Protocadherin alpha-2

Overview
NameProtocadherin alpha-2
Smed IDSMED30026029
Length (bp)3576
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin alpha-2 (SMED30026029) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin alpha-2 (SMED30026029) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin alpha-2 (SMED30026029) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin alpha-2 (SMED30026029) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026029

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026029SMESG000059102.1 SmedASXL_010047SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30026029SMESG000059102.1 dd_Smed_v4_19925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30026029SMESG000059102.1 dd_Smed_v4_19925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30026029SMESG000059102.1 dd_Smed_v4_19925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30026029SMESG000059102.1 dd_Smed_v4_19925_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026029SMESG000059102.1 dd_Smed_v6_19925_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30026029SMESG000059102.1 OX_Smed_1.0.08528ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 241.891 bits (616), Expect = 6.061e-65
Identity = 233/813 (28.66%), Postives = 372/813 (45.76%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKS-SVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK +G      I++ +  + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +DG L  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDKD +  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N KI+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q+IAVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQEK--NYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYK-TGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGINGVQ-NYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKD-ADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 125.946 bits (315), Expect = 1.527e-28
Identity = 111/381 (29.13%), Postives = 179/381 (46.98%), Query Frame = 2
Query: 1475 FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-----LTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
             DRE+     + +   DG         +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P +     + P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A+D D   N K+ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  207 LDREEKDTYVMKVKVEDGGFP----QRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAM-LFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 100.523 bits (249), Expect = 1.257e-20
Identity = 107/350 (30.57%), Postives = 154/350 (44.00%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPA--TIGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  I +      A D D G+NG  +Y L   ++ F L  I++  G     + VQ  +DRE K+ Y + +   D G    +S+  L ++V D NDN P    T  E S+ EN AP   ++ QL   D+DIG NA +   FS    N    +  +N T   + I +PLDRE    H L V   D GL   R     V + V DVNDN P +     +R I +  +     S +I     P      LI V D DA  N ++T      + +P ++    S    L     L +     Y IK+   D+G PPL    M ++ + ++
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPEN-APVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSI----DIRYIVNPVNDTVVLSENI-----PLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDE 459          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 240.736 bits (613), Expect = 9.681e-65
Identity = 224/791 (28.32%), Postives = 361/791 (45.64%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEF--HGSLIYKLSGPNCCFSIDQKSS----VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN       SL+Y+L        + + SS    + T +  ID E +C     +S     +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F      V + EN P  + + QL A D D  S + +R+          ++LF++     +I +   LD E    +KV V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + +   Y + T +  D E + + S  ++ SD    S N     +  + V++ D NDNPP F Q      V+EN   G  +  ++A D D G N  I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   D+D G N  V  S    ND+ V+   +G +      DRE +  +   V+  D G    R S+ +V I V+DVNDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   +G + + V++ D G P
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFPIPSATDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEREVP---FHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLN----QTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG-QPPRSSTAKVTINVMDVNDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 241.891 bits (616), Expect = 1.847e-64
Identity = 233/813 (28.66%), Postives = 372/813 (45.76%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK +G      I++ +  + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +DG L  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDKD +  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N KI+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q+IAVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQE--KNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYK-TGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGINGVQ-NYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKD-ADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 125.946 bits (315), Expect = 2.031e-28
Identity = 106/354 (29.94%), Postives = 171/354 (48.31%), Query Frame = 2
Query: 1556 TSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-----LTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P +     + P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A+D D   N K+ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  230 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSA-MLFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 99.7525 bits (247), Expect = 1.958e-20
Identity = 104/349 (29.80%), Postives = 154/349 (44.13%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  I +      A D D G+NG  +Y L   ++ F L  I++  G     + VQ  +DRE K+ Y + +   D G    +S+  L ++V D NDN P    T  E S+ EN    T + QL   D+DIG NA +   FS    N    +  +N T   + I +PLDRE    H L V   D GL   R     V + V DVNDN P +     +  ++D      S++I ++   +       LI V D DA  N ++T      + +P ++    S    L     L +     Y IK+   D+G PPL    M ++ + ++
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSIDIRYIVNPVNDTV--VLSENIPLNTKIA-------LITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDE 459          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 240.736 bits (613), Expect = 2.595e-64
Identity = 224/791 (28.32%), Postives = 361/791 (45.64%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEF--HGSLIYKLSGPNCCFSIDQKSS----VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN       SL+Y+L        + + SS    + T +  ID E +C     +S     +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F      V + EN P  + + QL A D D  S + +R+          ++LF++     +I +   LD E    +KV V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + + L   + T +  D E + + S  ++ SD    S    L  +  + V++ D NDNPP F Q      V+EN   G  +  ++A D D G N  I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   D+D G N  V  S    ND+ V+   +G +      DRE +  +   V+  D G    R S+ +V I V+DVNDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   +G + + V++ D G P
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFPIPSATDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEREVP---FHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG-QPPRSSTAKVTINVMDVNDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Match: PCDH11X (protocadherin 11 X-linked [Source:HGNC Symbol;Acc:HGNC:8656])

HSP 1 Score: 241.121 bits (614), Expect = 2.796e-64
Identity = 233/813 (28.66%), Postives = 372/813 (45.76%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK +G      I++ +  + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +DG L  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDKD +  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N KI+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q+IAVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQE--KNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYK-TGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGINGVQ-NYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKD-ADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 125.946 bits (315), Expect = 1.927e-28
Identity = 106/354 (29.94%), Postives = 171/354 (48.31%), Query Frame = 2
Query: 1556 TSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-----LTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P +     + P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A+D D   N K+ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  230 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSA-MLFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 100.138 bits (248), Expect = 1.929e-20
Identity = 106/349 (30.37%), Postives = 152/349 (43.55%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  I +      A D D G+NG  +Y L   ++ F L  I++  G     + VQ  +DRE K+ Y + +   D G    +S+  L ++V D NDN P    T  E S+ EN    T + QL   D+DIG NA +   FS    N    +  +N T   + I +PLDRE    H L V   D GL   R     V + V DVNDN P +     +R I +  +     S +I     P      LI V D DA  N ++T      + +P ++    S    L     L +     Y IK+   D+G PPL    M ++ + ++
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSI----DIRYIVNPVNDTVVLSENI-----PLNTKIALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDE 459          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 157.147 bits (396), Expect = 3.034e-38
Identity = 179/665 (26.92%), Postives = 303/665 (45.56%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYK--LSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQF-SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI--LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITV------NGTLYI--TKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            I EN  I  ++ T+    E  G N + H S+     + G     +ID  +  +T+ + ID +    N  +++   +  G         +   L + V + I+V+D+ND+ P   + Q++     E +   G  +    A D D  P N  I+Y + E  + F +    +    +     LD E    Y +K+ A +           + + + D NDN P F+   ++V + E  P  S I  L A D D    + + + + A+ E+  +  +   G ++ +S  L  + H + +V +  TD G  + R V+ V ++D N  +P    +P  +++ E+S     IG  ++T K +    G           R+ +S+ S +  +I   + DI   +  DRE  +  SV++  SD     A+  L +S  I V + D NDN P+F  S Y A ++E+ P+GT  L+V+A D D G NG + Y L    S     LF++D T+G + V   +DRE      L I A D G+  L+++  + +T+ DVNDN+P      ++  + EN +P  +T+G +   D+D G NAD+ F + +   D  +  +      NG + I      D E K     +        +G+  S+  V I V DVNDNKP L
Sbjct:  384 ILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG----LTIDYSTGEVTLRERIDAK----NSPITAVIRAKDG---------AQPALSSTVPLTINVIDINDHAPTLIAAQKM--ITLEENVAIGEEVGRVYAIDEDSGP-NGIIKYSM-EGSEDFII---DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRI-EEADREVFSILDIGDQGAILSVSGELKRQDH-KVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSP----IGYPVITLKAEDHDRGD--------NARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD----HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN-SPVGSTVGTIVARDADEGDNADISF-RIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKAN---KFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 1000          

HSP 2 Score: 136.732 bits (343), Expect = 5.009e-32
Identity = 106/379 (27.97%), Postives = 173/379 (45.65%), Query Frame = 2
Query: 1409 EFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLA-PATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            E  L+   ++++L   I   TA++R                    +  +++S T+ V +LD  DN P F +  YF  + E+ PIGT +L V A DLD G NG+I YSL   +  +L  I++ +GVI    P+DRE     +L + A D G+    S+  + ITV DVNDN+P   +  +  ++ EN+  PA I  ++  D D G N  V +S    +    +     T  +T     + K+     V    +G      S+  + I VID+ND+ P LI              AA + I++    + G  + ++ A+D+D   N  + Y +       S+ F  +  +G +   K L       Y +KV+ +D G+P L
Sbjct:  221 EIRLAKSMDREVLDKHILKVTAYER-------------------VDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLI--------------AAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM-----EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSL 561          

HSP 3 Score: 135.961 bits (341), Expect = 9.379e-32
Identity = 187/727 (25.72%), Postives = 311/727 (42.78%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQ--LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVT----DGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD---IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD----FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIG----QLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPS-QIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            F++D  S  + +AK++D E +               H+ L V  +  V   + A   V + VLDV DN P F K      + E +   G+ +    A D D + EN +IEY L E +    L ++  +   +     LD E  +   + + A +    K+ +   V++ V D NDN P F S  ++V + EN    ++I  + A D D  +  +      +++ +  L      G V L       ER      P+       DG   A S    L  +  D    +P LI    +I + EN   G  +G+V   D +DS  NG            +++S+  G    I+  D   I+T    DRE +++ S+ +   D    S N    +S TI V + D NDN P F + +Y   ++E  P G+ I+ + A D D+  + KI Y +E      FS+  I     +++V G + R+     ++ I A D G   L     +N+ +DDVN        PF   + E+   + IG     L+ ED D G NA +V+S     D +    ++   G + ++  LDRE +    + V   D+  +    +S ++ + + D+NDN P+            ++S AA+ S  I V    G    Q+ A+D D   N  + Y +   ++ PS Q+F  + T+G L +   L         + +  +D G+P L
Sbjct:  213 FTLDTMSGEIRLAKSMDREVL-------------DKHI-LKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDA-PIGTTVLSVFARDLD-SGENGEIEYSLGEGNGKNLLAINA-KSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTL------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAID-EDSGPNGI-----------IKYSME-GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLN----TSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEH---SPIGYPVITLKAEDHDRGDNARIVYSI----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHA-SPPLNTSTQIEVILDDINDNSPQFT----------SSSYAATISEDIPV----GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL 872          

