFPTTPLVKLGSSFDKVKDYLGRFNGIPDLLELDHLTVSGDVWFGKDVSLKGTVIIIANHGDRIDIPPGSILENKIVSGNLRILEH 522          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Celegans
Match: K08E3.5 (UTP--glucose-1-phosphate uridylyltransferase [Source:UniProtKB/TrEMBL;Acc:Q86D12])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 382/502 (76.10%), Query Frame = 1
Query:   82 EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI-DYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E+K  T+ +A   M   L +L+ T      +H + EL GF+ LF R+L    T + W  I+ L E  ++PY++L  + D  ++ + L KL+V+KLNGGLGTSMGC GPKS+ISVRNDLTFLDL +QQI+ LN  Y  D+PL+LMNSFNT EDT +VL+KYA + V++ TF QS YPRI+RE+++PI K +                +++ WYPPGHG+ Y +  NSG+LDK L +GKE+ F+SNIDNMGATVDL IL+F++     +  PEF+MEVT+KTRADVKGGTL++YE +L LLE+AQVPK+  +EF S+ KFRIFNTNNLWA L ++++ ++E+ L+MEVIVN K LD G +++QLE AAG+AIKSF+ A+G+NVPR+RFLPVK+++DL+L+MSNLY +  G L +S  RSFP+ PLVKLG  F++VKD+L RF+ IPD+LELDHLTVSGDV+FG+DV LKGTVIIIANHGDRIDIP G+IL+NKIVSGNLRIL+H
Sbjct:    6 EWKTSTKLEALGSMEGELAHLLSTCKPETLNHNKTELSGFRNLFARFLRAKPT-VDWSKIEPLPEGAIRPYKSLGHVVDKELIASQLRKLVVVKLNGGLGTSMGCKGPKSVISVRNDLTFLDLTMQQIQTLNKTYGVDVPLVLMNSFNTNEDTQKVLKKYANVKVSVHTFSQSQYPRINRETLLPIVKSLEAD-------------DNECWYPPGHGNFYEAFHNSGLLDKFLADGKEYCFLSNIDNMGATVDLSILNFVLNPSPDQTAPEFLMEVTDKTRADVKGGTLIQYEGRLMLLEIAQVPKDYVDEFKSISKFRIFNTNNLWAKLDAMRKIVVENKLEMEVIVNPKHLDRGLDVIQLETAAGAAIKSFSGAVGVNVPRSRFLPVKKTSDLLLLMSNLYDIDNGSLTLSHQRSFPTTPLVKLGSSFDKVKDYLGRFNGIPDLLELDHLTVSGDVWFGKDVSLKGTVIIIANHGDRIDIPPGSILENKIVSGNLRILEH 493          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Celegans
Match: K08E3.5 (UTP--glucose-1-phosphate uridylyltransferase [Source:UniProtKB/TrEMBL;Acc:Q86D12])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 382/502 (76.10%), Query Frame = 1
Query:   82 EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI-DYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E+K  T+ +A   M   L +L+ T      +H + EL GF+ LF R+L    T + W  I+ L E  ++PY++L  + D  ++ + L KL+V+KLNGGLGTSMGC GPKS+ISVRNDLTFLDL +QQI+ LN  Y  D+PL+LMNSFNT EDT +VL+KYA + V++ TF QS YPRI+RE+++PI K +                +++ WYPPGHG+ Y +  NSG+LDK L +GKE+ F+SNIDNMGATVDL IL+F++     +  PEF+MEVT+KTRADVKGGTL++YE +L LLE+AQVPK+  +EF S+ KFRIFNTNNLWA L ++++ ++E+ L+MEVIVN K LD G +++QLE AAG+AIKSF+ A+G+NVPR+RFLPVK+++DL+L+MSNLY +  G L +S  RSFP+ PLVKLG  F++VKD+L RF+ IPD+LELDHLTVSGDV+FG+DV LKGTVIIIANHGDRIDIP G+IL+NKIVSGNLRIL+H
Sbjct:    9 EWKTSTKLEALGSMEGELAHLLSTCKPETLNHNKTELSGFRNLFARFLRAKPT-VDWSKIEPLPEGAIRPYKSLGHVVDKELIASQLRKLVVVKLNGGLGTSMGCKGPKSVISVRNDLTFLDLTMQQIQTLNKTYGVDVPLVLMNSFNTNEDTQKVLKKYANVKVSVHTFSQSQYPRINRETLLPIVKSLEAD-------------DNECWYPPGHGNFYEAFHNSGLLDKFLADGKEYCFLSNIDNMGATVDLSILNFVLNPSPDQTAPEFLMEVTDKTRADVKGGTLIQYEGRLMLLEIAQVPKDYVDEFKSISKFRIFNTNNLWAKLDAMRKIVVENKLEMEVIVNPKHLDRGLDVIQLETAAGAAIKSFSGAVGVNVPRSRFLPVKKTSDLLLLMSNLYDIDNGSLTLSHQRSFPTTPLVKLGSSFDKVKDYLGRFNGIPDLLELDHLTVSGDVWFGKDVSLKGTVIIIANHGDRIDIPPGSILENKIVSGNLRILEH 496          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Celegans
Match: K08E3.5 (UTP--glucose-1-phosphate uridylyltransferase [Source:UniProtKB/TrEMBL;Acc:Q86D12])

HSP 1 Score: 600.127 bits (1546), Expect = 0.000e+0
Identity = 290/502 (57.77%), Postives = 382/502 (76.10%), Query Frame = 1
Query:   82 EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI-DYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E+K  T+ +A   M   L +L+ T      +H + EL GF+ LF R+L    T + W  I+ L E  ++PY++L  + D  ++ + L KL+V+KLNGGLGTSMGC GPKS+ISVRNDLTFLDL +QQI+ LN  Y  D+PL+LMNSFNT EDT +VL+KYA + V++ TF QS YPRI+RE+++PI K +                +++ WYPPGHG+ Y +  NSG+LDK L +GKE+ F+SNIDNMGATVDL IL+F++     +  PEF+MEVT+KTRADVKGGTL++YE +L LLE+AQVPK+  +EF S+ KFRIFNTNNLWA L ++++ ++E+ L+MEVIVN K LD G +++QLE AAG+AIKSF+ A+G+NVPR+RFLPVK+++DL+L+MSNLY +  G L +S  RSFP+ PLVKLG  F++VKD+L RF+ IPD+LELDHLTVSGDV+FG+DV LKGTVIIIANHGDRIDIP G+IL+NKIVSGNLRIL+H
Sbjct:   22 EWKTSTKLEALGSMEGELAHLLSTCKPETLNHNKTELSGFRNLFARFLRAKPT-VDWSKIEPLPEGAIRPYKSLGHVVDKELIASQLRKLVVVKLNGGLGTSMGCKGPKSVISVRNDLTFLDLTMQQIQTLNKTYGVDVPLVLMNSFNTNEDTQKVLKKYANVKVSVHTFSQSQYPRINRETLLPIVKSLEAD-------------DNECWYPPGHGNFYEAFHNSGLLDKFLADGKEYCFLSNIDNMGATVDLSILNFVLNPSPDQTAPEFLMEVTDKTRADVKGGTLIQYEGRLMLLEIAQVPKDYVDEFKSISKFRIFNTNNLWAKLDAMRKIVVENKLEMEVIVNPKHLDRGLDVIQLETAAGAAIKSFSGAVGVNVPRSRFLPVKKTSDLLLLMSNLYDIDNGSLTLSHQRSFPTTPLVKLGSSFDKVKDYLGRFNGIPDLLELDHLTVSGDVWFGKDVSLKGTVIIIANHGDRIDIPPGSILENKIVSGNLRILEH 509          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Fly
Match: UGP (gene:FBgn0035978 transcript:FBtr0301698)

HSP 1 Score: 595.504 bits (1534), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 383/514 (74.51%), Query Frame = 1
Query:   46 KTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGP-HFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            + H+R+ SD + EF E+T+RDA   +   ++ L+ T    R+  ++ E+  F  LF R++ E    + W+ I+ L E  V  Y NL       ++N LDKL+VIKLNGGLGTSMGC GPKS+I VR+DLTFLDL VQQIE LN  Y  ++PL+LMNSFNT EDT +++RKY    V I TF QS +PRI RE  +P+ K       DF    V+ +ME  AWYPPGHGD Y +  NSG+L K ++EG+E+ F+SNIDN+GATVDL IL+ LV   +     EFVMEVT+KTRADVKGGTL++ E+KLRLLE+AQVP E  ++F SV+ F+ FNTNN+WA+L +I + + E TL ME+IVN KTL+NGT ++QLE A G+A+K F+ AIGINVPR+RFLPVK+S+DL+LVMSNLY ++ G L+MSP R FP+ PLVKLG  HF++VK+FL RF+NIPD++ELDHLTVSGDV FGR V L+GTVIIIANHGDRIDIP+GAIL+NKIVSGN+RILDH
Sbjct:   11 RGHQRAPSD-SKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAK-------DF---DVEKDME--AWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH 511          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Fly
Match: UGP (gene:FBgn0035978 transcript:FBtr0301699)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 299/514 (58.17%), Postives = 383/514 (74.51%), Query Frame = 1
Query:   46 KTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGP-HFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            + H+R+ SD + EF E+T+RDA   +   ++ L+ T    R+  ++ E+  F  LF R++ E    + W+ I+ L E  V  Y NL       ++N LDKL+VIKLNGGLGTSMGC GPKS+I VR+DLTFLDL VQQIE LN  Y  ++PL+LMNSFNT EDT +++RKY    V I TF QS +PRI RE  +P+ K       DF    V+ +ME  AWYPPGHGD Y +  NSG+L K ++EG+E+ F+SNIDN+GATVDL IL+ LV   +     EFVMEVT+KTRADVKGGTL++ E+KLRLLE+AQVP E  ++F SV+ F+ FNTNN+WA+L +I + + E TL ME+IVN KTL+NGT ++QLE A G+A+K F+ AIGINVPR+RFLPVK+S+DL+LVMSNLY ++ G L+MSP R FP+ PLVKLG  HF++VK+FL RF+NIPD++ELDHLTVSGDV FGR V L+GTVIIIANHGDRIDIP+GAIL+NKIVSGN+RILDH
Sbjct:   18 RGHQRAPSD-SKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAK-------DF---DVEKDME--AWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH 518          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Fly
Match: UGP (gene:FBgn0035978 transcript:FBtr0076500)

HSP 1 Score: 595.119 bits (1533), Expect = 0.000e+0
Identity = 300/516 (58.14%), Postives = 387/516 (75.00%), Query Frame = 1
Query:   46 KTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENL--PEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGP-HFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            + H+R+ SD + EF E+T+RDA   +   ++ L+ T    R+  ++ E+  F  LF R++ E    + W+ I+ L E  V  Y NL  P+ + + ++N LDKL+VIKLNGGLGTSMGC GPKS+I VR+DLTFLDL VQQIE LN  Y  ++PL+LMNSFNT EDT +++RKY    V I TF QS +PRI RE  +P+ K       DF    V+ +ME  AWYPPGHGD Y +  NSG+L K ++EG+E+ F+SNIDN+GATVDL IL+ LV   +     EFVMEVT+KTRADVKGGTL++ E+KLRLLE+AQVP E  ++F SV+ F+ FNTNN+WA+L +I + + E TL ME+IVN KTL+NGT ++QLE A G+A+K F+ AIGINVPR+RFLPVK+S+DL+LVMSNLY ++ G L+MSP R FP+ PLVKLG  HF++VK+FL RF+NIPD++ELDHLTVSGDV FGR V L+GTVIIIANHGDRIDIP+GAIL+NKIVSGN+RILDH
Sbjct:   11 RGHQRAPSD-SKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAK-------DF---DVEKDME--AWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH 513          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Fly
Match: UGP (gene:FBgn0035978 transcript:FBtr0076501)

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 300/516 (58.14%), Postives = 387/516 (75.00%), Query Frame = 1
Query:   46 KTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENL--PEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGP-HFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            + H+R+ SD + EF E+T+RDA   +   ++ L+ T    R+  ++ E+  F  LF R++ E    + W+ I+ L E  V  Y NL  P+ + + ++N LDKL+VIKLNGGLGTSMGC GPKS+I VR+DLTFLDL VQQIE LN  Y  ++PL+LMNSFNT EDT +++RKY    V I TF QS +PRI RE  +P+ K       DF    V+ +ME  AWYPPGHGD Y +  NSG+L K ++EG+E+ F+SNIDN+GATVDL IL+ LV   +     EFVMEVT+KTRADVKGGTL++ E+KLRLLE+AQVP E  ++F SV+ F+ FNTNN+WA+L +I + + E TL ME+IVN KTL+NGT ++QLE A G+A+K F+ AIGINVPR+RFLPVK+S+DL+LVMSNLY ++ G L+MSP R FP+ PLVKLG  HF++VK+FL RF+NIPD++ELDHLTVSGDV FGR V L+GTVIIIANHGDRIDIP+GAIL+NKIVSGN+RILDH
Sbjct:   18 RGHQRAPSD-SKEFHEVTKRDALRLLEHDVDRLLETTEKARQPALKAEMGRFADLFGRFIQEEGPALDWNKIQKLPENAVMNYSNLKSPKNEQNEIRNMLDKLVVIKLNGGLGTSMGCHGPKSVIPVRSDLTFLDLTVQQIEHLNKTYDANVPLVLMNSFNTDEDTEKIVRKYKGFRVQIHTFNQSCFPRISREHYLPVAK-------DF---DVEKDME--AWYPPGHGDFYDTFRNSGLLKKFIEEGREYCFLSNIDNLGATVDLNILNKLVGEERATTPVEFVMEVTDKTRADVKGGTLIQMENKLRLLEIAQVPPEHVDDFKSVKTFKFFNTNNIWANLAAIDRVLRERTLNMEIIVNNKTLENGTRVIQLETAVGAAMKCFDGAIGINVPRSRFLPVKKSSDLLLVMSNLYTLKNGSLVMSPQRMFPTTPLVKLGENHFSKVKEFLGRFANIPDIIELDHLTVSGDVTFGRGVSLRGTVIIIANHGDRIDIPAGAILENKIVSGNMRILDH 520          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Zebrafish
Match: ugp2a (UDP-glucose pyrophosphorylase 2a [Source:ZFIN;Acc:ZDB-GENE-090311-46])

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 300/512 (58.59%), Postives = 370/512 (72.27%), Query Frame = 1
Query:   52 HRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHV-VKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            +R S +    EF+E  R   E  M   LE L+ TA  P  +   ++ EGFK LF R+L E    + W  I+   E  ++PYE +        V + L+KL V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+            +N   +   ++AWYPPGHGDIY S  NSG+LDK + EGKE+ F+SNIDN+GATVDL IL+ L+ S   +   EFVMEVT+KTRADVKGGTL +Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KTLD G N++QLE A G+A+KSF+NA+GINVPR+RFLPVK ++DL+LVMSNLY M  G L MSP R FP+ P VKLG  F +V+DFL RF +IPDMLELDHLTVSGDV FG+ + LKGTVIIIANHGDRIDIP+GA+L+NKIVSGNLRILDH
Sbjct:    8 YRSSPNAGMAEFQEKLRLQHENSMHTELEKLLSTAKTPEAEISRKDFEGFKKLFHRFLQEKGPSVDWAKIQRPPEDSIQPYEKIKLKGLPADVASSLNKLAVLKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYPRINKESLLPVA-----------TNMGLTGENEEAWYPPGHGDIYASFYNSGLLDKLIAEGKEYIFVSNIDNLGATVDLHILNHLM-SQPNDKRCEFVMEVTDKTRADVKGGTLTQYDGKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWMSLPAIKRLHEKNAMDMEIIVNPKTLDGGLNVIQLETAVGAAMKSFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSMNAGSLTMSPKREFPTTPHVKLGSSFTKVRDFLKRFESIPDMLELDHLTVSGDVTFGKQLTLKGTVIIIANHGDRIDIPAGAMLENKIVSGNLRILDH 507          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Zebrafish
Match: ugp2b (UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6352])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 289/513 (56.34%), Postives = 371/513 (72.32%), Query Frame = 1
Query:   61 SGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            S S+   +F+E+ R+  E+ M   LE L+ TA     +  +++ EGF+ LF R+L      ++W  I    E  ++PY+      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K + M           +    D WYPPGHGDIY S  NSG+L++ + EGKE+ F+SNIDN+GATVDL IL+ LV S       EF+MEVT+KTRADVKGGTL++Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KT+D G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+ P VKLG  F +V++++ RF +IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   14 SNSNGMAQFQEVMRQQLESSMHVELEKLLSTAKGAGAEVSKKDFEGFRKLFHRFLQVKGPSVEWPKINRPPEDSIQPYDKIKAKGLPD----NIADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYPRINKESLLPVAKDMGM-----------TGENGDVWYPPGHGDIYASFYNSGLLEQLIAEGKEYIFVSNIDNLGATVDLYILNHLV-SQPNGKRCEFIMEVTDKTRADVKGGTLIQYDGKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLSAIKRLQEQNAMDMEIIVNPKTIDGGLNVIQLETAVGAAIKCFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSEKREFPTTPHVKLGSSFTKVQEYITRFESIPDMLELDHLTVSGDVTFGKHVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 510          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Zebrafish
Match: ugp2b (UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6352])

HSP 1 Score: 579.326 bits (1492), Expect = 0.000e+0
Identity = 289/513 (56.34%), Postives = 371/513 (72.32%), Query Frame = 1
Query:   61 SGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            S S+   +F+E+ R+  E+ M   LE L+ TA     +  +++ EGF+ LF R+L      ++W  I    E  ++PY+      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K + M           +    D WYPPGHGDIY S  NSG+L++ + EGKE+ F+SNIDN+GATVDL IL+ LV S       EF+MEVT+KTRADVKGGTL++Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KT+D G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+ P VKLG  F +V++++ RF +IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   14 SNSNGMAQFQEVMRQQLESSMHVELEKLLSTAKGAGAEVSKKDFEGFRKLFHRFLQVKGPSVEWPKINRPPEDSIQPYDKIKAKGLPD----NIADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYPRINKESLLPVAKDMGM-----------TGENGDVWYPPGHGDIYASFYNSGLLEQLIAEGKEYIFVSNIDNLGATVDLYILNHLV-SQPNGKRCEFIMEVTDKTRADVKGGTLIQYDGKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLSAIKRLQEQNAMDMEIIVNPKTIDGGLNVIQLETAVGAAIKCFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSEKREFPTTPHVKLGSSFTKVQEYITRFESIPDMLELDHLTVSGDVTFGKHVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 510          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Zebrafish
Match: ugp2b (UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6352])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 289/513 (56.34%), Postives = 371/513 (72.32%), Query Frame = 1
Query:   61 SGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            S S+   +F+E+ R+  E+ M   LE L+ TA     +  +++ EGF+ LF R+L      ++W  I    E  ++PY+      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K + M           +    D WYPPGHGDIY S  NSG+L++ + EGKE+ F+SNIDN+GATVDL IL+ LV S       EF+MEVT+KTRADVKGGTL++Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KT+D G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+ P VKLG  F +V++++ RF +IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   10 SNSNGMAQFQEVMRQQLESSMHVELEKLLSTAKGAGAEVSKKDFEGFRKLFHRFLQVKGPSVEWPKINRPPEDSIQPYDKIKAKGLPD----NIADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYPRINKESLLPVAKDMGM-----------TGENGDVWYPPGHGDIYASFYNSGLLEQLIAEGKEYIFVSNIDNLGATVDLYILNHLV-SQPNGKRCEFIMEVTDKTRADVKGGTLIQYDGKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLSAIKRLQEQNAMDMEIIVNPKTIDGGLNVIQLETAVGAAIKCFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSEKREFPTTPHVKLGSSFTKVQEYITRFESIPDMLELDHLTVSGDVTFGKHVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 506          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Zebrafish
Match: ugp2b (UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-6352])

HSP 1 Score: 578.941 bits (1491), Expect = 0.000e+0
Identity = 289/513 (56.34%), Postives = 371/513 (72.32%), Query Frame = 1
Query:   61 SGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            S S+   +F+E+ R+  E+ M   LE L+ TA     +  +++ EGF+ LF R+L      ++W  I    E  ++PY+      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K + M           +    D WYPPGHGDIY S  NSG+L++ + EGKE+ F+SNIDN+GATVDL IL+ LV S       EF+MEVT+KTRADVKGGTL++Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KT+D G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+ P VKLG  F +V++++ RF +IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   10 SNSNGMAQFQEVMRQQLESSMHVELEKLLSTAKGAGAEVSKKDFEGFRKLFHRFLQVKGPSVEWPKINRPPEDSIQPYDKIKAKGLPD----NIADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYPRINKESLLPVAKDMGM-----------TGENGDVWYPPGHGDIYASFYNSGLLEQLIAEGKEYIFVSNIDNLGATVDLYILNHLV-SQPNGKRCEFIMEVTDKTRADVKGGTLIQYDGKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLSAIKRLQEQNAMDMEIIVNPKTIDGGLNVIQLETAVGAAIKCFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSEKREFPTTPHVKLGSSFTKVQEYITRFESIPDMLELDHLTVSGDVTFGKHVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 506          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Xenopus
Match: ugp2 (UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;Acc:493237])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 297/523 (56.79%), Postives = 374/523 (71.51%), Query Frame = 1
Query:   31 MLQFEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            M Q E+          ++F+E  R + E  M + LE ++ TAP    +HI+++L GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL V+QIE LNT Y  D+PL+LMNSFNT EDT ++L+KY+   V I TF QS YPRI +ES++PI K +             S    + WYPPGHGDIY S  NSG+LD+ + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVT+KTRADVKGGTL + E KLRL+E+AQVP+   +EF SV KF+IFNTNNLW  L +IK+    + + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPL KLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++VVLKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:    1 MTQLERLRNAMAGGGMLQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPD----NIASVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSHCRVKIHTFNQSRYPRISKESLLPIAKDLSY-----------SVENAETWYPPGHGDIYASFYNSGLLDRLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKC-EFVMEVTDKTRADVKGGTLTQCEGKLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSEKREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 507          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Xenopus
Match: ugp2 (UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;Acc:493237])

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 294/507 (57.99%), Postives = 370/507 (72.98%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            ++F+E  R + E  M + LE ++ TAP    +HI+++L GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL V+QIE LNT Y  D+PL+LMNSFNT EDT ++L+KY+   V I TF QS YPRI +ES++PI K +             S    + WYPPGHGDIY S  NSG+LD+ + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVT+KTRADVKGGTL + E KLRL+E+AQVP+   +EF SV KF+IFNTNNLW  L +IK+    + + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPL KLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++VVLKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   14 LQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPD----NIASVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSHCRVKIHTFNQSRYPRISKESLLPIAKDLSY-----------SVENAETWYPPGHGDIYASFYNSGLLDRLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKC-EFVMEVTDKTRADVKGGTLTQCEGKLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSEKREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 504          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Xenopus
Match: ugp2 (UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;Acc:493237])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 293/507 (57.79%), Postives = 371/507 (73.18%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            ++F+E  R + E  M + LE ++ TAP    +HI+++L GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL V+QIE LNT Y  D+PL+LMNSFNT EDT ++L+KY+   V I TF QS YPRI +ES++PI K +   + +            + WYPPGHGDIY S  NSG+LD+ + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVT+KTRADVKGGTL + E KLRL+E+AQVP+   +EF SV KF+IFNTNNLW  L +IK+    + + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPL KLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++VVLKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   13 LQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPD----NIASVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSHCRVKIHTFNQSRYPRISKESLLPIAKDLSYSVEN-----------AETWYPPGHGDIYASFYNSGLLDRLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKC-EFVMEVTDKTRADVKGGTLTQCEGKLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSEKREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 503          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Xenopus
Match: ugp2 (UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;Acc:493237])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 294/507 (57.99%), Postives = 370/507 (72.98%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            ++F+E  R + E  M + LE ++ TAP    +HI+++L GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL V+QIE LNT Y  D+PL+LMNSFNT EDT ++L+KY+   V I TF QS YPRI +ES++PI K +             S    + WYPPGHGDIY S  NSG+LD+ + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVT+KTRADVKGGTL + E KLRL+E+AQVP+   +EF SV KF+IFNTNNLW  L +IK+    + + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPL KLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++VVLKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   17 LQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPD----NIASVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSHCRVKIHTFNQSRYPRISKESLLPIAKDLSY-----------SVENAETWYPPGHGDIYASFYNSGLLDRLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKC-EFVMEVTDKTRADVKGGTLTQCEGKLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSEKREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 507          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Xenopus
Match: ugp2 (UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;Acc:493237])