HSP 4 Score: 124.405 bits (311), Expect = 3.108e-28
Identity = 172/723 (23.79%), Postives = 307/723 (42.46%), Query Frame = 2
Query:  302 IQENEPI------------DRMVGTIATDIEGLGINLEFHGSLIYKLSGPNC--CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVF----SKTWPNDDTVMI-TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHIL 2392
            +Q+N PI            D  +GT    +    ++   +G + Y L   N     +I+ KS V+  A  +D E++ + R            L++I +     +  +   V I+V+DVNDN P F+       + E +    + I    ATD D    N ++ Y +A       L +D      + L   +DA+N     + IRA +       + + + + V D ND+ P   ++   + ++EN      + ++ A D DS    ++++ +      E  + F + ++  +I  +  LD E   RY + V   D         + + V+++D ND +P   +    + + E   +G  I  +   D D+ Q   K+    E  +  +   L  G    IL+     K      +  ++ V +  +D         L     +NV I D N + P F    +   + E+ PIG  ++ + A D D G N +I YS++     F+ID ++G I+V   +DRE +  + + + A D  S PLN+S  + + +DD+NDNSP    + +  ++ E++   T   Q+   D+DIG N  V +    S + P+     +   +GTL ++  LDRE      L +  RD G      +S E+ + + DVNDN P              T    S  + I+     G  +  ++A D D+  N  +++ I 
Sbjct:  263 VQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIR------------LDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILE-NITIPAVIATVKATDEDFG-TNGKVHYSMASSSGIGGLTIDYSTGE-VTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ---KITYRIEEADREVFSILDIGDQGAILSVSGELK-----RQDHKVRVEISATDQGG------LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS-EITLTLSDVNDNAP--------------TFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIF 932          

HSP 5 Score: 79.7221 bits (195), Expect = 1.497e-14
Identity = 78/276 (28.26%), Postives = 128/276 (46.38%), Query Frame = 2
Query: 1601 NPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFS-VRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMI--TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQS---PGYVITQLIAVDDDDATNTKLTYHI 2389
            N   F+Q +Y   + E+ PI T+I  V A       +  ++YS+         +LF +D+ +G I +   +DRE+ + + L + A +     +++S  + + V DV DNSP       F  +RE+ AP   T+  +   D D G N ++ +S    N   ++     +G +    PLDRET     L V   D G   +R+S+  V I V+DVNDN P                  AS S ++++ ++   P  VI  + A D+D  TN K+ Y +
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKA---SHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIRED-APIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKG-TPKRESTAMVEITVVDVNDNAPVF----------------ASDSYNVTILENITIPA-VIATVKATDEDFGTNGKVHYSM 414          

HSP 6 Score: 78.1814 bits (191), Expect = 3.755e-14
Identity = 81/350 (23.14%), Postives = 151/350 (43.14%), Query Frame = 2
Query:  824 NDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD----------IRTKTAFDRE-KSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYK 1825
            +DLD E++  + + + A +           +++ +DD NDN P+F SS ++  + E+ P  +   Q+ A D D     ++ + L +++++   +LF + +    + +SS LD E+     +P+F  D       A S + + + D ND +P   Q    + + ENS  G  +G ++  D D            E     + F +  G + K+   +          I T+  FD E K+++    L  S G        L+S+  + + + D NDN P  +      +  +N  +   I  + A+D D   N  + Y LE +  L + +  TG I V+    R +   +K
Sbjct:  740 SDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD------------EGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG-------QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEEN-DLIEAEKYTGKILVKQEWKRNMDVSFK 1067          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 156.377 bits (394), Expect = 4.801e-38
Identity = 179/665 (26.92%), Postives = 303/665 (45.56%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYK--LSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQF-SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI--LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITV------NGTLYI--TKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            I EN  I  ++ T+    E  G N + H S+     + G     +ID  +  +T+ + ID +    N  +++   +  G         +   L + V + I+V+D+ND+ P   + Q++     E +   G  +    A D D  P N  I+Y + E  + F +    +    +     LD E    Y +K+ A +           + + + D NDN P F+   ++V + E  P  S I  L A D D    + + + + A+ E+  +  +   G ++ +S  L  + H + +V +  TD G  + R V+ V ++D N  +P    +P  +++ E+S     IG  ++T K +    G           R+ +S+ S +  +I   + DI   +  DRE  +  SV++  SD     A+  L +S  I V + D NDN P+F  S Y A ++E+ P+GT  L+V+A D D G NG + Y L    S     LF++D T+G + V   +DRE      L I A D G+  L+++  + +T+ DVNDN+P      ++  + EN +P  +T+G +   D+D G NAD+ F + +   D  +  +      NG + I      D E K     +        +G+  S+  V I V DVNDNKP L
Sbjct:   25 ILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGG----LTIDYSTGEVTLRERIDAK----NSPITAVIRAKDG---------AQPALSSTVPLTINVIDINDHAPTLIAAQKM--ITLEENVAIGEEVGRVYAIDEDSGP-NGIIKYSM-EGSEDFII---DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRI-EEADREVFSILDIGDQGAILSVSGELKRQDH-KVRVEISATDQGGLQGRCVVNVFIDDVNS-APYFNDHPFSVKIPEHSP----IGYPVITLKAEDHDRGD--------NARIVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASD----HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN-SPVGSTVGTIVARDADEGDNADISF-RIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKAN---KFFFELQASSGQLSSTVPVRIHVSDVNDNKPAL 641          

HSP 2 Score: 116.316 bits (290), Expect = 9.114e-26
Identity = 151/613 (24.63%), Postives = 266/613 (43.39%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVF----SKTWPNDDTVMI-TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHIL 2392
            V I+V+DVNDN P F+       + E +    + I    ATD D    N ++ Y +A       L +D      + L   +DA+N     + IRA +       + + + + V D ND+ P   ++   + ++EN      + ++ A D DS    ++++ +      E  + F + ++  +I  +  LD E   RY + V   D         + + V+++D ND +P   +    + + E   +G  I  +   D D+ Q   K+    E  +  +   L  G    IL+     K      +  ++ V +  +D         L     +NV I D N + P F    +   + E+ PIG  ++ + A D D G N +I YS++     F+ID ++G I+V   +DRE +  + + + A D  S PLN+S  + + +DD+NDNSP    + +  ++ E++   T   Q+   D+DIG N  V +    S + P+     +   +GTL ++  LDRE      L +  RD G      +S E+ + + DVNDN P              T    S  + I+     G  +  ++A D D+  N  +++ I 
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILE-NITIPAVIATVKATDEDFG-TNGKVHYSMASSSGIGGLTIDYSTGE-VTLRERIDAKNSPITAV-IRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSM------EGSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ---KITYRIEEADREVFSILDIGDQGAILSVSGELK-----RQDHKVRVEISATDQGG------LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAAS-EITLTLSDVNDNAP--------------TFEQLSYDLYIAENSPVGSTVGTIVARDADEGDNADISFRIF 573          

HSP 3 Score: 114.005 bits (284), Expect = 4.953e-25
Identity = 147/562 (26.16%), Postives = 243/562 (43.24%), Query Frame = 2
Query:  914 VDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVT----DGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD---IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD----FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIG----QLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPS-QIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            V++ V D NDN P F S  ++V + EN    ++I  + A D D  +  +      +++ +  L      G V L       ER      P+       DG   A S    L  +  D    +P LI    +I + EN   G  +G+V   D +DS  NG            +++S+  G    I+  D   I+T    DRE +++ S+ +   D    S N    +S TI V + D NDN P F + +Y   ++E  P G+ I+ + A D D+  + KI Y +E      FS+  I     +++V G + R+     ++ I A D G   L     +N+ +DDVN        PF   + E+   + IG     L+ ED D G NA +V+S     D +    ++   G + ++  LDRE +    + V   D+  +    +S ++ + + D+NDN P+            ++S AA+ S  I V    G    Q+ A+D D   N  + Y +   ++ PS Q+F  + T+G L +   L         + +  +D G+P L
Sbjct:    2 VEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTL------RERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAID-EDSGPNGI-----------IKYSME-GSEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLN----TSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDE--DQKITYRIEEADREVFSILDIGDQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEH---SPIGYPVITLKAEDHDRGDNARIVYSI----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHA-SPPLNTSTQIEVILDDINDNSPQFT----------SSSYAATISEDIPV----GTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSL 513          

HSP 4 Score: 77.7962 bits (190), Expect = 4.380e-14
Identity = 81/350 (23.14%), Postives = 151/350 (43.14%), Query Frame = 2
Query:  824 NDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD----------IRTKTAFDRE-KSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYK 1825
            +DLD E++  + + + A +           +++ +DD NDN P+F SS ++  + E+ P  +   Q+ A D D     ++ + L +++++   +LF + +    + +SS LD E+     +P+F  D       A S + + + D ND +P   Q    + + ENS  G  +G ++  D D            E     + F +  G + K+   +          I T+  FD E K+++    L  S G        L+S+  + + + D NDN P  +      +  +N  +   I  + A+D D   N  + Y LE +  L + +  TG I V+    R +   +K
Sbjct:  381 SDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD------------EGDNADISFRIFGGADAKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSG-------QLSSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPDQ--NATLEYFLEEN-DLIEAEKYTGKILVKQEWKRNMDVSFK 708          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 125.176 bits (313), Expect = 1.809e-28
Identity = 165/687 (24.02%), Postives = 286/687 (41.63%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWN-ELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILT------YDIRTKTAFDREKSSQISV-VLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIG----TVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATIG-QLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTL----PSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            A+  V + + DVNDN P F     ER         G+ + + +A D D +P + +I + L E +  F L    +   +L + + LD E   HY +  RA    D   +N +L   + V D ND+PP+F    F++ +  + P+ S I      D D +       +    NE   +F +  N  ++L    +  E   +Y++ V   DG++E  + +++ ++   D   +  +    + + ENS KG V+                 + E     P + F LS       +         ++     D EK+ Q+    L   D       +       I V I + NDN PK  +      + EN P        I ++ A D D     +I + +  DF  LFQID   GV+TV  P+D E+   + L + A D           + +TV D NDN+P    + +   V E+    +IG +L +  +  G   + +     P+D T  + +N   G L + KPLD ET     L V  +D+G+    ++  +V I V+D NDN P+    + + ++ + +                G  +  + A+D D      ++Y + + +      P   F+ NS  G + + + + +  I  Y +KV  KD G PPL  E +  + + ++
Sbjct: 2694 AITTVTVDIGDVNDNAPAFHGD-YERFTISEDAAVGTSVTIFSAMDRDDSP-SGRIRFSLVEENPYFDL---NENSGWLTVASQLDREKIDHYKLIARA---TDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDL--HLPSTSPILHFSIKDDDLSPNNVSQFFIPKGNE-EGVFWIDSNNDLLLKRPEI-VENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKTVILAENSKKGTVV-----------------LGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSEVCKEL-------ITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD---FDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EFEDKATILVTVIDQNDNAPTFEKSTYSMKVMES---ESIGYELAHFRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPL-ETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKS--------------GEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSN-GDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDE 3319          

HSP 2 Score: 117.087 bits (292), Expect = 6.649e-26
Identity = 120/472 (25.42%), Postives = 213/472 (45.13%), Query Frame = 2
Query:  830 LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL---YEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQY--EDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR 2227
            L+      Y I +   +A   + ++ L   L V D ND PP F    +S  + E+      +  + A D D    + + L   + ++    FSV      I ++  L+++      + +  TD     + A + +EV +  E+ + P+   +  +  VME++  G VIG+V   + +  +    ++   E ++  L FS+     K I+      K++ DRE+ +Q  + +      + +  +H  +  T+ V I D NDN P F        ++E+  +GT +   +A D DD  +G+I +SL  +   F ++  +G +TV   +DRE  +HYKL   A D G    N+ +   I V DVND SP      EF++  +L P+T   L +  +D D+  N    F     N++ V  I  N  L + +P   E K ++ L+V       +G  ++S +V I +    D+  R
Sbjct: 2465 LNYHRDKRYQIPLVVEDATGRRAFSTLT--LSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQF---FSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIV------KSSLDRERKNQWKMTIRA----DAAGGVHAIT--TVTVDIGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGG--FNTDLPFTIVVSDVND-SPPQFEKEEFNIDLHL-PSTSPILHFSIKDDDLSPNNVSQFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKV----TAFDGVFETSTKVKINLKSSKDSDIR 2911          

HSP 3 Score: 115.546 bits (288), Expect = 1.656e-25
Identity = 189/766 (24.67%), Postives = 325/766 (42.43%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNC-CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSW---LDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIE---------VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD----IRTKTAFDREKSSQISVVLICSDG-WNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGK---IHYSLEHD--FSLFQIDSTTGVITVQG--PVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPF-EFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            + E+ PI  +V  +  + E  G N  F   +I+ ++G +    ++D++S  +T+A   DL  +   +    D       ++    + S+V+ +     ++ + DVN++ PQF +      +SE + K G  IF  TA D D    N +I++ L  + +   +     +   + LL  LD E+Q  +   I A +     + +  N+ + V+D NDNPP+         + E+ P  + +  + A D D    S L+F L     N  +  F +  +   I I +    LDY +   + + + V D      S    L  +       +  N   IE         V ENS  G    +VI+ +  ++    K+  E+      LE+ +  G      + D    +RT    DRE  S   + +   D   +   +        + ++ILD ND+ P  ++  Y A VAEN P   VI+KV A D DD  N     + + +E     S F+ID T+G IT  G   +DRE +  ++L +   D G   L S+V + + V D NDNSP        +SVR   A   + ++   D+D G NA + ++ T   D    I  NG +  ++ +  +  + + L V+  D+G  G++ ++  V +   +    KPR    +      + +   +   I IS     G  + +L A    DA   +L + I   +  P  +F     TG L L K +     G   + +SV D
Sbjct:  617 VTEDAPIGTVVAKLQANDEDTGYN-GFIRYVIHDIAGSSHEVLTVDEQSGEITVAS--DLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTM-----KLRIKDVNNHSPQFDEVSYYLRISE-NEKPGKDIFKVTANDFD-GGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLL-----NSEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELV----DIAHNHLAIEFDDVAKEASVYENSEIGT---EVIMIEAKETGDEQKVKAEN------LEYRIIGGDGWPHFSIDQKGTVRTTHLLDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRPVAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFTQAIHHYSVRSKFA-GKLCRIFAVDADEGENARLTYNIT-EGDARFSIDNNGNIIASEAIHGD--ESYALTVQATDHGTPGQQFAATRVVL-TANSAGQKPR----KSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEA---SDADGDELWWSISSGD--PDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTD 1340          

HSP 4 Score: 102.449 bits (254), Expect = 1.699e-21
Identity = 121/444 (27.25%), Postives = 197/444 (44.37%), Query Frame = 2
Query:  884 QDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTP----ARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFS-LSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE------HDFSL--FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP----CLLTPFEFSVRENLAPATIGQ--LQYEDSDI-GRNADVVFSKTWPNDDTVMITVNGTLYI--TKPLDRETKDRHCLRVRLRD 2149
            QDN +  +  + + +++ NDN P+    L  V + EN P    AR  I +++A D D   + +F +     ++   LF +     V+ +   LD E    + + V  +DG +E ++ + V V D+ND +P   ++   ++VME+   G  +     +  D          ++ET E  L+ S ++S  N    T  +      D E  S + + ++  D    S    L +   + + ++D NDN PKF + +Y   V EN   G  +L V A D+D    G + Y LE       D  +  F I+S   V+  Q  +D E  + Y L + A D G  PL S   L I V+D ND++P    C +T     V+E  A   IG   L++  SD+ G      F+     D      VN  L +   K L+   KD++ L V  +D
Sbjct: 2987 QDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEI-KFRMV----DDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGD----------QNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKD----SGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQS-IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTAL---VQEGEA---IGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKD 3404          

HSP 5 Score: 92.4337 bits (228), Expect = 1.674e-18
Identity = 79/270 (29.26%), Postives = 133/270 (49.26%), Query Frame = 2
Query: 1256 SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSF-TINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSV-GLNITVDDVNDNSP-CLLTPFEFSVRENLA-PATIGQLQYEDSDIGRNADVVF 2029
            SP     P ++EV E++  G V+ ++   D +D+  NG +         R      +G + ++LT D     I   +   +    ++ V+ +        A   + SS  T+ ++I D N++ P+F +  Y+  ++EN   G  I KV A D D G NGKI +SL   +   S+  ID+ TG++ +   +DRE ++ +   I A D G  P+  SV  L I+V+DVNDN P C++      + E+L   A +  +   D DIG+N+ + F
Sbjct:  605 SPVFSSFPEIVEVTEDAPIGTVVAKLQAND-EDTGYNGFI---------RYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDEG-FPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHGAFVSCMAAFDEDIGQNSKLKF 863          

HSP 6 Score: 84.3445 bits (207), Expect = 5.397e-16
Identity = 172/759 (22.66%), Postives = 303/759 (39.92%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLES-ICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARS--MIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDR----EKSSQISVVLICSDG---WNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVG---LNITVDDVNDNSPCLLTPF-EFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMI----TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSF---NSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT----NKPA----KYDDKLQSNN 2608
            FS+  +   +T+AK ++ ++ + ++  + +  S+   H              A   V +++   +  +P+FS       V E +   G+ I      +T+I      I  G +E   SF     ++    + + + LD E +  + + IRA  A        + VD  + D NDN P F+       + E+    +   IF  +  D   +  +RF L      E    F + +N   + ++S LD E+   YK+    TD G +       ++V D ND  PQ  +    I++   S   ++     + D D S  N              +F +  G  + +   D        R    E   Q  + +   DG    +T   I+L SS   +++  + N              +AEN   GTV+L  ++      L   + + L ++D ++F ++   G++ V+     + +++ +L  H +   +I  NS V    + + ++++NDN P ++    + S+ ENL P +    QY    +  +AD    K    DD   +     +NG + + KPLD E      L V   D    G  +    + + VID NDN P              T   ++ S+ +   +S GY +    A   D   N  + Y++      PS + SF   N+ TG L+L KPL    +    + V  KDSG PPL  E    + +     N P     KY  K++ N+
Sbjct: 2551 FSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHH-------------ATTTVEVNIASESVKVPRFSNSHYLFSVMEDA-DVGNVIGRVQQMETEIDEIRFTIVPG-SEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRADAAGGVHAITTVTVD--IGDVNDNAPAFHGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLV-----EENPYFDLNENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIVVSDVNDSPPQFEKEEFNIDLHLPSTSPIL--HFSIKDDDLSPNNVS------------QFFIPKGNEEGVFWIDSNNDLLLKRPEIVENKMQYQLKVTAFDGVFETSTKVKINLKSSKDSDIRCPEANKT----------VILAENSKKGTVVLGESSL-----LGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRL---TIQDNSEVCKELITVVIENLNDNRPKIIEKLLKVSIDENL-PTSEDARQYITRIVAEDADFDEIKFRMVDDFGGLFQIDDINGVVTVVKPLDSEILGFFNLTVVASD----GEFEDKATILVTVIDQNDNAP--------------TFEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYLK-----PSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENS 3229          