HSP 1 Score: 589.726 bits (1519), Expect = 0.000e+0
Identity = 294/507 (57.99%), Postives = 370/507 (72.98%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            ++F+E  R + E  M + LE ++ TAP    +HI+++L GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL V+QIE LNT Y  D+PL+LMNSFNT EDT ++L+KY+   V I TF QS YPRI +ES++PI K +             S    + WYPPGHGDIY S  NSG+LD+ + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVT+KTRADVKGGTL + E KLRL+E+AQVP+   +EF SV KF+IFNTNNLW  L +IK+    + + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPL KLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++VVLKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   18 LQFQEAIREELEEAMKSDLEKILSTAPESELEHIKKDLAGFQKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKAKGLPD----NIASVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVKQIEHLNTVYNTDVPLVLMNSFNTDEDTKKILQKYSHCRVKIHTFNQSRYPRISKESLLPIAKDLSY-----------SVENAETWYPPGHGDIYASFYNSGLLDRLIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKKC-EFVMEVTDKTRADVKGGTLTQCEGKLRLVEIAQVPRAHVDEFKSVSKFKIFNTNNLWISLSAIKRLQEANAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSEKREFPTVPLTKLGSSFTKVQDYLKRFESIPDMLELDHLTVSGDVTFGKNVVLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Mouse
Match: Ugp2 (UDP-glucose pyrophosphorylase 2 [Source:MGI Symbol;Acc:MGI:2183447])

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 296/510 (58.04%), Postives = 373/510 (73.14%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+  ++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++PI K V             S    +AWYPPGHGDIY S  NSG+LD  ++EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Mouse
Match: Ugp2 (UDP-glucose pyrophosphorylase 2 [Source:MGI Symbol;Acc:MGI:2183447])

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 296/510 (58.04%), Postives = 373/510 (73.14%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+  ++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++PI K V             S    +AWYPPGHGDIY S  NSG+LD  ++EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:    4 DGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 497          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Mouse
Match: Uap1 (UDP-N-acetylglucosamine pyrophosphorylase 1 [Source:MGI Symbol;Acc:MGI:1334459])

HSP 1 Score: 57.3806 bits (137), Expect = 3.253e-8
Identity = 60/258 (23.26%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  340 DKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLD------LNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIET---FEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATV-DLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSI 1077
            +K+ V+ L GG GT +G + PK +  + + +  T         L +QQ+   +   KC IP  +M S  T E T +   K+    +  E    F+Q M P +  +  I + +K          NKV       +  P G+G +YR+L    I++     G     +  +DN+   V D + + F ++  K  +    V+E TN T      G + + +   +++E +++     +  +S  +  +FN  N+  H  ++
Sbjct:  101 NKVAVLLLAGGQGTRLGVSYPKGMYDVGLPSHKTLFQIQAERILKLQQLAEKHHGNKCTIPWYIMTSGRTMESTKEFFTKHKFFGLKKENVVFFQQGMLPAMSFDGKIILEEK----------NKV-------SMAPDGNGGLYRALAAQNIVEDMEQRGICSIHVYCVDNILVKVADPRFIGFCIQ--KGADCGAKVVEKTNPTEPV---GVVCRVDGVYQVVEYSEISLATAQRRSSDGRL-LFNAGNIANHFFTV 335          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Mouse
Match: Uap1 (UDP-N-acetylglucosamine pyrophosphorylase 1 [Source:MGI Symbol;Acc:MGI:1334459])

HSP 1 Score: 57.3806 bits (137), Expect = 3.513e-8
Identity = 60/258 (23.26%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  340 DKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLD------LNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIET---FEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATV-DLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSI 1077
            +K+ V+ L GG GT +G + PK +  + + +  T         L +QQ+   +   KC IP  +M S  T E T +   K+    +  E    F+Q M P +  +  I + +K          NKV       +  P G+G +YR+L    I++     G     +  +DN+   V D + + F ++  K  +    V+E TN T      G + + +   +++E +++     +  +S  +  +FN  N+  H  ++
Sbjct:  101 NKVAVLLLAGGQGTRLGVSYPKGMYDVGLPSHKTLFQIQAERILKLQQLAEKHHGNKCTIPWYIMTSGRTMESTKEFFTKHKFFGLKKENVVFFQQGMLPAMSFDGKIILEEK----------NKV-------SMAPDGNGGLYRALAAQNIVEDMEQRGICSIHVYCVDNILVKVADPRFIGFCIQ--KGADCGAKVVEKTNPTEPV---GVVCRVDGVYQVVEYSEISLATAQRRSSDGRL-LFNAGNIANHFFTV 335          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Mouse
Match: Uap1 (UDP-N-acetylglucosamine pyrophosphorylase 1 [Source:MGI Symbol;Acc:MGI:1334459])

HSP 1 Score: 57.3806 bits (137), Expect = 3.664e-8
Identity = 60/258 (23.26%), Postives = 112/258 (43.41%), Query Frame = 1
Query:  340 DKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLD------LNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIET---FEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATV-DLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSI 1077
            +K+ V+ L GG GT +G + PK +  + + +  T         L +QQ+   +   KC IP  +M S  T E T +   K+    +  E    F+Q M P +  +  I + +K          NKV       +  P G+G +YR+L    I++     G     +  +DN+   V D + + F ++  K  +    V+E TN T      G + + +   +++E +++     +  +S  +  +FN  N+  H  ++
Sbjct:  101 NKVAVLLLAGGQGTRLGVSYPKGMYDVGLPSHKTLFQIQAERILKLQQLAEKHHGNKCTIPWYIMTSGRTMESTKEFFTKHKFFGLKKENVVFFQQGMLPAMSFDGKIILEEK----------NKV-------SMAPDGNGGLYRALAAQNIVEDMEQRGICSIHVYCVDNILVKVADPRFIGFCIQ--KGADCGAKVVEKTNPTEPV---GVVCRVDGVYQVVEYSEISLATAQRRSSDGRL-LFNAGNIANHFFTV 335          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. UniProt/SwissProt
Match: sp|Q07130|UGPA_BOVIN (UTP--glucose-1-phosphate uridylyltransferase OS=Bos taurus OX=9913 GN=UGP2 PE=1 SV=2)

HSP 1 Score: 597.816 bits (1540), Expect = 0.000e+0
Identity = 298/510 (58.43%), Postives = 374/510 (73.33%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TAP+   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     V + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NVSSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYDTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKNVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKPC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. UniProt/SwissProt
Match: sp|Q16851|UGPA_HUMAN (UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2 PE=1 SV=5)

HSP 1 Score: 596.66 bits (1537), Expect = 0.000e+0
Identity = 297/510 (58.24%), Postives = 374/510 (73.33%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVNAKTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVIRQELELSVKKELEKILTTASSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNAKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. UniProt/SwissProt
Match: sp|O35156|UGPA_CRIGR (UTP--glucose-1-phosphate uridylyltransferase OS=Cricetulus griseus OX=10029 GN=UGP2 PE=2 SV=3)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 295/510 (57.84%), Postives = 373/510 (73.14%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+  ++ E  +   LE ++ TA +   +H +++L+GF+ L+ R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  L+EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVILQELELSVKKELEKILTTATSHEYEHTKKDLDGFRKLYHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKSYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVS-----------SSGESTEAWYPPGHGDIYASFYNSGLLDTFLEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. UniProt/SwissProt
Match: sp|Q91ZJ5|UGPA_MOUSE (UTP--glucose-1-phosphate uridylyltransferase OS=Mus musculus OX=10090 GN=Ugp2 PE=1 SV=3)

HSP 1 Score: 592.808 bits (1527), Expect = 0.000e+0
Identity = 296/510 (58.04%), Postives = 373/510 (73.14%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+  ++ E  +   LE ++ TA +   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++PI K V             S    +AWYPPGHGDIY S  NSG+LD  ++EGKE+ F+SNIDN+GATVDL IL+ L+     +   EFVMEVTNKTRADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVILQELELSVKKELEKILTTAASHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPIAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIEEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRC-EFVMEVTNKTRADVKGGTLTQYEGKLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLGAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. UniProt/SwissProt
Match: sp|P79303|UGPA_PIG (UTP--glucose-1-phosphate uridylyltransferase OS=Sus scrofa OX=9823 GN=UGP2 PE=2 SV=3)

HSP 1 Score: 590.112 bits (1520), Expect = 0.000e+0
Identity = 294/510 (57.65%), Postives = 370/510 (72.55%), Query Frame = 1
Query:   70 DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            D A +F+E+ R++ E  +   LE ++ TAP+   +H +++L+GF+ LF R+L E    + W  I+   E  ++PYE      LP+     + + L+KL+V+KLNGGLGTSMGC GPKSLI VRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+ K V             S    +AWYPPGHGDIY S  NSG+LD  + EGKE+ F+SNIDN+GATVDL IL+ L+         EFVME TNK RADVKGGTL +YE KLRL+E+AQVPK   +EF SV KF+IFNTNNLW  L ++K+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF N++GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+VPLVKLG  F +V+D+L RF +IPDMLELDHLTVSGDV FG++V LKGTVIII NHGDRIDIP GA+L+NKIVSGNLRILDH
Sbjct:   15 DGASQFQEVIRQELELSVKKELEKILTTAPSHEFEHTKKDLDGFRKLFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPD----NISSVLNKLVVVKLNGGLGTSMGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYNHCRVKIYTFNQSRYPRINKESLLPVAKDVSY-----------SGENTEAWYPPGHGDIYASFYNSGLLDTFIGEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGRPC-EFVMEATNKARADVKGGTLTQYEGKLRLVEIAQVPKPHVDEFKSVSKFKIFNTNNLWISLAAVKRLQEQNAIDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFENSLGINVPRSRFLPVKTTSDLLLVMSNLYSLNAGSLTMSEKREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIXNHGDRIDIPPGAVLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. TrEMBL
Match: A0A0B7AN08 (UTP--glucose-1-phosphate uridylyltransferase OS=Arion vulgaris OX=1028688 GN=ORF130232 PE=3 SV=1)

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 313/515 (60.78%), Postives = 405/515 (78.64%), Query Frame = 1
Query:   40 FEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            F K H+RS SD  +EF++  R+DA++ M+  L  L++T     +D   +E EGF+ LF R+L E+   ++WD +KLL    ++ Y +L   +   VKN LDKL+VIKLNGGLGTSMGCTGPKS I VRN+LTFLDLNVQQIE LN  +  D+PL+LMNSFNT +DT ++LRKY+++ V+I TF QS +PRI+R++++P+ +               +E   + WYPPGHGD+Y SL NSG+LDK ++EGK++ FISNIDNMGATVDL IL+FL+ES +  + PEFVMEVT+KTRAD+KGGTLV YE KLRLLE AQVP +  +EF SVRKF+IFNTNNLW  L +IK+++ E+T+ ME+IVN KTLDNG N++QLE AAG+AIKSF+ A+GINVPR+RFLPVK ++DL++VMSNLY M+ G L MSP RSFPSVPLVKLG  F++VKDF++RF++IPD++ELDHLTV+GDV FG++V L+GTVIIIANHG++IDIP GAIL+NKIVSGNLRILDH
Sbjct:   17 FVKGHKRSPSD--IEFRDAMRKDAQSAMNKELYKLLMTTAPGLQDRTRKEFEGFETLFARFLRETGPSVEWDKLKLLSPELIRKYNDLKTPEPKDVKNLLDKLVVIKLNGGLGTSMGCTGPKSAIQVRNELTFLDLNVQQIEYLNKSHGVDVPLVLMNSFNTDDDTQKILRKYSQIKVSIVTFNQSRFPRINRDTLMPVPRSF-------------TEESIEGWYPPGHGDVYSSLYNSGLLDKFINEGKKYVFISNIDNMGATVDLNILNFLLESQESSS-PEFVMEVTDKTRADIKGGTLVDYEGKLRLLEFAQVPADHVDEFKSVRKFKIFNTNNLWISLNAIKRNVEEETMHMEIIVNPKTLDNGMNVIQLETAAGAAIKSFDRAVGINVPRSRFLPVKTTSDLLIVMSNLYAMKTGALEMSPKRSFPSVPLVKLGNQFSKVKDFIHRFASIPDIIELDHLTVAGDVNFGKNVTLRGTVIIIANHGEKIDIPQGAILENKIVSGNLRILDH 515          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. TrEMBL
Match: A0A0B7ANL7 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF130228 PE=4 SV=1)