HSP 7 Score: 83.1889 bits (204), Expect = 1.143e-15
Identity = 151/687 (21.98%), Postives = 279/687 (40.61%), Query Frame = 2
Query:  569 QLLAVVRVRISVLD-VNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPY---LFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFD----LYQTANNELRKLFSVLQNGTVILISSWLDYE----RHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS--PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLS------SGKNKKILTYDIRTKTA---------FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITV---NGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSG 2521
            +++A  +V I V   +  + P F K +      E++   G  +    AT +D   EN  IEY L+          D +  P    + +   LD E    Y +K+ A  +   +  +E    + ++D ND  P F  S  S  + ++      I  + A D D+T+ L  +    LY+  + +   LF++      + ++  ++ +       +  + V VTDG++ A + L V +         P+  Q+  V   +EN+   +V    ++T        G +        P L+FSL+      S  +K+     I  KT          + R+K  QI +V+  + G    +        T+ + ++D ND PP F    Y   ++E+   G  ++ V+A D D+  N  I YSL    +   F +    G ITV   ++ +      L I A DS + P +++  + + +   +   P    + + FSV E+      IG++Q  +++I      +   +  +D  +  +V    G + +   LDRE K++  + +R       G   +   V + + DVNDN P                    +  +IS   + G  +T   A+D DD+ + ++ + ++  N      F  N  +G+L++   L    I HY +     D G
Sbjct: 2164 KMIAKAQVEIIVKSGITTHAPVFEKLKYTASTPEST-SIGQRLLTIKATTSD---ENDTIEYSLSGSK-------DIEIHPETGDVTITGQLDYEKTQKYDLKLVA-TSSGKQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGD-ETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENT---IVNKSALLT----VAVKGGV--------PPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFS--------TLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLLDGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYLFSVMEDADVGNVIGRVQQMETEIDEIRFTIVPGSEESDSFLPFSVERSTGKIIVKSSLDRERKNQWKMTIRA---DAAGGVHAITTVTVDIGDVNDNAPAF--------------HGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPY----FDLNENSGWLTVASQLDREKIDHYKLIARATDEG 2791          

HSP 8 Score: 83.1889 bits (204), Expect = 1.330e-15
Identity = 170/755 (22.52%), Postives = 308/755 (40.79%), Query Frame = 2
Query:  392 LIYKLS--GPNCCFSIDQKSSVLTIA--KNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGS--HIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTH----YLIKIRAWN-AQDNKQWNELNVDLYVDDF-------NDNPPRFNS--SLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGK-------MICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYK--LHIHAVDSGSIPLNSSVGLNI-TVDDVNDNSPCLLTPFEFSVRENLAPAT----IGQLQYEDSDIGRNADVVFSKTWPNDDTVMI-TVNGTLYITKPLD--RETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP---RLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            L++K+    P   F ID  S  +T +  + +D E    +    S C  G+             QL + V V ++VLD NDN P F+ Q I  H S  S  AG    IF   A D D   ENA++ Y + E    F +  D           ++ A    H    Y + ++A +     +Q+    V L  +          ++PP  +   S + + + +       + +L A+D D   +     +  ++ +   +F V Q+   +L++  ++  +    ++ + VTDG     S + + V  +  + P+   +    +V E     + +G  I T K   ++ G           +    E ++    SSG        ++      D E + +I  V+         AN+   ++F++N+   D NDN P F     FA V E+  +  V+  V A+D D G NG + YS+   ++ SLF+ID+ +G + +  P+D EL +H +  L I A+DS +  L   + L+I   ++  + +      ++ ++ ++  P T    +  L +           V  K  PN     + T++G +++   L   +  K   C  +     G    +Q   +V  ++I  N + P   R +    +RE      P  S  +S S+      V++   A+D+D  +N  + Y +L P     Q+FS +  +G +          +  Y   V   D G PP
Sbjct: 1084 LMFKIERGDPQSFFRIDLTSGYITTSGIRRLDREKQSEHELWVSICDGGEP------------QLCSNVIVIVNVLDENDNSPTFT-QAI-HHYSVRSKFAGKLCRIF---AVDADEG-ENARLTYNITEGDARFSI--DNN--------GNIIASEAIHGDESYALTVQATDHGTPGQQFAATRVVLTANSAGQKPRKSKNSPPEISGKKSDYVIPISDADQVGLTVGKLEASDADGDELW----WSISSGDPDSVFDVRQDTGQLLLAKKVELLKRGELRLNISVTDGQAWDHSTVIIQVSRQISQRPKFSASHYQTDVSER----VAVGTQIYTLKASGESLGTKPLVFNLFSVDDVAMEDKIRVEPSSG--------NVIVMEPLDYEAARRIRAVVQVQ-----QANMKSFATFSVNIN--DENDNSPYFVGHTAFAFVDESDTVDDVLATVTAFDKDRGENGIVTYSIVSGNEESLFKIDAKSGEVRLAKPLDPEL-QHVESILRIRAIDSAANSLKDEMSLHIRNSNEAPETAKFDRKVYQTTLYDSTRPGTPVLVLNALHH---------GTVSYKLEPNCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVESTEG----QQDIAKVIAKIIRTNQHSPIFRRQVYRGTIRE----NMPTGSSVLSKSLLP---LVVS---AIDEDPGSNGLVGYRMLSPKD--EQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPP 1761          

HSP 9 Score: 70.8626 bits (172), Expect = 6.955e-12
Identity = 95/406 (23.40%), Postives = 170/406 (41.87%), Query Frame = 2
Query: 1406 LEFSLSSGKNKKI--LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLD-----DGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRE-------------------LKEHYKLHIHAVDSGSIP----LNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            +E+SLS  K+ +I   T D+      D EK+ +  + L+      TS+   ++S     V I D ND  P+F +S   A ++++   G  I  ++A D+D     D  + K+ Y + + D +LF I   TG +++  PV+++                      + KL +  + SGS+        S  +   +++   N   LLT    +V+  + P     LQ+  +    +      + WP     +    G +++++ L+     R+ + + + D    GRR  S  + + VID+ND  P  + P                S SIS     G  +  + A DDD+  N  + Y +L  +   SQ FS +   G +++ K L H       + +   DS +PP
Sbjct: 2219 IEYSLSGSKDIEIHPETGDVTITGQLDYEKTQKYDLKLVA-----TSSGKQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDETLFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTAYAKLVVEILRSGSMQPPPRFEQSHYVANALENTIVNKSALLT---VAVKGGVPP-----LQFSLAPTTSSNSSTSKEAWP---VAIDRKTGRIHVSRVLNYHRDKRYQIPLVVED--ATGRRAFS-TLTLSVIDINDKPPFFVLP--------------FYSTSISESAKEGDTVMMVSATDDDE--NDTIEYSLL--DGSESQFFSVHPRQGTITVAKKLEHKAGVTLSLTIKATDSANPP 2587          

HSP 10 Score: 63.5438 bits (153), Expect = 1.127e-9
Identity = 84/315 (26.67%), Postives = 131/315 (41.59%), Query Frame = 2
Query:  275 IKECVLKYLIQENEPIDRMVGTIATDIEGLGINL-EFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDST--SVLRFDL---YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG 1201
            I E +LK  I EN P         T I     +  E    ++    G    F ID  + V+T+ K +D E +              G   L V + S+ +      + ++V+D NDN P F K      V E S   G  +    A+  D   +N  IEY L     +  + L+ Q    L L   LD E  +   + + A ++       E  V++ V D NDN P+F    +   VKEN+ +   +  + A D DS     + ++L    +T  +     F++  NG V LIS  +DYE+ ++Y + V   DG
Sbjct: 3011 IIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGG---LFQIDDINGVVTVVKPLDSEIL--------------GFFNLTV-VASDGEFEDKATILVTVIDQNDNAPTFEKSTYSMKVME-SESIGYELAHFRASGGD---QNETIEYYLKPSDVTSFVNLNAQTG-ILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDV-LISQSIDYEKIKKYNLKVIAKDG 3301          

HSP 11 Score: 57.7658 bits (138), Expect = 7.280e-8
Identity = 44/161 (27.33%), Postives = 70/161 (43.48%), Query Frame = 2
Query: 1469 TAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILK-------VNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVG--LNITVDDVNDNSP 1918
            T     KS + + ++  ++G    A +          +I+  N + P FR+  Y   + EN P G+ +L        V+A D D G NG + Y +    D  +F +D  +G I  Q   D E  + Y  ++ A D G  P  S +   + +TV D ND  P
Sbjct: 1630 TKLKHRKSVECTAIVESTEGQQDIAKVI--------AKIIRTNQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPP 1782          

HSP 12 Score: 53.9138 bits (128), Expect = 9.255e-7
Identity = 102/443 (23.02%), Postives = 185/443 (41.76%), Query Frame = 2
Query:  938 NDNPPRFNSSLFSVLVKENTPARS---------MIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR-----SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENG--PIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQG-PVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITK--PLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVID 2206
            N + P F   ++   ++EN P  S         ++   I  DP S  ++ + +    + ++   FSV Q    I      D+E+ + Y   V   D     R     S++ V V DENDE P+   N   I ++  +  G+ +G     D D   +    I +       + FS+ S K   +L  D  +    D  K   + V +  +DG  ++       S+ + +  +   ++  KF +++Y   + EN   P G++IL V    + D L+   H+S+ +    F I   TGVI+  G  +DRE     +L + A      P+ +   + + ++++ND +P  + TP++ ++      + IG +  E   I  +   V + +  N       V G + + K  P   E       ++  +DNG   R +    V IRV+D
Sbjct: 1664 NQHSPIFRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDEQM---FSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKDQS-----VPFSVDS-KTGDVLVKD--SNGISDMTKLFDLEVFV--TDGKQSA-------SYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSIILSVAT--IGDKLD---HFSIVNPHEAFFIHPGTGVISSSGIALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTPYDITI----GHSDIGTVVLEPKVIDNDEGDVVTISSENMPEYFKIVGGKVVLGKKLPSIEEEDLEFNFKLIAKDNGSVHRVEEP--VKIRVVD 2075          

HSP 13 Score: 51.2174 bits (121), Expect = 6.691e-6
Identity = 69/341 (20.23%), Postives = 138/341 (40.47%), Query Frame = 2
Query:  431 IDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPY-------LFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIAND---PDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARS-XXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKM---ICEHETTEPRLE 1411
            ++ ++ +LT+AK +D E++   +       SG   LE               +V ISV+D NDN P+F K++    V E S K+G  +    A D D +     + Y L       +   D    P+       + +   +D E    Y +K+ A +       +E  ++++V+D ND+ P F+    + LV+E       + +   +D   P + +    ++        +     +     +L +  L+Y +  +Y + V   D   +     L + +   +  +P +      I  ++N     +IG++  +D+D+   NG +   + E     PR +
Sbjct: 3161 LNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLE------------TEAQVEISVMDENDNAPKFEKEKYVGKVKENS-KSGEKVLTVKALDVD-SEHFGAVSYEL---EIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRLLKFSVSDLDGPKNGAPFTVEIQGDGAKSFK-----VNEKLELLTAKKLEYRKKDKYLLTVIAKDVKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEGIIGRLKASDEDEEDQNGLLRFGLVEGSIQSPRAQ 3479          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 116.316 bits (290), Expect = 8.415e-26
Identity = 163/665 (24.51%), Postives = 283/665 (42.56%), Query Frame = 2
Query:  596 ISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS-PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWN----TSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSS--VGLNITVDDVNDNSPCLLTPF-EFSVRENLA---PATIGQLQYEDSDIGRNADVVFS--KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            +++ D+NDN PQ+   +I  H+S    + GS     TA D D+  +N  I Y + +     +L    +    +F+ N +D    +    ++RA +        +L V   + D    PP+F  +L+ V + E+TP  + + +++AN+    ++  +R+ L     N+   L     +GTV  I    D+E+ + Y+  V  T+   E  + L  +   + +++ P    N   + V E       +  V  +D D S T G+ +  H  +E       SS  +   +T ++  +    R    +  +V+   DG       SANIH+T        ++D +   P+F +S+Y     E+   G  I  V A         K+ YS+     +H+FS   ID  TG I V   +D ++ +   L+I A    ++P   S    + I ++D NDN P   +   E S+RE+L    P  +  +Q  D D  +N +V +S   + P     +    G L     LD E    + LRV+  D G+  R  S+  + I V+DVNDN P         E+ + + P                ++ +++A D D   N ++ Y I    T  S+ F  +   G +   + +    I H  I +  +D G PP
Sbjct:  429 LTIGDINDNAPQWHSSQI--HISLNRTQGGSRTL--TAKDPDLG-QNGWIRYSVLDT----ELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSL----QNQDEHLTVDTMSGTV-CIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMD-SGTFGE-VSYHILSE-------SSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGGGQSSENSANIHIT--------VIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAM-------SKVKYSIYSGDQDHNFS---IDEDTGKIYVTRYLDADVHDTVLLNIQA----TLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYV--VQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR-SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKT--------------IVGKVVARDKDSLENGQIVYRI----TNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPP 1024          

HSP 2 Score: 105.531 bits (262), Expect = 1.599e-22
Identity = 162/664 (24.40%), Postives = 275/664 (41.42%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKS--FQLC---LDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQL----IQNPSVIEVMENSGKGLVIGQVIVT----DKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISV-VLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSG 2521
            + + + V D NDN P F+ Q ++  +SE + + G+   L T TD D  P+     + + + + +  F+L    +++Q Q  L +   LD E +  Y + I A +     +  +L   + + D NDN P F+ S ++  V  N    S +  + A D D    S + +D+ +T+       F++ Q+G +   +S L    H    V          + +V+ + V      SP L    +   +   +MENS  G ++ +V +     D          +C  +T +  +   L  G                DRE +S+  +  L+  DG     +  L       + I D NDN P++  SQ   H++ N   G     + A D D G NG I YS+  D  L  ID  TG I V   +D  +    K  + A D GS  L++ + +   + D     P      ++  + E+    T + ++   +S  G +  + +S    ++   + T++GT+ I K  D E +  +   V +  N       S+  + IR+ DVNDN P          + +   P           + P  V++   A D D  T  +++YHIL      S  FS N  TG +   KPL+    G + + VS KD G
Sbjct:  106 IDILVEVDDENDNAPSFADQVVKLEISEFA-QLGTSFALPTVTDGD-GPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPS-NSNFAISQSGVITTTASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCG--------------ILDRETASEHHLKFLLEKDGQIIIEHPQL-------LTIGDINDNAPQWHSSQI--HISLNRTQGGS-RTLTAKDPDLGQNGWIRYSV-LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTV-IATNA--NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKP-----------EEPLLVVS---ASDMDSGTFGEVSYHIL----SESSSFSINPVTGEVFAQKPLAR---GRFHLVVSAKDGG 717          

HSP 3 Score: 102.834 bits (255), Expect = 1.215e-21
Identity = 131/540 (24.26%), Postives = 236/540 (43.70%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEA-RSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CL-LTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRV 2200
            + I + DVNDN P F        V E   K    + + +A+D D +    ++ Y +     SF +         +F    L A  + H ++  +    Q ++  N  N+ + V D +   P+F+ S + +   E+     ++  +      + S +++ +Y   + +    FS+ ++   I ++ +LD + H    + +  T    E+ ++ + + +ED ND  PQ   +   I + E+         V  +DKD  + NG++     ++ P     +         T  + T +  D E +    + +  +D          +S+ T+ + +LD NDN P+F +S Y   V EN P  T++ KV A D D   NG+I Y + +    F ID   G +  +  +DRE+  H  + I A D G  P +S+    I+V DVNDN P CL +TP        L+ A IG +   D D G N  V++ +        ++  NG +Y+ + L+   +    L V + D G+  R+     V +R+
Sbjct:  627 ISIRLKDVNDNWPIFYPNEYHLTVREGP-KPEEPLLVVSASDMD-SGTFGEVSYHILSESSSFSI---NPVTGEVFAQKPL-ARGRFHLVVSAKDGGGQSSE--NSANIHITVIDKDTKTPQFSRSKYEIRTTED-----ILPGIAIGSVGAMSKVKYSIY---SGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKK-NGEVRYSIISSHPGSSIEIDQ------FTGQLSTGSLLDYEATRNYKLRVKATDLGIPPR----SSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTA-IGTIVAMDPDKGLNGSVLY-RAQLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVP-RKSVVCHVPVRI 1136          

HSP 4 Score: 98.2117 bits (243), Expect = 3.087e-20
Identity = 161/658 (24.47%), Postives = 266/658 (40.43%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRT-KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQIL--DFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPATI-GQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            ++V   +LD     PQF K   +  + E +   G+ +    A ++     + +I Y L    +   L +D      + +    D E Q  Y   + A NA  N + +   + + + D NDN P F  + + + V+E       +  + A+D DS +      +  + +     FS+      +     L      R+ + V   DG     E  + + + V D++ ++PQ  ++   I   E+   G+ IG V           G M         ++++S+ SG      + D  T K    R   + +   ++     N  A +    S    V I   D NDNPP+F  S     + E+  +      V A D D   NG++ YS+   H  S  +ID  TG ++    +D E   +YKL + A D G  P +S++ L I V DVNDN+P      +   V EN  P TI G++   D D   N  +V+  T  ++   +    G +Y  + +DRE      + +   D G+  R  S+    I V+DVNDN P  ++      I     PA S   +          I  ++A+D D   N  + Y   L ++L    F   S  G + L + L+     H  + V V D G P
Sbjct:  524 LQVVADLLDTESKPPQFEKALWQVEIPEDT-PIGTCLVKVVANNSQCG-NSKRIRYSLQNQDE--HLTVDTMSG-TVCIQKTFDFEKQKSYQTTVIATNA--NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSES---SSFSINPVTGEVFAQKPL---ARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSV-----------GAM--------SKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLL----NIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPR-SSTASARISVLDVNDNPPSCLS------ITPIVVPAGSPLST---------AIGTIVAMDPDKGLNGSVLYRAQLQSSL----FVVKS-NGDVYLRRQLNASDERHQRLSVIVSDQGVP 1124          

HSP 5 Score: 78.5666 bits (192), Expect = 3.203e-14
Identity = 173/697 (24.82%), Postives = 277/697 (39.74%), Query Frame = 2
Query:  503 LSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQF-SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPP-------RFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQL-IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDG-WNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHV--AENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDV--NDNSPCLLTPFEFSVRENLAPA-TIGQLQYEDSDIG--RNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL----DKPLSHHYIGHYPIKVSVKDSGSP 2527
            L  D  + Q HL LI+ L           VR++V D NDN PQ  +    E  ++E+S + G  +    A+D DI  +N +  + L E        + +     L  L+ L +     + IK+R  +      + E N+++     N NP         F    +   + E  P    I +L    P+   +     Y      +   FSV   G VI  +  LD E  +RY + V  T    +  + ++V V + ND  P   +  P    V EN   G  +  V   D D+       +    + +    F++         T  I      D E   + ++ +  +DG ++T  N        + + + D NDN P F +  Y   V  A   P G    K+ A+DLD    G + YSL +   S+F++   +G + ++  V     E Y + + A D+G    ++SV +++ + +    D        F F V EN      IG L  E+S     R  D   SK +  D        G L++  P+DRE +  H  +V + DN +   ++   +  + V+D NDN P              TS A   S+  S+    G  I Q++A D D   N +++Y IL  N L   I + N  TG + L    D  L       + I V  +D G P
Sbjct: 1685 LPLDREASQEHL-LIIILTDGGSRNDSCTVRVTVADQNDNKPQLDASTPSELEIAESS-RVGDVLHRFRASDMDIG-QNGKFSFELLEDSSGSLDLVPETGDLVLRRLSSLQS-----WKIKLRVVDHGVPGLYVEKNLEIS----NRNPQTEAKAPLEFLKQTYLSTIDEGLPRGQFIAKL---QPELAGL----TYSIVEGNIDSAFSVDSEG-VIRTNLELDREILERYSLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPR--RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQ------FTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTFTN--------LTIFVSDINDNAPTFSKPLYQTTVSPATFSP-GQPFAKIEAHDLD--ARGALTYSLGQGSSSIFRVAPESGALFMK--VLPPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKF------GRLFVAGPIDREQRATHEFQVEI-DNEMMTSQKVQCKCHVIVLDENDNLPVF------------TSVAYYLSLKDSMAH--GQKIGQIMASDQDSGENGRVSYRILSGNDL--NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHP 2317          

HSP 6 Score: 73.1738 bits (178), Expect = 1.289e-12
Identity = 98/414 (23.67%), Postives = 180/414 (43.48%), Query Frame = 2
Query:  731 ENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSW----LDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS-----PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRT-----KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGP-VDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL 1927
            E+ +  Y + +   S    +D+  +  LF+   +D E +  +  ++   N     Q  +    + V D NDN P F S  + + +K++      I Q++A+D DS    R      + N+L  + ++  +   I ++ W    LD   +  +++ V   D  + AR+ +  +       S     P  +     + V+E++  G V+ ++  +++   + +G            L +SL   + K  L  D++T     KT  D E    IS+ L  SDG   SA + L     I V+ +D  +  P F +S Y   +  + P G  + ++ A D D G++G + YS+    S  +I+  TG+I +Q P V R      ++ + A  S +    ++V L I   DV  + P LL
Sbjct: 2157 ESREFHYRIQDPEASKIFSIDKFGR--LFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDL-NIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDG------------LLYSLKEHQGK--LGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNGRSAVVPLK----IVVEPVD--EFAPVFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPLVSRRNLTIEQITVVAYSSPTKQSKTTVYLEIGPFDVQPSLPKLL 2547          