HSP 1 Score: 650.973 bits (1678), Expect = 0.000e+0
Identity = 313/515 (60.78%), Postives = 405/515 (78.64%), Query Frame = 1
Query:   40 FEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            F K H+RS SD  +EF++  R+DA++ M+  L  L++T     +D   +E EGF+ LF R+L E+   ++WD +KLL    ++ Y +L   +   VKN LDKL+VIKLNGGLGTSMGCTGPKS I VRN+LTFLDLNVQQIE LN  +  D+PL+LMNSFNT +DT ++LRKY+++ V+I TF QS +PRI+R++++P+ +               +E   + WYPPGHGD+Y SL NSG+LDK ++EGK++ FISNIDNMGATVDL IL+FL+ES +  + PEFVMEVT+KTRAD+KGGTLV YE KLRLLE AQVP +  +EF SVRKF+IFNTNNLW  L +IK+++ E+T+ ME+IVN KTLDNG N++QLE AAG+AIKSF+ A+GINVPR+RFLPVK ++DL++VMSNLY M+ G L MSP RSFPSVPLVKLG  F++VKDF++RF++IPD++ELDHLTV+GDV FG++V L+GTVIIIANHG++IDIP GAIL+NKIVSGNLRILDH
Sbjct:   34 FVKGHKRSPSD--IEFRDAMRKDAQSAMNKELYKLLMTTAPGLQDRTRKEFEGFETLFARFLRETGPSVEWDKLKLLSPELIRKYNDLKTPEPKDVKNLLDKLVVIKLNGGLGTSMGCTGPKSAIQVRNELTFLDLNVQQIEYLNKSHGVDVPLVLMNSFNTDDDTQKILRKYSQIKVSIVTFNQSRFPRINRDTLMPVPRSF-------------TEESIEGWYPPGHGDVYSSLYNSGLLDKFINEGKKYVFISNIDNMGATVDLNILNFLLESQESSS-PEFVMEVTDKTRADIKGGTLVDYEGKLRLLEFAQVPADHVDEFKSVRKFKIFNTNNLWISLNAIKRNVEEETMHMEIIVNPKTLDNGMNVIQLETAAGAAIKSFDRAVGINVPRSRFLPVKTTSDLLIVMSNLYAMKTGALEMSPKRSFPSVPLVKLGNQFSKVKDFIHRFASIPDIIELDHLTVAGDVNFGKNVTLRGTVIIIANHGEKIDIPQGAILENKIVSGNLRILDH 532          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. TrEMBL
Match: K1Q1D1 (UTP--glucose-1-phosphate uridylyltransferase OS=Crassostrea gigas OX=29159 GN=CGI_10015638 PE=3 SV=1)

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 320/520 (61.54%), Postives = 400/520 (76.92%), Query Frame = 1
Query:   25 LVMLQFEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            L +  F + HRR+GSD  V+F E TR DA+  M+  L+ L+ T P    + I  E + F+ LF RYL ES   I WD I+L+ +  VK Y  L   D   +K  L++L+V+KLNGGLGTSMGC GPKS+ISVRNDLTFLDL VQQIE LN  Y  D+PL+LMNSFNT  DT ++L++Y+++ V I TF QS YPRI RES++PI          F +  ++S      WYPPGHGD+Y+S+ NS +LD+ +++GK++ F+SNIDN+GATVDL IL+FL++   K+  PEFVMEVTNKTRADVKGGTLV+Y+ KLRLLE+AQVPK+  +EF SV KF+IFNTNNLW  L +IK+ + ++TL ME+IVN KTLDNG N+VQLE A G+AIKSF  AIGINVPR RFLPVK ++DL++VMSNLY ++ G L M+P RSFPSVPLVKLG HF++VKD+L+RF++IPDMLELDHLTVSGDV FGR+V LKGTVIIIANHGDRIDIPSGA+L+NKIVSGNLRILDH
Sbjct:    6 LSLSAFVRGHRRAGSD--VQFIERTRLDAQKAMNKELQKLIQTGPPGLHERIRAEFDEFEKLFGRYLQESGHAIMWDKIRLVSDDLVKTYNELKAPDNKSIKTLLNQLVVVKLNGGLGTSMGCKGPKSIISVRNDLTFLDLTVQQIEHLNKTYGTDVPLVLMNSFNTDADTEKILQRYSQVKVKIFTFNQSRYPRISRESLLPIATS-------FNTENIES------WYPPGHGDVYQSIANSKLLDQFINDGKKYLFMSNIDNLGATVDLNILNFLLDPNTKQA-PEFVMEVTNKTRADVKGGTLVEYDGKLRLLEIAQVPKDHVDEFKSVSKFKIFNTNNLWISLDAIKRVVEDNTLHMEIIVNPKTLDNGVNVVQLETAVGAAIKSFEGAIGINVPRRRFLPVKTTSDLLIVMSNLYSLKTGALEMNPLRSFPSVPLVKLGSHFSKVKDYLHRFASIPDMLELDHLTVSGDVTFGRNVTLKGTVIIIANHGDRIDIPSGAVLENKIVSGNLRILDH 509          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. TrEMBL
Match: A0A0L8GQ95 (UTP--glucose-1-phosphate uridylyltransferase OS=Octopus bimaculoides OX=37653 GN=OCBIM_22029785mg PE=3 SV=1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 318/515 (61.75%), Postives = 389/515 (75.53%), Query Frame = 1
Query:   40 FEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            F K HRR+ SD  +EFKE+ RRDA+  M   L  L+ TAP  ++  ++ EL+ F+ILF RYL E+ T + W+ IK+L +  +K Y  +   +   +KN L+KL+V+KLNGGLGTSMGC GPKS ISVRNDLTFLD+ VQQIE LN  Y  D+PL+LMNSFNT EDT ++L KY ++ V I TF QS +PRI+RES++PI K +     D             +WYPPGHGDIY S   +G+L++ ++ G+E+ F+SNIDN+GATVDL IL+ L+        PEFVMEVT+KTRADVKGGTLV Y+ KLRLLE+AQVPKE  +EF SV KF+IFNTNNLW  L ++K+ I E TL ME+IVN KTLDNG N++QLE A+G+AIKSF  AIGINVPR RFLPVK ++DL+LVMSNLY MR G L MSP RSFPSVPLVKLG  F +VK+FL RF++IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+GA L+NKIVSGNLRILDH
Sbjct:    6 FVKGHRRTSSD--IEFKELIRRDAQLAMHKELTKLIQTAPPVQQPKVKNELDRFQILFERYLQEAGTSLNWEKIKVLPDDAIKNYNEIQRTELTNMKNMLNKLVVLKLNGGLGTSMGCQGPKSAISVRNDLTFLDMTVQQIEYLNKSYDADVPLVLMNSFNTDEDTEKILGKYNQIKVRIYTFNQSKFPRINRESLLPIPKCMATVGTD----------GTPSWYPPGHGDIYESFAAAGLLEEFIEAGREYVFVSNIDNLGATVDLHILNHLINPPMGGIAPEFVMEVTDKTRADVKGGTLVDYDGKLRLLEIAQVPKEHVDEFKSVSKFKIFNTNNLWIKLNALKRVIDERTLHMEIIVNPKTLDNGINVIQLETASGAAIKSFEGAIGINVPRKRFLPVKTTSDLLLVMSNLYKMRTGALEMSPQRSFPSVPLVKLGIQFQKVKEFLQRFASIPDMLELDHLTVSGDVTFGKSVSLKGTVIIIANHGDRIDIPTGACLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. TrEMBL
Match: A0A3S1CCR4 (UTP--glucose-1-phosphate uridylyltransferase OS=Elysia chlorotica OX=188477 GN=EGW08_003080 PE=3 SV=1)

HSP 1 Score: 638.647 bits (1646), Expect = 0.000e+0
Identity = 313/515 (60.78%), Postives = 395/515 (76.70%), Query Frame = 1
Query:   40 FEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            F K HRR+ SD  +EF++  R+DA++ M+  L  L+ TAPA  +     E +GF++LF R+L E+ +   WD + LL +  +K Y +L        K+ L++L+VIKLNGGLGTSMGCTGPKS I VRN+LTFLDLNVQQIE LN  Y  D+PL+LMNSFNT EDT ++LRKY+ + V+I TF QS YPR++R++++PI K                E   + WYPPGHGD+Y S  NSG+LD+ + +GK++ FISNIDNMGATVDL IL+FLV S + +  PEF+MEVT+KTRADVKGGTLV+ E KLRLLE AQVP ++ +EF SV KF+IFNTNNLW  L++IK++I E TL ME+IVN KTLDNG N++QLE A G+AIKSF+ A+GINVPR RFLPVK ++DL++VMSNLY MR G L MSP RSFPSVPLVKLG  F++VKDFL RF++IPD+LELDHLTVSGDV FG++V L+GTVIIIANHG++IDIP G+IL+NKIVSGNLRILDH
Sbjct:   16 FVKGHRRTPSD--IEFRDAMRKDAQSAMNKELNKLLATAPAGIQQKARTEFDGFEMLFGRFLHETGSSADWDKLTLLPDDAIKRYNSLETPAATDFKSLLNQLVVIKLNGGLGTSMGCTGPKSAIQVRNELTFLDLNVQQIENLNKAYDVDVPLVLMNSFNTDEDTQKILRKYSHIKVSIFTFNQSRYPRVNRDTLMPIPKSF-------------GEESIEGWYPPGHGDVYNSFFNSGLLDQFIRQGKKYVFISNIDNMGATVDLNILNFLVNSPESQA-PEFLMEVTDKTRADVKGGTLVEQEGKLRLLEYAQVPSDKVDEFKSVSKFKIFNTNNLWISLQAIKRNIEEKTLHMEIIVNPKTLDNGMNVIQLETAVGAAIKSFDKAVGINVPRRRFLPVKTTSDLLIVMSNLYAMRTGALEMSPKRSFPSVPLVKLGHQFSKVKDFLQRFASIPDILELDHLTVSGDVNFGKNVSLRGTVIIIANHGEKIDIPMGSILENKIVSGNLRILDH 514          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Cavefish
Match: ugp2b (UTP--glucose-1-phosphate uridylyltransferase [Source:NCBI gene;Acc:103033287])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 295/503 (58.65%), Postives = 371/503 (73.76%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDY-HVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
             +F+E+ R+  E+ M   LE LV TA A   +  +++ EGFK L+ R+L      ++W  I    E  ++PYE + E      V + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KYA   V I TF QS YPRI++ES++P+ K + M +G+            D WYPPGHGDIY S  NSG+L++ + EGKE+ F+SNIDN+GATVDL IL+ LV S       EFVMEVT+KTRADVKGGTL++YE KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KTL+ G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MS  R FP+ P VKLG  F +V+++L RF +IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   18 AQFQEVMRQQLESSMLVELEKLVGTAKAGDAEICKKDFEGFKKLYHRFLQVKGPSVEWPKINRPPEDSIQPYEKIHERGLPENVADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTRKILQKYAHHRVKIHTFNQSRYPRINKESLLPVAKDMGM-VGE----------SADGWYPPGHGDIYASFYNSGLLEQLIAEGKEYIFVSNIDNLGATVDLHILNHLV-SQPNGKRCEFVMEVTDKTRADVKGGTLIQYEGKLRLLEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLAAIKRLQEQNAMDMEIIVNPKTLNGGLNVIQLETAVGAAIKCFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSLEAGSLTMSEKREFPTTPHVKLGSSFTKVQEYLTRFESIPDMLELDHLTVSGDVTFGKQVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Cavefish
Match: ugp2a (UDP-glucose pyrophosphorylase 2a [Source:ZFIN;Acc:ZDB-GENE-090311-46])

HSP 1 Score: 566.614 bits (1459), Expect = 0.000e+0
Identity = 292/515 (56.70%), Postives = 363/515 (70.49%), Query Frame = 1
Query:   58 RSGSDFAV-EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYEN-----LPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            R+G +  + EF+E  R+  E  M   LE L+ T      +   ++ EGFK LF R+L      + W  I    E  ++PYE      LPE     V + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+   + +                      G  +IY S  NSG+L+K L EGKE+ F+SNIDN+GATVDL IL+ L+ S   +   EFVMEVT+KTRADVKGGTL++Y++KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   +++L +E+IVN KTLD G N++QLE A G+AIKSF+NA+GINVPR+RFLPVK S+DL+LVMSNLY +  G L MS  R FP+ P VKLG  F +V+DFL RF +IPDMLELDHLTVSGDV FG+ V LKGTVIIIANHGDRIDIP+GA+L+NKIVSGNLRILDH
Sbjct:   10 RAGPNAVMTEFQEKLRQQHENSMHKELEKLLSTTSGAEAECSRKDFEGFKQLFHRFLQVKGPSVDWAKINRPPEDSIQPYERIRAKALPE----AVASGLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNADVPLVLMNSFNTDEDTKKILQKYTHHRVKIHTFNQSRYPRINKESLLPVATNMSLT---------------------GENNIYASFYNSGLLEKLLSEGKEYIFVSNIDNLGATVDLHILNHLM-SQPADRRCEFVMEVTDKTRADVKGGTLIQYDNKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLPAIKRLQQQNSLDLEIIVNPKTLDGGLNVIQLETAVGAAIKSFDNALGINVPRSRFLPVKTSSDLLLVMSNLYSLEAGSLTMSAKREFPTTPHVKLGSSFTKVQDFLRRFESIPDMLELDHLTVSGDVTFGKQVTLKGTVIIIANHGDRIDIPAGAMLENKIVSGNLRILDH 498          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Cavefish
Match: uap1 (UDP-N-acetylglucosamine pyrophosphorylase 1 [Source:NCBI gene;Acc:103036709])

HSP 1 Score: 70.8626 bits (172), Expect = 1.738e-12
Identity = 87/360 (24.17%), Postives = 155/360 (43.06%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKI----LFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI--DYHVVKNY---------LDKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLDLNVQQIEAL------NTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIET---FEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATV-DLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSI 1077
            ++   +T+R AEA  S  L+     +P  + D +  +LE         F     +++TQ K DN+     +E  P E L  +  D   +K++          +K+ V+ L GG GT +G   PK +  + + +  T   +  ++I  L      N K KC IP  +M S  T + T +   K+    +  E    F+Q M P +     I +  K ++                 A  P G+G +YRSL  + I++     G  + ++  +DN+   V D   + F V   K  +    V+E TN T A    G + K + + +++E +++     E+ +S  +  +FN +N+  H  S+
Sbjct:    1 MDISRLTQRLAEAGQSHLLQFWDQLSPEEQADLVS-DLENMDFKEINCFFTNAMKTSTQTKQDNVDT--RMEPVPREILGSVTRDRESLKDWEEEGLHCISQNKVAVLLLAGGQGTRLGVPYPKGMYDVGLPSHKTLFQIQAERILKLEQLAENNHKTKCCIPWYIMTSGRTMDSTKEFFAKHKYFGLKEENIIFFQQGMLPAMDFNGKIILEDKGKL-----------------AMAPDGNGGLYRSLAANKIVEDMERRGISYIYVYCVDNILVKVADPAFIGFCVR--KGADCGAKVVEKTNPTEAV---GVVCKVDGRYQVVEYSEITLSTAEKRSSDGRL-LFNASNVANHFFSL 334          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Cavefish
Match: uap1 (UDP-N-acetylglucosamine pyrophosphorylase 1 [Source:NCBI gene;Acc:103036709])

HSP 1 Score: 70.4774 bits (171), Expect = 2.120e-12
Identity = 87/360 (24.17%), Postives = 155/360 (43.06%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKI----LFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEI--DYHVVKNY---------LDKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLDLNVQQIEAL------NTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIET---FEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATV-DLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSI 1077
            ++   +T+R AEA  S  L+     +P  + D +  +LE         F     +++TQ K DN+     +E  P E L  +  D   +K++          +K+ V+ L GG GT +G   PK +  + + +  T   +  ++I  L      N K KC IP  +M S  T + T +   K+    +  E    F+Q M P +     I +  K ++                 A  P G+G +YRSL  + I++     G  + ++  +DN+   V D   + F V   K  +    V+E TN T A    G + K + + +++E +++     E+ +S  +  +FN +N+  H  S+
Sbjct:    1 MDISRLTQRLAEAGQSHLLQFWDQLSPEEQADLVS-DLENMDFKEINCFFTNAMKTSTQTKQDNVDT--RMEPVPREILGSVTRDRESLKDWEEEGLHCISQNKVAVLLLAGGQGTRLGVPYPKGMYDVGLPSHKTLFQIQAERILKLEQLAENNHKTKCCIPWYIMTSGRTMDSTKEFFAKHKYFGLKEENIIFFQQGMLPAMDFNGKIILEDKGKL-----------------AMAPDGNGGLYRSLAANKIVEDMERRGISYIYVYCVDNILVKVADPAFIGFCVR--KGADCGAKVVEKTNPTEAV---GVVCKVDGRYQVVEYSEITLSTAEKRSSDGRL-LFNASNVANHFFSL 334          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Cavefish
Match: uap1l1 (UDP-N-acetylglucosamine pyrophosphorylase 1 like 1 [Source:NCBI gene;Acc:103046386])

HSP 1 Score: 56.9954 bits (136), Expect = 3.216e-8
Identity = 72/309 (23.30%), Postives = 129/309 (41.75%), Query Frame = 1
Query:  337 LDKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLDLN------VQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNV-------TIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDN-MGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAH------LKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSF 1197
            ++K+ V+ L GG GT +G   PK +  + + +  T   +       VQ++ +     KC +P  +M    T E TLQ   K+ K N         +  FEQ M P +  +  I + KK          NK+       A  P G+G +YR+L+++ IL+     G ++  +  +DN +    D   + F V  MK  +    V+E   K       G + + +   +++E ++V  E  E+     +  +++  N+  H      L+ + Q       Q   I     +D   NIV+  +  G  ++ F
Sbjct:  103 VNKVAVLLLAGGQGTRLGVPYPKGMYNVGLPSGKTLYQIQAERIQKVQELASEKNGSKCTVPWYIM----TSEFTLQPTEKFFKENSYFGLDPSNVVMFEQRMIPAVSFDGKIILEKK----------NKI-------AMAPDGNGGLYRALVDNKILEDMERRGVQYLHVYCVDNILVKMADPVFIGFCV--MKGADCGAKVVE---KAYPAEPVGVVCRVDGVYQVVEYSEVLPETAEQRHPGGEL-VYSAGNICNHFFTRGFLQEVAQKFQVQLKQHVAIKKVPFVDEEGNIVKPTKPNGIKMEKF 384          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003045.1 (pep scaffold:Pmarinus_7.0:GL481489:5146:17160:-1 gene:ENSPMAG00000002778.1 transcript:ENSPMAT00000003045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 526.554 bits (1355), Expect = 0.000e+0
Identity = 257/470 (54.68%), Postives = 346/470 (73.62%), Query Frame = 1
Query:  178 IERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHV-VKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            ++R++E FK++F+++L E+   + W+ I+ L E  V+PYE+L        V   L++L+V+KLNG  G+ MG  GP SL+ VR++ TFLDL ++QIE LN  Y CDIPL+LMNSF T E+ L++L+KY+   V I+TF QS YPR+H+E+++P              ++ + +   D WY PGHGD Y S   SG+LD  L +GKE  FISN+DN+GA+VDL IL  L+E +   +  EFVMEVT+KTRAD++GGTL+ YEDKLRLLE+AQVP    +EF SV KF+IFNTNNLW  L++ K+      + MEVI N + L NG +++QLE A G+A+K F+NA+GINVPR+RFLPVK++ADL+LV SNLY +R G + +S  R FP+VPLVKLG  F +V+DFL RF++IPD+LELDHLTVSG+V FG++VVLKGTVIIIANHGD+I IPSG+IL+NKI+SGNL +LDH
Sbjct:    1 MQRDMEDFKMVFQKFL-ENRPSLDWEKIQKLPEGAVEPYEDLRARALPSDVAALLNRLVVVKLNGASGSHMGFQGPHSLLGVRDESTFLDLAIEQIEHLNEAYDCDIPLVLMNSFLTNEEILKILQKYSHRRVKIKTFMQSRYPRVHKETLLPAASA--------DGDEEQLQARHDGWYLPGHGDFYESFHRSGLLDGFLQQGKEVMFISNMDNLGASVDLHILHHLLEPLAGRSRCEFVMEVTDKTRADMEGGTLIHYEDKLRLLEIAQVPSANIDEFRSVSKFKIFNTNNLWISLEACKRLQESGRIDMEVIANQRMLSNGLSVIQLERAVGAAMKCFDNALGINVPRSRFLPVKKTADLLLVQSNLYTLRGGAVRLSERREFPTVPLVKLGDEFTKVQDFLRRFASIPDILELDHLTVSGNVTFGKNVVLKGTVIIIANHGDKIAIPSGSILENKIISGNLSVLDH 461          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Yeast
Match: UGP1 (UDP-glucose pyrophosphorylase (UGPase); catalyses the reversible formation of UDP-Glc from glucose 1-phosphate and UTP, involved in a wide variety of metabolic pathways, expression modulated by Pho85p through Pho4p; involved in PKA-mediated oxidative stress resistance and long-term survival in stationary phase; UGP1 has a paralog, YHL012W, that arose from the whole genome duplication [Source:SGD;Acc:S000001518])

HSP 1 Score: 478.789 bits (1231), Expect = 3.541e-165
Identity = 252/520 (48.46%), Postives = 357/520 (68.65%), Query Frame = 1
Query:   46 KTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPA--PRRDHIERELEGFKILFRRYLDE--STTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTL---DNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            K H ++ S +A  F+  T   A ++M  AL  L  ++      R   E EL+ F  LFRRYL E  S T ++WD IK  +  EV  YE + +   +V  + L KL V+KLNGGLGTSMGC GPKS+I VR   TFLDL+V+QIE LN +Y  D+PL+LMNSFNT +DT  +++KY+   + I +F QS +PR++++S++P+  +   PL              DAWYPPGHGD++ SL  SG LD  + +G+E  F+SN DN+GATVDLKIL+ ++E+       E++ME+T+KTRADVKGGTL+ Y+ ++RLLE+AQVPKE  +EF ++RKF  FNTNNLW +LK++K+ I    L+ME+I N KT+    +  N++QLE A G+AI+ F+ A G+ VPR+RFLPVK  +DL+LV S+L+ +  G L + P+R  P+ PL+KLG HF +V  F  R  +IP ++ELDHLT++G+VF G+DV L+GTVII+ + G +IDIP+G+IL+N +V+GNL+IL+H
Sbjct:    4 KKHTKTHSTYA--FESNTNSVAASQMRNALNKLADSSKLDDAARAKFENELDSFFTLFRRYLVEKSSRTTLEWDKIKSPNPDEVVKYEIISQQPENV--SNLSKLAVLKLNGGLGTSMGCVGPKSVIEVREGNTFLDLSVRQIEYLNRQYDSDVPLLLMNSFNTDKDTEHLIKKYSANRIRIRSFNQSRFPRVYKDSLLPVPTEYDSPL--------------DAWYPPGHGDLFESLHVSGELDALIAQGREILFVSNGDNLGATVDLKILNHMIETGA-----EYIMELTDKTRADVKGGTLISYDGQVRLLEVAQVPKEHIDEFKNIRKFTNFNTNNLWINLKAVKRLIESSNLEMEIIPNQKTITRDGHEINVLQLETACGAAIRHFDGAHGVVVPRSRFLPVKTCSDLLLVKSDLFRLEHGSLKLDPSRFGPN-PLIKLGSHFKKVSGFNARIPHIPKIVELDHLTITGNVFLGKDVTLRGTVIIVCSDGHKIDIPNGSILENVVVTGNLQILEH 499          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Yeast
Match: YHL012W_mRNA (Putative UTP glucose-1-phosphate uridylyltransferase; YHL012W has a paralog, UGP1, that arose from the whole genome duplication [Source:SGD;Acc:S000001004])