HSP 7 Score: 70.8626 bits (172), Expect = 7.200e-12
Identity = 100/388 (25.77%), Postives = 160/388 (41.24%), Query Frame = 2
Query: 1412 FSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF----SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL--LTPFEFSVRENLAPATIGQL--------QYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            F L+S K  + L  D+      DRE   +  +++   DG   +    L  S    ++I+D NDN P F +S+Y A V+ N  IG+ ++ V A D D G N +I Y ++       S F I S +GVIT    +       + + + A D GS  L+SS  + ITV     +SP L  +   E +    +  +T+G +        QY D+ +             +   V +     L +   LDRET   H L+  L  +G            + + D+NDN P+                  S  I IS+ ++ G   T L A D D   N  + Y +     L +++ S +  TG + +   +  +       +V  +D GSP L
Sbjct:  170 FKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCS----IEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAI-SQSGVITTTASL--LPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYL-----LLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ---LLTIGDINDNAPQW----------------HSSQIHISLNRTQGGSRT-LTAKDPDLGQNGWIRYSV-----LDTELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPAL 520          

HSP 8 Score: 62.3882 bits (150), Expect = 2.483e-9
Identity = 132/619 (21.32%), Postives = 252/619 (40.71%), Query Frame = 2
Query:  302 IQENEPIDRMVGTI-ATDIEGLGINLEFHGSLIYKLSGPNCC-FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFN-DNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSV---IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKT---------AFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLA-PA--TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPL 2101
            + EN  +   V T+ A D++ L     F   L+   SG     F+IDQ +  + +   +D E +    E +    +  G  +   NL             I V D+NDN P FSK   +  VS A+   G       A D D       + Y L +   S      +    ++ +L          YL+ + A +         + V + + +    + P F  + F   V EN+     I  L   +       R   Y+  + E  K+FS+ + G  + ++  +D E+   ++  V + + +  ++ V         DE+  L    SV   + + ++   G  IGQ++ +D+D  + NG           R+ + + SG +  I+T +  T +           D   ++   +++   D G    A +       +++++  ++ + P F    Y  HV E+  +GTV+ K+ A +     N  + YSL+       ID  TG +T++  +D E +    +++   D      ++ V L I V+ V++ +P + T   ++++  ++ PA  ++GQ+Q  D D G +  V +S +       +    G + + KPL
Sbjct: 1935 VPENLRVGSYVATVGAKDVDNLAPLRYF---LVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLP---EHTLTIKATDGSFDTFTNL------------TIFVSDINDNAPTFSKPLYQTTVSPATFSPGQPFAKIEAHDLD---ARGALTYSLGQGSSSIFRVAPESGALFMKVL----PPAGERYLVTVTATDNGVPSFSTSVPVSVIIGEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEES------REFHYRIQDPEASKIFSIDKFGR-LFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGE-NG-----------RVSYRILSGNDLNIVTLNPDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAV---GKVQVSLKMSSWSGSAPFFVLPVYEVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDVKTGELTLKTHLDWESEPIISMYLSVSDGNG--RSAVVPLKIVVEPVDEFAP-VFTKSSYTLQIPISTPAGESVGQMQAIDEDGGVHGVVKYSISDRQSTVKIEEHTGIIRLQKPL 2503          

HSP 9 Score: 57.7658 bits (138), Expect = 6.819e-8
Identity = 81/310 (26.13%), Postives = 132/310 (42.58%), Query Frame = 2
Query: 1370 KMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFA-HVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELK--EHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEF-------SVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR--LINPRGLRE 2254
            +++    T E R  F  ++ K     T    +    DRE S +  +++I +DG + +       S T+ V + D NDN P+   S      +AE+  +G V+ +  A D+D G NGK  + L  D S    +   TG + +     R L   + +K+ +  VD G   L   V  N+ + + N  +     P EF       ++ E L     I +LQ E       A + +S    N D+   +   G +     LDRE  +R+ L+V     G    +Q    V +RV ++NDN P   +  PR + E
Sbjct: 1652 RILATGMTEESRFRFQGNAPKFSINSTTGSISVLPLDREASQEHLLIIILTDGGSRN------DSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELLEDSSGSLDLVPETGDLVL-----RRLSSLQSWKIKLRVVDHGVPGLY--VEKNLEISNRNPQTEA-KAPLEFLKQTYLSTIDEGLPRGQFIAKLQPE------LAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVI----GTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPRRVPE 1937          
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 113.235 bits (282), Expect = 8.062e-25
Identity = 152/596 (25.50%), Postives = 244/596 (40.94%), Query Frame = 2
Query:  596 ISVLDVNDNIPQFS----KQRIERHVSEASH---KAGSHIFLETATDTDIAPENAQIEYGL-----AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWN-------AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGK-GLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQIS----VVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAEN-GPI---GTVILKVNAYDLDDGL--NGKIHYSLEHDF-----SLFQIDSTTGVITVQGPVDREL--KEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATIGQLQYEDSDIGRNA-DVVFSKTWPND-DTVMITVN--------GTLYITKPLDRE---TKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            + V DVND +PQF+       I+  ++   H     G  I    A DTD      ++ Y +      E  K F++    +    +F     D E    Y++ + A +         +    + + V + ++D NDN P F    +   VKE+      +  + A+D D  S LR+ L        R  F V  +   I +   LD+E   +Y + +  +DG + A + + + +ED ND +PQ  Q      V+E       V+  V  TD D  + + +++   E       F +  GK     +  I    A DR+  + +     VV    D  N      L     + V + D NDN P F + + F ++ EN  PI   G   + V A D DD    N  I Y +  +      S+F+ID  TG I     +DRE+  +  + + + A D G         + I V D+NDN+P    T +E SV E  AP     + +   D    A D VF+     + D   +T +        G L + +PLD E    +D   L +R+ D    GR  +   V + ++D ND+ P +
Sbjct: 1199 VEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRI---DELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGG--RIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRI--GK----YSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNG-----LVGYADVQVNVRDINDNSPIFPE-RLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEET-APIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD----GRHDAEAAVHVALVDRNDHAPHI 1772          

HSP 2 Score: 102.834 bits (255), Expect = 1.236e-21
Identity = 141/546 (25.82%), Postives = 229/546 (41.94%), Query Frame = 2
Query:  857 LIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNG----TVILISSWLDYERHQRYKVPVFVTD-----GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKD-DSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAE--NGPIGT---VILKVNAYDLDDGLNGKIHYSLEHDFS----LFQIDSTTGVITVQGPV--DRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVR--ENLAPATIGQLQYEDSDIGRNADVVFS--------KTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHI 2389
            L K++    +DN++ + +++ + +DD NDN P F   L++  V+E+ P    I ++ A D D+    R   Y   N+     FS+  NG     V L +  L+ ERH  Y+  V   D      L  +  +        ++ +  L  +     V E++  G  + Q+   D D D  T   M     +T+    FS+        L + +      + E    ++V++          +   TS  T+ + I D N+N P+F     ++ +A+   G   T    I+KV A D D   NG I YSL +  S     F ID  TGV+T    V  DRE +    + + A D G  PL      ++ V D+NDNSP    P +E SV   E +  + I    + D+D   NA++ +S        +   ND      VN   G + + KP+  +T+ +    V   DNG+    QSS +V + V+D     P+             TSP     I++        VI +  AV   D+ N+ + Y +
Sbjct:  610 LHKLKVTAREDNRE-SHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRI-TYSVDNHN----FSINSNGEISAKVRLDADQLN-ERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAF-DNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQ-KFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKW-----------QTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKL 1135          

HSP 3 Score: 99.7525 bits (247), Expect = 9.546e-21
Identity = 185/770 (24.03%), Postives = 316/770 (41.04%), Query Frame = 2
Query:  389 SLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL------AEHHKS----FQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSS---LFSVLVKENTPARSMIFQLIA---NDPDSTSVLRFDLYQT------ANNELRKLFSVLQNG---TVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS--PQL---IQNPSVIEVM-------ENSGKGLVIGQVIVTDKDDSQ--TNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTS---ANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLA--PATIGQLQYEDSDIG-RNADVVFSKTWPNDDTV--MITVNGTLYITKPLDRETK---DRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQ-IFSFNSTTGYL----SLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            SL Y  S     F ID+++ VLT + ++  +     RE  +  ++ +G   LI             +  + V+D+NDN PQF +   E  VS      G+ +    A D D A  NA+I Y L       E H++    F+L    +R   + L+  +  + Q      I   N       +   V L V D     P++ +S      + V EN     +I +  A    D  ++ V+ + L  +      A ++ R+ F+  +NG     ++I   LDYE+   Y + +  TD      S    +VE  +     PQ    +   ++ E M       + +GK +V  + I TD D  Q   + +++ E    E +  F +        LT +I     FDREK     + +  SD   ++   AN     +  + + I D NDN P F + +Y   V E+   G  ++ + A+DLD   N + H        + F + + +G I V+ P+D E  + Y L + A D      N++  + I ++DVNDN+P      +  +V E     P  +  +   D+D   +++ +V+       D V  +   +GT+ + K LDR+           V+  D+  NG      +V + V D+NDN P +   R    I++   P  S  +     Q+  +        DD    N  + Y I+    +  + +F  +  TG +    SLD+ +S      + I+V   D G P
Sbjct:  908 SLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLI----------GFCQFSVEVVDINDNSPQFERPSYETSVSRF-EAVGTSVITVFAFDNDAA-HNAEITYSLEIDTTAGEEHQNDLDFFELV--NRRSGEITLIKPIPMKTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVI-YKLTASGGPGNKAESKFRQ-FNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETK-HFRIDE------LTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGRH---NATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNG-LVGYADVQVNVRDINDNSP-IFPERLFGYIEENREPIHSDGVYFMDVQARDF--------DDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSER--EFIIEVRANDRGVP 1639          

HSP 4 Score: 83.1889 bits (204), Expect = 1.317e-15
Identity = 64/230 (27.83%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIH-YSLEHDFSLFQI-------DSTTGVITVQGPVDRE---LKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP 2224
            + +++ D NDN P F +++Y   V E  PIG  ++  +A+D D+     +  Y L  +   F +        S+ GV+ V+ P+D E    ++ + L I   D      ++   +++ + D ND++P +    E  VRE++   T IG+    D D G  A    ++         I  +GTL +   LDRE    + L +   DN  N  RQ    V + + DVNDN P
Sbjct: 1647 VTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRH---DAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQM---VAVYLQDVNDNGP 1870          

HSP 5 Score: 78.5666 bits (192), Expect = 3.251e-14
Identity = 168/772 (21.76%), Postives = 311/772 (40.28%), Query Frame = 2
Query:  386 GSLIYKLSG-----PNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELN----VDLYVDDFNDNPPRF-NSSLFSVLVKENTPARSMIFQLIANDPDSTSV-LRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVT-----DG---LYEARSXXXXXXXXXXXXS--------PQLIQNPSVIEVMENSGKG--LVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE----------HDFSLFQ-IDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIP--LNSSVGLNITVDDVNDNSPCLLTPFE----FSVRENLA-PATIGQLQYEDSDIGRNADVVFSKT---WPNDDT------VMITVNGTLY----ITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVD-DDDATNTKLTYHIL-LPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            G + Y L G         F ID  + ++ + + +D +   + +      ++ + + E  V+L             I + DVNDN+P F++      V E        I   TA D D   +N++I Y +  H+  F +  + +    + L  D D  N+ H++ +     A+D+ +   L+    + +  ++ ND    F  +S ++  V E+    + + Q+ A D D   V   F      + +   LFS+ ++  ++ +   +        + P+ +T     DG   +Y +++           E         P   +   + ++ME + K     I +V  TD DDS  NG ++     T+     +    +   +LT        FDRE   +  V +  +D      +  L      +V+++D NDN P+F +  Y   V+    +GT ++ V A+D D   N +I YSLE          +D   F+ ++  +G IT+  P+  + ++ +  ++ A D+G IP  L SS  + + V D    +P   T  +     +V EN+     I + +   S   RN+DV++  T    P +             NG  +    I + LD E  + + L +   D  +  R  S+    + V DVND  P+         ID+  +P         + ++ G  I  + A+D D D    ++ Y I+   N   ++ F  +  TG +  ++      I  Y + V   D
Sbjct:  567 GPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDL------------TIRIDDVNDNVPTFTRPLYTAQVRE-DIPLNQTILKVTAVDKDTG-DNSRITYSVDNHN--FSINSNGEISAKVRL--DADQLNERHFVYRFNV-TARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATD-DDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPS--PHVVFDRETRPREDVTVKATD----RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQK-FIFNVIADDNG-IPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKPGITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATD--MTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNE------HLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASD 1302          

HSP 6 Score: 74.7146 bits (182), Expect = 4.014e-13
Identity = 97/367 (26.43%), Postives = 155/367 (42.23%), Query Frame = 2
Query: 1559 SSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE-HDFSLFQIDSTTGVITVQGPVDR-ELKEH---YKLHIHAVDSGS-IPLNSSVGLNITVDDVNDNSPCLLTPFEFS--VRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLR-----------DNGLNGR--RQSSGEVC--------------IRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYP-----IKVSVKDSGSPPLI 2536
            S   + ++I D NDN P F +  Y A V E+ P+   ILKV A D D G N +I YS++ H+FS+    ++ G I+ +  +D  +L E    Y+ ++ A D G  + L+SS  ++I  ++ ND S   L   +++  V E+    T + Q+Q  D+D     +V +S          +  NG    T+ ++  + D H   V+LR           +N +N     Q  G  C              I + DVN+NKP         E  D    +    I    Y++    I ++ A DDD + N  + Y +    +   + F  +  TG L+   P  H            + V   D G  PLI
Sbjct:  624 SHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSI----NSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDAD---RDEVTYS---------FMDKNGRS--TQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKP---------EFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLT---PSPHVVFDRETRPREDVTVKATDRGDRPLI 960          

HSP 7 Score: 71.2478 bits (173), Expect = 4.592e-12
Identity = 96/347 (27.67%), Postives = 152/347 (43.80%), Query Frame = 2
Query: 1556 TSSFTINVQILDF--NDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDL---DDGLN-GKIHYSLEHDF-----SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLA-PATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDR-ETKDRHCL---RVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQ---IFSFNSTTGYLSLDKPLSHHYIGHY--PIKVS--VKDSGS 2524
            T+S    V IL+   ++ PP+F + +Y   V+E+  +   ++ V A      +DG + G I YSLE D        F+ID +TG+I +   +D +     KLH   V +      S V L I +DDVNDN P    P +   VRE++    TI ++   D D G N+ + +S    ++    I  NG +     LD  +  +RH +    V  RD+G      SS  + IR  + ND              + A     SQ  +     + G   T +I +   DA   ++TY  +  N   +Q   +FS +  TG + L   +S   +     PI ++  V+D GS
Sbjct:  509 TTSQLSEVAILEILADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSV---DNHNFSINSNGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTND--------------ESAVFLPTSQYTAFVAEDAQGG--TPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGS 836          

HSP 8 Score: 70.0922 bits (170), Expect = 1.142e-11
Identity = 140/572 (24.48%), Postives = 231/572 (40.38%), Query Frame = 2
Query:  371 NLEFHGSLIYKL---SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQT---HYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARS---MIFQLIANDPDSTSVLRFDL-YQTANNEL---RKLFSVLQNGTVILISSWLDYE--RHQRYKVPVFVTDGLYEAR---SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDI-RTKTAFDREKSSQ---ISVVLICSDG-WNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVG---LNITVDDVNDNSPCLLT-PFEFSVRENLAPATIGQLQYEDSD 2002
            +L+ H +L Y L    G    F +   S  + + + +D E+            S Q HL LI    S+ +  A   V I + DVNDN PQF +Q+    V E        +F   ATD D   ++++I Y L E   + ++    +    + L+  LD +       +   ++A +   N      +V + V D NDN P F   LF  + +   P  S       + A D D  +    ++ Y    N+L     +F + QN   I     LD E    + + + V   D    +R   + + + V D ND +P   +      V E +  G  +      D D+   +   +  ++ +E    F +++ K+ K  +  + R K   D E  +Q     + +  SDG  +  A +H        V ++D ND+ P    +     V E+ P GT I +  A D D G   +   + + D    F ID   G + V   +DRE    Y L I A D+     ++++G   + + + DVNDN P   T P     REN     +G  +   +D
Sbjct: 1361 DLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEA------------SDQYHLVLIA---SDGRHNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKSSRIVYRL-EGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDN--VFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVH--------VALVDRNDHAPHIHGATEH-RVREDVPRGTSIGRYTATDRDAGDTARFRINRQSDPKRQFTIDQ-DGTLRVAHTLDREDIAVYNLIIEAYDN-----SNNIGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATD 1899          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 186.037 bits (471), Expect = 5.066e-47
Identity = 204/785 (25.99%), Postives = 343/785 (43.69%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFH---GSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIE---RHVSEASHKAGSH-IFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLND-LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDST--SVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRT-----KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-------------EHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPATI-GQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQ-IFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMF 2551
            + ENEP+ R +  ++      G+N   +   G     L+     F +   S  + IA  +D E               +   E  V       L     +++ + DVNDN P F  +  +   R   +AS +A S  I    ATD D      Q+ Y +   +++    +D+       +  D L    Q  +++ I A +  + +   +  V L + D    PP F  + ++  VKE+ P  +++  +IA   D    S +R+ +Y   + +    FS+  N   I I+  LD+E   +  + +  T G   +Y   + + + VED ND +P+   +   I V E++  G  +      DKD S ++G++            +SL     K +   D R+         D E S + ++++  +DG   S    L+++ TI V + D NDNPP F + +Y  +V+E+  I   I++VNA DLD G N +I Y +               D S  F I   +G I ++ P+DRE ++ Y+L + A D+G+   ++   + + V D NDN P    + +EF + ENL   ++ G +   D D+G NA + +S    N    +  V G +   +PLDRE ++ + L V  RD G    R +   V I V DVNDN P + +P+                +S+   Q PG  + ++ AVD D   N  +TY I+         +FS + T+G +     L H     Y + V+  D G+PP    +M 
Sbjct:  620 VAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLT----EFEVRSASGEICIAGELDFER--------------RSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYG-NFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIY---SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVY-GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKD-SGSSGQVT-----------YSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS----LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG-TPVRSARVPVRIHVSDVNDNAPEIADPQ-------------EDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRML 1351          

HSP 2 Score: 162.155 bits (409), Expect = 1.333e-39
Identity = 213/783 (27.20%), Postives = 334/783 (42.66%), Query Frame = 2
Query:  419 CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDL----------DAENQTHYLIKIRAWNAQDN---KQWNELNVDLYVDDFNDNPPRF---NSS---LFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWL----DYERHQRYKVPVFVTD-GLYEARSXXXXX---XXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLIC---------------------SDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQ-SQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD--FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNIT--VDDVNDNSPCL-LTPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKP 2575
              F ID+ S  L +A+ +D       RE+ S+    +  +  +    SN    + + V+I V DVNDN P++ +  I+  VSEA+   G+ I   TATD D    N  ++Y L  +    QL   Q++   LF ++ L          D E    YL+ ++A +   N   +    + V L + D ND+ P F   NSS     S+ + + T    ++  ++A D DS    +     T  N   +     Q G + L+ S      D E+  R+ + +   D G  E +     L   V+  ++  P+ +Q      ++EN   G  + QV                 H      L + + +G    +   D     I T+  FDRE  SQ S VL                       SD    ++N       TI + + D NDN P+FR  S Y   V EN   G VI  V A DLD+G N  + YS+      + F IDS++G ++ + P+DRE    Y L I A D G  P +     NIT  V+D NDN+P   L+ +  SV+E+ AP   ++ Q+   D+D+G NA +V+S    N+      ++G    +     LDRE +  +   V   D G    R ++  V I V+D+NDN+P       + ++     PA  Q         PG  + ++ A+D D   N ++ Y +   N+  S  F  N +TG LS  + L+        ++V  +D G+PP     +  L I   P
Sbjct: 1424 AAFDIDRHSGNLVVARLLD-------REVQSEF---RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTG-TNGDLQYRLIRYFP--QLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAK------------SLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRE--SQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQ-PKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED-APLGTSVVQISAVDADLGVNARLVYS--LANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQV-----PALIQ---------PGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAP 2158          