HSP 1 Score: 228.409 bits (581), Expect = 1.973e-68
Identity = 163/488 (33.40%), Postives = 256/488 (52.46%), Query Frame = 1
Query:  121 MSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNY-------LDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRK-YAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTN---IVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVM-RKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDN 1548
            MS  +  L    P+ R  + E  L  F  +F+RY+ E+T+ I  D +   D++ +   + + E+D   +KNY       L KL ++KL G     +G   P  L  V+N ++ LD+ V+Q + LN +Y  D+PLI M S  T+      L + Y+   V  +T  QS +P+I ++ ++PI  ++             +  E+D WYP G G++  +L  SG LDK + +GKE  F+SN+DN+GAT DL IL+F++         E+++EV  +T      G L  Y+ KLR +    +  E      S    RI NTNN+W  LK +K  I  ++L + +  +   + +       +Q +      I  F N+  + V R+RFLP++   DL L+ S LY +   G   + P + F  +P + LG  F   + F     +IP++LEL+HLTV G+VFFGR++ LKGTVIII +  D I +P G+IL+N
Sbjct:   25 MSQMIRALQKHFPSIRDKNYEFSL--FLHIFQRYVLENTS-ITHDLV--CDKIRLPIIDEVVELDD--IKNYGLLEGKLLSKLAILKLTGKANPIIGKESP--LFEVKNGMSSLDVIVRQTQNLNVRYNSDVPLIFMTSLETESQVSNFLEEHYSSSKVRWKTVVQSSFPQIDKDRLLPIDLQI-------------NSHENDFWYPCGTGNLTDTLYFSGELDKLIAQGKEILFVSNVDNLGATGDLNILNFIINEK-----IEYLVEVVERTANVSNTGVLATYKGKLRSVYYNCLSNE------SASTCRIVNTNNIWIDLKKLKVLIESNSLNLPIHSSESKITHKNEEIECLQFKTQLVDCIAFFPNSRVLKVSRDRFLPLRTCKDLFLLKSTLYDLDSNGTFNLYPLK-FGLLPSIDLGDEFATYETFKIGVPDIPNILELEHLTVMGNVFFGRNITLKGTVIIICDENDVITVPDGSILEN 478          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Nematostella
Match: EDO48580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIW3])

HSP 1 Score: 594.734 bits (1532), Expect = 0.000e+0
Identity = 290/501 (57.88%), Postives = 374/501 (74.65%), Query Frame = 1
Query:   82 EFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            +FK ++R+DA  RM   +  L+  APAP++D   +E+  FK LF+RYL E+   + W+ I    +  V  Y+ +   +   +K  LDKL+VIKLNGGLGT+MG  GPKSLISV  +LTFLDLN+QQIE LN KY  ++PL+LMNSFNT E+T++ LRKY  +NV I  F QS +PRI  ES++P+                  +   ++WYPPGHGDIY S  NSG+L K +DEGKE+ F++NIDN+GATVDL IL++L+   +K    EFVMEVT+KTRADVKGGTL++Y+++LRLLE+AQVPK+  +EF SV KFRIFNTNNLW +LK++K+ + +  + ME+IVN KTLD+G  I+QLE A G+A+K+F  A+GINVPR RFLPVK+++DL+LV SNLY M  G L+MSP R FPSVPLV+LG  F +V DF +RF  IPD+LELDHLTVSGDV FG+ V+LKGTVIIIANHGDRIDIP+GAIL+NKIVSGNLRIL+H
Sbjct:   15 QFKSLSRKDAFERMETEINKLIEFAPAPQKDLASKEMNNFKGLFKRYLQETGPSVVWEKIHPPPKGLVVNYDEVSHAEPADIKAALDKLVVIKLNGGLGTTMGLVGPKSLISVTQELTFLDLNIQQIEHLNNKYGSNVPLVLMNSFNTHEETVKTLRKYGAVNVRIHCFNQSGHPRIATESLLPLASTY--------------DKNPNSWYPPGHGDIYESFYNSGLLQKFIDEGKEYMFVANIDNLGATVDLHILNYLLSESRKAPC-EFVMEVTDKTRADVKGGTLIEYDNRLRLLEIAQVPKQHVDEFKSVSKFRIFNTNNLWVNLKAVKRLVEKQAMDMEIIVNKKTLDDGVRIIQLETAVGAAMKNFEGAVGINVPRRRFLPVKKTSDLLLVKSNLYHMSHGVLIMSPLRQFPSVPLVQLGSFFKKVNDFRDRFETIPDLLELDHLTVSGDVTFGKGVILKGTVIIIANHGDRIDIPAGAILENKIVSGNLRILEH 500          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Nematostella
Match: EDO47862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RL26])

HSP 1 Score: 53.9138 bits (128), Expect = 1.246e-7
Identity = 61/258 (23.64%), Postives = 106/258 (41.09%), Query Frame = 1
Query:  343 KLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLDLN------VQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIE---TFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDN-MGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIK 1080
            K+ V+ L GG GT +G + PK +  + + +  T   L       V+++ A  +  KC +P  LM S +T+E T +         +  E    FEQ+  P +  E  I +  K ++                 A  P G+G +Y +LL   IL+     G E+  +  +DN +    D   + F +   K  +    V+E T  T A    G +   + K  ++E +++     E+  +  K   F   N+  H  + K
Sbjct:  101 KVAVLLLAGGQGTRLGVSYPKGMYNVGLPSGKTLYQLQAERIRKVEELAAKKSGKKCIVPWYLMTSEHTKESTSKFFSDNDYFGLDKENFVVFEQNTIPCMSFEGKIILADKGKL-----------------ARAPDGNGGLYAALLTHKILEDMEKRGVEYIHVYGVDNILVKMADPVFIGFCI--GKGADCGAKVVEKTIPTEAV---GVVCLCDGKYEVVEYSEISNNAAEKRDADGKL-TFRAGNIANHFFTFK 335          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Medaka
Match: ugp2b (UTP--glucose-1-phosphate uridylyltransferase [Source:NCBI gene;Acc:101168232])

HSP 1 Score: 583.178 bits (1502), Expect = 0.000e+0
Identity = 293/519 (56.45%), Postives = 370/519 (71.29%), Query Frame = 1
Query:   43 EKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E  HR        +F+E+ R+  E  M A L+ L+ TA    ++  ++  EGF  LF+R+L      ++W  I+   E  ++PY+      LP+     V + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+   + M           S    +AWYPPGHGDIY S  NSG+LD+ + +GKE+ F+SNIDN+GATVDL IL  LV S       EFVMEVT+KTRADVKGGTL+ Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   +  + ME+IVN KTLD G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MSP R FP+ P VKLG  F +V+++L R  +IPD+LELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   34 ESAHRG-----MAQFQEIMRQQLEGSMQAELQKLLGTASGSEKEVAKKNFEGFTNLFQRFLQVKGPSVEWVKIQRPPEDSIQPYDKIAARGLPD----SVADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYTHHRVRIHTFNQSRYPRINKESLLPVATSLSM-----------SGQNAEAWYPPGHGDIYASFYNSGLLDQLIAQGKEYIFVSNIDNLGATVDLHILHHLV-SQPNGKRCEFVMEVTDKTRADVKGGTLITYDGKLRLLEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLPAIKRLQEKTAMDMEIIVNPKTLDGGQNVIQLETAVGAAIKCFDNAMGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSPKREFPTTPHVKLGSSFTKVQEYLTRLESIPDILELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 531          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Medaka
Match: ugp2b (UTP--glucose-1-phosphate uridylyltransferase [Source:NCBI gene;Acc:101168232])

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 290/507 (57.20%), Postives = 367/507 (72.39%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
             +F+E+ R+  E  M A L+ L+ TA    ++  ++  EGF  LF+R+L      ++W  I+   E  ++PY+      LP+     V + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+   + M           S    +AWYPPGHGDIY S  NSG+LD+ + +GKE+ F+SNIDN+GATVDL IL  LV S       EFVMEVT+KTRADVKGGTL+ Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   +  + ME+IVN KTLD G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MSP R FP+ P VKLG  F +V+++L R  +IPD+LELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:    2 AQFQEIMRQQLEGSMQAELQKLLGTASGSEKEVAKKNFEGFTNLFQRFLQVKGPSVEWVKIQRPPEDSIQPYDKIAARGLPD----SVADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYTHHRVRIHTFNQSRYPRINKESLLPVATSLSM-----------SGQNAEAWYPPGHGDIYASFYNSGLLDQLIAQGKEYIFVSNIDNLGATVDLHILHHLV-SQPNGKRCEFVMEVTDKTRADVKGGTLITYDGKLRLLEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLPAIKRLQEKTAMDMEIIVNPKTLDGGQNVIQLETAVGAAIKCFDNAMGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSPKREFPTTPHVKLGSSFTKVQEYLTRLESIPDILELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 492          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Medaka
Match: ugp2b (UTP--glucose-1-phosphate uridylyltransferase [Source:NCBI gene;Acc:101168232])

HSP 1 Score: 582.408 bits (1500), Expect = 0.000e+0
Identity = 293/519 (56.45%), Postives = 370/519 (71.29%), Query Frame = 1
Query:   43 EKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E  HR        +F+E+ R+  E  M A L+ L+ TA    ++  ++  EGF  LF+R+L      ++W  I+   E  ++PY+      LP+     V + L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  Y  D+PL+LMNSFNT EDT ++L+KY    V I TF QS YPRI++ES++P+   + M           S    +AWYPPGHGDIY S  NSG+LD+ + +GKE+ F+SNIDN+GATVDL IL  LV S       EFVMEVT+KTRADVKGGTL+ Y+ KLRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   +  + ME+IVN KTLD G N++QLE A G+AIK F+NA+GINVPR+RFLPVK ++DL+LVMSNLY +  G L MSP R FP+ P VKLG  F +V+++L R  +IPD+LELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP+G++L+NKIVSGNLRILDH
Sbjct:   11 ESAHRG-----MAQFQEIMRQQLEGSMQAELQKLLGTASGSEKEVAKKNFEGFTNLFQRFLQVKGPSVEWVKIQRPPEDSIQPYDKIAARGLPD----SVADSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYTHHRVRIHTFNQSRYPRINKESLLPVATSLSM-----------SGQNAEAWYPPGHGDIYASFYNSGLLDQLIAQGKEYIFVSNIDNLGATVDLHILHHLV-SQPNGKRCEFVMEVTDKTRADVKGGTLITYDGKLRLLEIAQVPKAHVDEFKSVSKFKIFNTNNLWISLPAIKRLQEKTAMDMEIIVNPKTLDGGQNVIQLETAVGAAIKCFDNAMGINVPRSRFLPVKTTSDLLLVMSNLYSLDAGSLTMSPKREFPTTPHVKLGSSFTKVQEYLTRLESIPDILELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPAGSMLENKIVSGNLRILDH 508          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Medaka
Match: ugp2a (UTP--glucose-1-phosphate uridylyltransferase [Source:NCBI gene;Acc:101169415])

HSP 1 Score: 580.096 bits (1494), Expect = 0.000e+0
Identity = 296/507 (58.38%), Postives = 367/507 (72.39%), Query Frame = 1
Query:   79 VEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYE-----NLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
             EF+E  R+  E  M   LE L+ TA     +   ++ +GFK LF R+L      + W  I    E  ++PY+      LP+     +   L+KL+V+KLNGGLGTSMGC GPKSLISVRN+ TFLDL VQQIE LN  +  D+PL+LMNSFNT EDT ++L+KY+   V I TF QS YPRI++ES++PI K + +       N   +E    AWYPPGHGDIY S  NSG+LDK L EG+E+ F+SNIDN+GATVDL IL  L+ S+  +   EF+MEVT+KTRADVKGGTL++YED LRLLE+AQVPK   +EF SV KF+IFNTNNLW  L +IK+   ++ + ME+IVN KTLD G N++QLE A G+AIKSF NA+G+NVPR+RFLPVK S+DL+LVMSNLY +  G L MS  R F + P VKLG  F +V++FL RF NIPDMLELDHLTVSGDV FG++V LKGTVIIIANHGDRIDIP+GA+L+NKIVSGNLRILDH
Sbjct:   14 TEFQEKLRQQHEESMHRELEALLATANKEEAEISRKDFDGFKKLFHRFLQVKGPSVNWAKINRPPEDSIQPYDRIKAKGLPDD----ITTSLNKLVVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKTFNTDVPLVLMNSFNTDEDTKKILQKYSHHRVNIHTFNQSRYPRINKESLLPIAKGMGL-------NGANTE----AWYPPGHGDIYASFHNSGLLDKLLAEGREYIFVSNIDNLGATVDLFILHHLM-SLPADRRCEFIMEVTDKTRADVKGGTLIQYEDHLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLPAIKRLQEKNAMDMEIIVNPKTLDGGLNVIQLETAVGAAIKSFKNAMGVNVPRSRFLPVKTSSDLLLVMSNLYSLDAGSLTMSKKREFLTTPHVKLGSSFTKVQEFLKRFENIPDMLELDHLTVSGDVTFGKNVSLKGTVIIIANHGDRIDIPAGAVLENKIVSGNLRILDH 504          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Medaka
Match: uap1 (UDP-N-acetylglucosamine pyrophosphorylase 1 [Source:NCBI gene;Acc:101158685])

HSP 1 Score: 63.1586 bits (152), Expect = 4.747e-10
Identity = 67/268 (25.00%), Postives = 115/268 (42.91%), Query Frame = 1
Query:  340 DKLIVIKLNGGLGTSMGCTGPKSL--ISVRNDLTFLD------LNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRK--YAKLNVT-IETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATV-DLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQ 1107
            +K+  + L GG GT +G + PK +  + + +  T         L +QQ+       KC IP  +M S  T E T     +  Y  L  T +  F+Q M P +  +  I +  K ++ +                  P G+G +YR+L N GIL+     G ++  +  +DN+   V D   + F V+  K  +    V+E TN T A    G + K +   +++E +++     E+  +  +  +FN  N+  H  S     L D +Q
Sbjct:  102 NKVAALLLAGGQGTRLGVSYPKGMYDVGLPSHKTLFQIQAERILKLQQLAEQRHNIKCCIPWYIMTSGRTMEMTKDFFSRHNYFGLEKTDVIFFQQGMLPAMDYKGKIILESKGKLSMA-----------------PDGNGGLYRALGNQGILNDMQQRGIQFIHVYCVDNILVKVADPAFVGFCVQ--KGADCGAKVVEKTNPTEAV---GVVCKVDGLYQVVEYSEITLATAEKRGADGRL-MFNAGNVANHFFSF--PFLRDVVQ 344          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Planmine SMEST
Match: SMESG000043519.1 (SMESG000043519.1)

HSP 1 Score: 1065.83 bits (2755), Expect = 0.000e+0
Identity = 518/518 (100.00%), Postives = 518/518 (100.00%), Query Frame = 1
Query:   31 MLQFEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            MLQFEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH
Sbjct:    1 MLQFEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 518          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Planmine SMEST
Match: SMESG000057826.1 (SMESG000057826.1)

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 380/529 (71.83%), Postives = 459/529 (86.77%), Query Frame = 1
Query:    1 FQYFQFE*LVMLQFEKTHRRSGS-DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            FQY +     ++Q ++T +R  S D A EFKE TRRDAE RM  AL+NL+  A   RR+H+++E  GF++LF+RYL+E++T+IKWDNIKLL++ EVKPY NLPE D   ++ YL +++VIKLNGGLGTSMGCTGPKSLISVR+DLTFLDL +QQ+E LN KY CDIPLILMNSFNTQ+DT++V+RKY  +NVTIETFEQSMYPRIHRES+ PITK V +   D  +   K + ED+AWYPPGHGD+YRS LNSG+LDK++D+GK++AFISNIDNMGAT+DLKILSFL++SMK +  PEFVMEVT+KTRADVKGGTL+KY++KLRLLEMAQVPK+R +EFTSVRKFRIFNTNNLW  L ++K++++E+TL M+VIVN KTLDNGTNI+QLEEA+GSAIKSFNNAIGINVPRNRFLPVKQ ADL+LVMSNLY + KGCL+MSP RSFPSVPL+KLG  F +VKD L+RFS+IP+MLELDHLTVSGDV FG++VVLKGTVIIIANHG++IDIPSG+ILDNKIVSGNLRILDH
Sbjct:    5 FQYSE-----IMQSQQTFKRKSSIDVANEFKETTRRDAEVRMKIALKNLISNAKMERRNHLQKEFHGFEVLFKRYLEEASTEIKWDNIKLLNDNEVKPYTNLPEADLEAIQTYLKEIVVIKLNGGLGTSMGCTGPKSLISVRSDLTFLDLTIQQVETLNNKYDCDIPLILMNSFNTQQDTMEVIRKYNNVNVTIETFEQSMYPRIHRESLQPITKLVHLDSNDDHNIHTK-DSEDEAWYPPGHGDVYRSFLNSGLLDKYIDQGKKFAFISNIDNMGATIDLKILSFLIDSMKTDKCPEFVMEVTDKTRADVKGGTLIKYDNKLRLLEMAQVPKDRIDEFTSVRKFRIFNTNNLWVSLSAVKRAVIEETLHMDVIVNPKTLDNGTNIIQLEEASGSAIKSFNNAIGINVPRNRFLPVKQCADLLLVMSNLYELSKGCLVMSPKRSFPSVPLIKLGTQFKKVKDCLSRFSSIPNMLELDHLTVSGDVSFGKNVVLKGTVIIIANHGEKIDIPSGSILDNKIVSGNLRILDH 527          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Planmine SMEST
Match: SMESG000057826.1 (SMESG000057826.1)

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 377/518 (72.78%), Postives = 454/518 (87.64%), Query Frame = 1
Query:   34 LQFEKTHRRSGS-DFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            +Q ++T +R  S D A EFKE TRRDAE RM  AL+NL+  A   RR+H+++E  GF++LF+RYL+E++T+IKWDNIKLL++ EVKPY NLPE D   ++ YL +++VIKLNGGLGTSMGCTGPKSLISVR+DLTFLDL +QQ+E LN KY CDIPLILMNSFNTQ+DT++V+RKY  +NVTIETFEQSMYPRIHRES+ PITK V +   D  +   K + ED+AWYPPGHGD+YRS LNSG+LDK++D+GK++AFISNIDNMGAT+DLKILSFL++SMK +  PEFVMEVT+KTRADVKGGTL+KY++KLRLLEMAQVPK+R +EFTSVRKFRIFNTNNLW  L ++K++++E+TL M+VIVN KTLDNGTNI+QLEEA+GSAIKSFNNAIGINVPRNRFLPVKQ ADL+LVMSNLY + KGCL+MSP RSFPSVPL+KLG  F +VKD L+RFS+IP+MLELDHLTVSGDV FG++VVLKGTVIIIANHG++IDIPSG+ILDNKIVSGNLRILDH
Sbjct:    1 MQSQQTFKRKSSIDVANEFKETTRRDAEVRMKIALKNLISNAKMERRNHLQKEFHGFEVLFKRYLEEASTEIKWDNIKLLNDNEVKPYTNLPEADLEAIQTYLKEIVVIKLNGGLGTSMGCTGPKSLISVRSDLTFLDLTIQQVETLNNKYDCDIPLILMNSFNTQQDTMEVIRKYNNVNVTIETFEQSMYPRIHRESLQPITKLVHLDSNDDHNIHTK-DSEDEAWYPPGHGDVYRSFLNSGLLDKYIDQGKKFAFISNIDNMGATIDLKILSFLIDSMKTDKCPEFVMEVTDKTRADVKGGTLIKYDNKLRLLEMAQVPKDRIDEFTSVRKFRIFNTNNLWVSLSAVKRAVIEETLHMDVIVNPKTLDNGTNIIQLEEASGSAIKSFNNAIGINVPRNRFLPVKQCADLLLVMSNLYELSKGCLVMSPKRSFPSVPLIKLGTQFKKVKDCLSRFSSIPNMLELDHLTVSGDVSFGKNVVLKGTVIIIANHGEKIDIPSGSILDNKIVSGNLRILDH 517          
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Planmine SMEST
Match: SMESG000028844.1 (SMESG000028844.1)

HSP 1 Score: 544.273 bits (1401), Expect = 0.000e+0
Identity = 270/499 (54.11%), Postives = 361/499 (72.34%), Query Frame = 1
Query:   91 EMTRRDAEARMSAALENLVL-TAPAPRRDHIERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVKNYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTKYKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMIPITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLDEGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADVKGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIKQSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRNRFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVKDFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPSGAILDNKIVSGNLRILDH 1584
            E T+ D    +   LE ++  T P   ++   +E + F  +F+ + + +T  IKWD I L+ + E+K  +++ + D + V   L KL+V+KLNGGLGTSMGC GPKS+I +R+D TFLDL+V+QIE LN  Y  DIPL+LMNSFNT+EDT +V+ +Y K+NV I  F Q  +PRI +++++PIT                    ++AWYPPGHGD+Y S  +SG+LD  +  GK W F+SNIDN+GATVDL IL  L ES +     +F+MEVT KTRADVKGGTL+K  +KL LLE AQVPK+++EEFTS++KF IFNTNNLW +L  IK+ ++++ ++ME+IVN KTLDNG  ++QLE+AAG+AIKSF+NA+G+ VPR+RFLPVK ++DL+LVMSNLY++  G L +SP R FP +PL+KLGP F  VK FL RF   PD+LELDHLTV GDV FG ++ L+GTVIIIA  GD IDIP+GAIL+NKI++GNL ILDH
Sbjct:   22 ETTQIDPCDALKQELEQMIFKTVPEDLQEKHLKENDDFLKIFKDFRENATKPIKWDEITLVPDNEIKDIQDIAKFDINEVNIILKKLVVLKLNGGLGTSMGCIGPKSVIQIRDDSTFLDLSVKQIEKLNNHYNVDIPLVLMNSFNTEEDTKKVVNRYKKVNVKIYMFSQKKFPRIMKDTLMPITNSYY-------------PFNNEAWYPPGHGDMYSSFESSGLLDLFIQNGKSWLFVSNIDNLGATVDLSILKEL-ESYQS---CDFLMEVTRKTRADVKGGTLIKINNKLTLLEYAQVPKDKREEFTSIQKFNIFNTNNLWLNLDKIKKLVVQNKIKMEIIVNPKTLDNGKTVIQLEQAAGAAIKSFDNALGLRVPRSRFLPVKTTSDLLLVMSNLYLLYDGELKLSPFRKFPELPLIKLGPQFKSVKHFLTRFPKFPDLLELDHLTVFGDVKFGNEIALRGTVIIIAQEGDHIDIPAGAILENKIITGNLHILDH 503          
The following BLAST results are available for this feature:
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UGP20.000e+057.42UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbo... [more]
UGP20.000e+058.24UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbo... [more]
UGP20.000e+058.24UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbo... [more]
UGP20.000e+058.24UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbo... [more]
UGP20.000e+058.24UDP-glucose pyrophosphorylase 2 [Source:HGNC Symbo... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K08E3.50.000e+057.77UTP--glucose-1-phosphate uridylyltransferase [Sou... [more]
K08E3.50.000e+057.77UTP--glucose-1-phosphate uridylyltransferase [Sou... [more]
K08E3.50.000e+057.77UTP--glucose-1-phosphate uridylyltransferase [Sou... [more]
K08E3.50.000e+057.77UTP--glucose-1-phosphate uridylyltransferase [Sou... [more]
K08E3.50.000e+057.77UTP--glucose-1-phosphate uridylyltransferase [Sou... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
UGP0.000e+058.17gene:FBgn0035978 transcript:FBtr0301698[more]
UGP0.000e+058.17gene:FBgn0035978 transcript:FBtr0301699[more]
UGP0.000e+058.14gene:FBgn0035978 transcript:FBtr0076500[more]
UGP0.000e+058.14gene:FBgn0035978 transcript:FBtr0076501[more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ugp2a0.000e+058.59UDP-glucose pyrophosphorylase 2a [Source:ZFIN;Acc:... [more]
ugp2b0.000e+056.34UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:... [more]
ugp2b0.000e+056.34UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:... [more]
ugp2b0.000e+056.34UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:... [more]
ugp2b0.000e+056.34UDP-glucose pyrophosphorylase 2b [Source:ZFIN;Acc:... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ugp20.000e+056.79UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;... [more]
ugp20.000e+057.99UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;... [more]
ugp20.000e+057.79UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;... [more]
ugp20.000e+057.99UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;... [more]
ugp20.000e+057.99UDP-glucose pyrophosphorylase 2 [Source:NCBI gene;... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ugp20.000e+058.04UDP-glucose pyrophosphorylase 2 [Source:MGI Symbol... [more]
Ugp20.000e+058.04UDP-glucose pyrophosphorylase 2 [Source:MGI Symbol... [more]
Uap13.253e-823.26UDP-N-acetylglucosamine pyrophosphorylase 1 [Sourc... [more]
Uap13.513e-823.26UDP-N-acetylglucosamine pyrophosphorylase 1 [Sourc... [more]
Uap13.664e-823.26UDP-N-acetylglucosamine pyrophosphorylase 1 [Sourc... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q07130|UGPA_BOVIN0.000e+058.43UTP--glucose-1-phosphate uridylyltransferase OS=Bo... [more]
sp|Q16851|UGPA_HUMAN0.000e+058.24UTP--glucose-1-phosphate uridylyltransferase OS=Ho... [more]
sp|O35156|UGPA_CRIGR0.000e+057.84UTP--glucose-1-phosphate uridylyltransferase OS=Cr... [more]
sp|Q91ZJ5|UGPA_MOUSE0.000e+058.04UTP--glucose-1-phosphate uridylyltransferase OS=Mu... [more]
sp|P79303|UGPA_PIG0.000e+057.65UTP--glucose-1-phosphate uridylyltransferase OS=Su... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0B7AN080.000e+060.78UTP--glucose-1-phosphate uridylyltransferase OS=Ar... [more]
A0A0B7ANL70.000e+060.78Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
K1Q1D10.000e+061.54UTP--glucose-1-phosphate uridylyltransferase OS=Cr... [more]
A0A0L8GQ950.000e+061.75UTP--glucose-1-phosphate uridylyltransferase OS=Oc... [more]
A0A3S1CCR40.000e+060.78UTP--glucose-1-phosphate uridylyltransferase OS=El... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ugp2b0.000e+058.65UTP--glucose-1-phosphate uridylyltransferase [Sour... [more]
ugp2a0.000e+056.70UDP-glucose pyrophosphorylase 2a [Source:ZFIN;Acc:... [more]
uap11.738e-1224.17UDP-N-acetylglucosamine pyrophosphorylase 1 [Sourc... [more]
uap12.120e-1224.17UDP-N-acetylglucosamine pyrophosphorylase 1 [Sourc... [more]
uap1l13.216e-823.30UDP-N-acetylglucosamine pyrophosphorylase 1 like 1... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000003045.10.000e+054.68pep scaffold:Pmarinus_7.0:GL481489:5146:17160:-1 g... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
UGP13.541e-16548.46UDP-glucose pyrophosphorylase (UGPase); catalyses ... [more]
YHL012W_mRNA1.973e-6833.40Putative UTP glucose-1-phosphate uridylyltransfera... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO485800.000e+057.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO478621.246e-723.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ugp2b0.000e+056.45UTP--glucose-1-phosphate uridylyltransferase [Sour... [more]
ugp2b0.000e+057.20UTP--glucose-1-phosphate uridylyltransferase [Sour... [more]
ugp2b0.000e+056.45UTP--glucose-1-phosphate uridylyltransferase [Sour... [more]
ugp2a0.000e+058.38UTP--glucose-1-phosphate uridylyltransferase [Sour... [more]
uap14.747e-1025.00UDP-N-acetylglucosamine pyrophosphorylase 1 [Sourc... [more]
back to top
BLAST of UTP--glucose-1-phosphate uridylyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000043519.10.000e+0100.00SMESG000043519.1[more]
SMESG000057826.10.000e+071.83SMESG000057826.1[more]
SMESG000057826.10.000e+072.78SMESG000057826.1[more]
SMESG000028844.10.000e+054.11SMESG000028844.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026043 ID=SMED30026043|Name=UTP--glucose-1-phosphate uridylyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1782bp
TTTCAGTATTTTCAATTTGAATAACTCGTTATGCTTCAATTTGAAAAAAC
TCATAGGAGATCTGGAAGTGATTTTGCAGTCGAGTTCAAGGAAATGACTC
GACGAGATGCCGAAGCTAGAATGAGTGCAGCTTTGGAAAATCTCGTTTTA
ACCGCTCCAGCACCCAGAAGAGACCATATTGAAAGAGAATTGGAAGGTTT
TAAAATTTTATTTAGGCGTTACTTAGACGAATCAACAACTCAAATTAAAT
GGGATAACATTAAGCTTCTCGATGAAGTGGAAGTAAAACCATATGAAAAT
CTGCCTGAAATTGATTATCACGTGGTTAAAAACTACCTGGACAAATTAAT
TGTGATTAAACTAAATGGTGGCTTGGGAACTAGCATGGGATGTACTGGTC
CCAAATCTCTGATTTCTGTGAGAAATGATTTAACTTTTCTTGATTTAAAT
GTTCAACAAATCGAAGCGCTTAATACAAAATATAAATGCGATATTCCTTT
AATTTTAATGAATTCTTTTAATACACAAGAAGATACACTGCAAGTATTGA
GAAAATATGCTAAATTAAATGTTACAATTGAAACTTTTGAACAAAGCATG
TATCCTCGCATCCATCGCGAATCCATGATACCTATCACTAAAAAAGTGCG
AATGCCGTTAGGAGATTTTCGAAGCAATAAAGTGAAATCAGAGATGGAAG
ATGACGCGTGGTATCCACCGGGTCACGGTGATATTTATAGAAGTTTATTA
AATTCTGGAATATTAGATAAACATTTGGATGAGGGCAAGGAATGGGCATT
TATTTCCAATATCGATAATATGGGAGCCACAGTCGATTTGAAAATTCTTT
CTTTTCTTGTTGAATCTATGAAAAAAGAAAATTTTCCTGAATTTGTAATG
GAAGTTACCAATAAAACTAGAGCTGATGTTAAGGGAGGAACATTAGTGAA
ATATGAAGATAAATTGCGCCTGCTGGAAATGGCTCAGGTTCCAAAAGAGA
GAAAAGAAGAGTTTACGTCGGTTCGTAAATTTCGAATATTCAACACAAAC
AATTTGTGGGCACATTTAAAATCCATCAAACAATCAATTCTTGAAGATAC
TTTACAAATGGAAGTAATTGTGAATGCGAAAACCCTTGATAATGGTACTA
ATATTGTACAATTGGAAGAGGCTGCTGGATCCGCAATAAAAAGCTTCAAT
AATGCAATCGGAATCAATGTGCCTAGAAATCGATTTTTACCCGTGAAGCA
ATCGGCAGATCTGATGCTAGTTATGTCAAATCTCTATGTGATGAGAAAAG
GCTGTCTGATGATGTCACCGAATCGTAGTTTTCCGTCGGTTCCACTCGTA
AAATTAGGGCCTCATTTTAACCGGGTCAAAGATTTCCTTAATCGGTTCAG
TAACATCCCAGACATGCTAGAGCTTGACCATTTGACAGTTTCCGGGGATG
TTTTTTTCGGCAGAGATGTCGTTCTGAAGGGCACTGTGATAATCATTGCT
AACCATGGCGATCGAATCGATATTCCATCCGGAGCTATTCTCGACAACAA
AATCGTATCTGGAAATCTTAGAATTCTTGATCATTAAATTTCATATCTTG
TTCATGTTTTTGTAGTGATTTTTCAATAGTTTTTTTTCTCAATAGATAAC
TTGATTATTTTTAATGCTATACTAGATCTGATAGGTCGTTCATTCGGTTC
TTGCCTTTTCCAGGATTTGCGGTGAACTACATTTCAAGGATTCCAGTAAA
GGATGAATAAATATTTTTGTAAACGGAAAAAA
back to top

protein sequence of SMED30026043-orf-1

>SMED30026043-orf-1 ID=SMED30026043-orf-1|Name=SMED30026043-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=519bp
MLQFEKTHRRSGSDFAVEFKEMTRRDAEARMSAALENLVLTAPAPRRDHI
ERELEGFKILFRRYLDESTTQIKWDNIKLLDEVEVKPYENLPEIDYHVVK
NYLDKLIVIKLNGGLGTSMGCTGPKSLISVRNDLTFLDLNVQQIEALNTK
YKCDIPLILMNSFNTQEDTLQVLRKYAKLNVTIETFEQSMYPRIHRESMI
PITKKVRMPLGDFRSNKVKSEMEDDAWYPPGHGDIYRSLLNSGILDKHLD
EGKEWAFISNIDNMGATVDLKILSFLVESMKKENFPEFVMEVTNKTRADV
KGGTLVKYEDKLRLLEMAQVPKERKEEFTSVRKFRIFNTNNLWAHLKSIK
QSILEDTLQMEVIVNAKTLDNGTNIVQLEEAAGSAIKSFNNAIGINVPRN
RFLPVKQSADLMLVMSNLYVMRKGCLMMSPNRSFPSVPLVKLGPHFNRVK
DFLNRFSNIPDMLELDHLTVSGDVFFGRDVVLKGTVIIIANHGDRIDIPS
GAILDNKIVSGNLRILDH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR016267UDPGP_trans
IPR029044Nucleotide-diphossugar_trans
IPR002618UDPGP_fam
Vocabulary: molecular function
TermDefinition
GO:0003983UTP:glucose-1-phosphate uridylyltransferase activity
GO:0070569uridylyltransferase activity
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
Vocabulary: biological process
TermDefinition
GO:0006011UDP-glucose metabolic process
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR029044Nucleotide-diphospho-sugar transferasesGENE3DG3DSA:3.90.550.10coord: 26..405
e-value: 9.4E-153
score: 510.6
IPR029044Nucleotide-diphospho-sugar transferasesSUPERFAMILYSSF53448Nucleotide-diphospho-sugar transferasescoord: 53..491
IPR002618UDPGP familyPFAMPF01704UDPGPcoord: 55..483
e-value: 6.1E-182
score: 604.8
NoneNo IPR availableGENE3DG3DSA:2.160.10.10coord: 406..518
e-value: 2.7E-47
score: 161.1
NoneNo IPR availablePANTHERPTHR43511FAMILY NOT NAMEDcoord: 17..517
NoneNo IPR availablePANTHERPTHR43511:SF4UTP--GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASEcoord: 17..517
IPR016267UTP--glucose-1-phosphate uridylyltransferasePIRSFPIRSF000806UDPGPcoord: 5..518
e-value: 7.0E-195
score: 645.8
IPR016267UTP--glucose-1-phosphate uridylyltransferaseCDDcd00897UGPase_eukcoord: 103..421
e-value: 2.85874E-179
score: 503.702