HSP 3 Score: 160.614 bits (405), Expect = 4.091e-39
Identity = 163/581 (28.06%), Postives = 270/581 (46.47%), Query Frame = 2
Query:  551 NLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIA---PENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVME---NSGKGLVI-GQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD--------IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFE--FSVRENLAPAT-IGQLQYEDSDIGRNADVVFS--KTWPNDDTVMITVNGTLYITKP---LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP 2224
            NL SN   +    V +S++D     P F K R   +V E   + G+ +    A   D+A   P    I  G  + + S +      R     +   LD E ++  L+ I+A   +    +    V++ V+D NDN P F +S+  + V E+    + ++   A+D DS S  +   Y       + LF++      +++S  LDYE  QR+ + V  TDG   + S    ++ D  D +     NP V E  E   N  +   I  Q+I  +  D  T       +   +  ++   +S  +  +  +         I  +   DRE   +  + ++ +D    +A+    +   + V++LD NDN PKF++S+Y   + EN   G+V+  V A DLD G N  I YSL    S FQ+   TG I+ + P+DREL+E Y L + A D G+   ++ V + I V DVNDN+P +  P E   SVRE   P T + +++  D D G+NA + +S  K   +D   + +++ T  + +    LD E +  + L V   D G N  R++   + + V+D+NDN+P
Sbjct:  804 NLRSNADAV----VFLSIIDAMQRPPIFEKARYNYYVKEDIPR-GTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIR-----IAKPLDHEAKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQV-TYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVN----DNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAH----AKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGG-NPPRETVRMLRVEVLDLNDNRP 1363          

HSP 4 Score: 159.844 bits (403), Expect = 5.945e-39
Identity = 182/682 (26.69%), Postives = 305/682 (44.72%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH--KSFQLCLDQQRQPYLFL----LNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQL----IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILT------YDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL----EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPF-EFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITV---NGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPR----GLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKP--LSHHYIGHYPIKVSVKDSG 2521
            +RV ++V D NDN P F +  +     E + +      L  A D D+ P N Q  Y +   +   +F+L   ++R   L+L       LD E    Y + I A +         + V++ + D NDN P FN S +   V EN    + + Q+ A+D D+    ++ + + +  +++  ++F +      I I+  LD+E  + +++ V   D      E  + + + V D ND  P +    + + +  ++ E++  G  + ++ V D D            +T    +  +L+ G     LT      Y +      DRE  S  ++ ++ +D         L +S +I ++I D NDNPP+F Q  Y A+V E    GT +L+V A+D D+GLN  + YSL    E     FQID  TG+IT +  +D E +   +L + A D G  PL+S+  + +T+ DVNDN P     F   SV EN      I ++   D D G NA V ++            V   +G + I   LD E +  +   V   D    G   ++  + +++ DVNDN+P +  PR     LRE   A+S A+S              I  ++A D D     +++Y I+  N   + IF  + +TG + + +P  LS      + + +S  D G
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLL-PARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK-EQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS-----------KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPP----LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATD---RGGLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTP------------IVAVVATDPDYGNFGQVSYRIVAGNE--AGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 5 Score: 148.673 bits (374), Expect = 1.822e-35
Identity = 172/694 (24.78%), Postives = 301/694 (43.37%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQL----CLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVL-VKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI-LTYDIRTKTA-------FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----------EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGS---IPLNSSVGLNITVDDVNDNSPCLLTPFEFSVREN---LAPAT-----IGQLQYEDSDIGRNADVVFSKTWPNDDT--VMITVNGTLYITKPLDRETKD-----RHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDS 2518
            A  RV + VLD NDN P+F K + E  + E + + GS + + TA+D D+  ENA I Y L   + SFQ+         R+P       LD E +  Y + + A +     +   + V ++V D NDN P        V+ V+E  P  + + ++ A D D    + + + + +  +++   LFS+     VI     LD+E    Y++ V  +DG    R  + +L  +  D +   P    +  V  V E++  G V+G +   ++        +  E    + R+ ++L+      I   +DI   +         DRE  S+  + +   D   T++N   +S+ T+ +++ D NDN P++ Q      V+E  P+GT+I    A D D G NG + Y L           E   SLF++DS TG +++Q P+D E  + Y L + A+D  S     L +SV + + + D ND++P  ++P     +     ++ AT     +  +   D D G N  + +  T  N +    + +  G + + K L   T+D     R  L +  +D+G    ++SS  + + V   ++N PR +               A    +I      G  + Q+ A     A N  L+Y I  P  + + +F  +   G ++            Y + V V+D+
Sbjct: 1135 AKTRVIVRVLDANDNDPKFQKSKYEFRIEE-NLRRGSVVGVVTASDLDLG-ENAAIRYSLLPINSSFQVHPVTGEISTREP-------LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSV--EESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALD--TTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQ--------------AVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI--PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDA 1799          

HSP 6 Score: 138.658 bits (348), Expect = 1.850e-32
Identity = 170/679 (25.04%), Postives = 285/679 (41.97%), Query Frame = 2
Query:  572 LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHK-SFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFN----SSLFSVLVKENTPARSMIFQLIANDPDS-TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG----LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQ--------LQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKP--LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            L   + V I++ DVNDN P F++ R    V E +   G+ +    A+DTD A EN  +EY +        Q+     R   +++   LD E +  + + + A +  +        V + V D NDN P  N    S   S  + E+      + ++  +DPDS T     ++     +    L +   +  ++++   LD E    Y + V  TD     L+ ++S+   + +  ++  P+  Q+     VME +  G  + QV+  D+D+   +       ET E   ++     +   I T   R+    + E   Q++VV    DG        L+S+ T+ V I D NDN P F QS Y   VAEN P+G  ILKV+A D D G+N  ++Y++   F   + F++ S +G I + G +D E +  Y+  + A D G +   + + + +T  DVNDN P    P E+ V    +P    Q        +   D D G    V +     N+  +  +    G +++ +P  L   T+  H L +   D G N R  +   V + +ID     P     R    + +                  G V+  +IA   D A  + + Y I   +  P   FS  + +G + + KPL H       + +     G PP+
Sbjct:  266 LRGFMTVNITIQDVNDNQPIFNQSRYFATVPENA-TVGTSVLQVYASDTD-ADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDN-PPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITT---RSHIDCETEPVPQLTVV--ARDGGVPP----LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFY-PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG-NLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDI--------------PRGTVVGSVIAASGDVAHRSPVRYSIYSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPV 911          

HSP 7 Score: 137.887 bits (346), Expect = 3.612e-32
Identity = 170/671 (25.34%), Postives = 282/671 (42.03%), Query Frame = 2
Query:  332 VGTIATDIEGLGINLEFHGSLIYKL-----------SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNL--WSNV--QLLAVVRVRISVLDVNDNIPQF------SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDL-----DAENQTHYLIKIRAWN-AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG----------LYEARSXXXXXXXXXXXX----------------SPQLIQNPSV-IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSS-VGLNITVDDVNDNSPCL-LTPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDD-TVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNG 2155
            VGTI  +      +   +G L Y+L                 F +D  +  L++   +D E++             Q +L ++  L   SNV  +L   V VR+ +LD ND+ P F        +     +S+A+ + G  +    A D D + +N Q+ Y +   +   +  ++ Q    + L+  L     D E    + + I A +  Q   + + LN+ L V   ++NPPRF  +++   + EN P+ S + Q+ A             Y+        LF V     +I      D E    Y +PV+V D           + + RS   +                        SP+        + V ENS  G VI  V+ +D D+   N  +I          +FS+ S   +        +    DRE+ S+ ++ +  SD G   S   H      I + + D NDN P+F+ S+Y   V E+ P+GT +++++A D D G+N ++ YSL ++    F ID  +G+IT  G +DREL+  Y   + A D G   + S+ V + I V D+NDN P     P+   V   + P  T+ ++Q  D+D+G NA++V+S    N   +    +N   G L  ++ L  E+     L V  RD G
Sbjct: 1500 VGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAV-------------QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDAT-RIGEVVAHIVAVDED-SGDNGQLTYEITGGNGEGRFRINSQTG-IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLS-YEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEG-PNADLIYSITGGNLGNKFSIDSSSGEL-------SARPLDREQHSRYTLQIQASDRGQPKSRQGHCN----ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG 2140          

HSP 8 Score: 116.316 bits (290), Expect = 1.304e-25
Identity = 122/409 (29.83%), Postives = 178/409 (43.52%), Query Frame = 2
Query: 1448 TYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----EHDFSLFQIDSTTGVI----TVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFS-VRENLAPATIG----QLQYEDSDIGRNADVVFS-KTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL-DKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT---NKPAKYDDKLQSNN 2608
            T +IRTK   DRE  +  S+V I   G N            + V + D NDN P F Q+       EN P       + A DLD        Y++        F L       GV+     + G +DRE    Y L I A+D G+ PL   + +NIT+ DVNDN P       F+ V EN   AT+G    Q+   D+D   N  V ++     +D   M  ++   G +YI K LD ETK+ H L V  +D+G     +++  V IRV DVNDN+P +     +  + D  SP  S+S        PG  + + I+V D D+       ++ L         +    + YL +   PL    + +Y + V   D G+PPL   K  +L IT   + P +++  L   N
Sbjct:  129 TGEIRTKVKLDRETRASYSLVAIPLSGRN----------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN---ATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHG-EQPLETTAFVSIRVTDVNDNQPTI----NVIFLSDDASPKISES------AQPGEFVAR-ISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN 512          

HSP 9 Score: 115.931 bits (289), Expect = 1.624e-25
Identity = 161/580 (27.76%), Postives = 265/580 (45.69%), Query Frame = 2
Query:  572 LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDL--YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQN---------PSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDI-RTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLN------ITVDDVNDNSPCL--LTPFEFSVRENLAPA--TIGQLQYEDSDIGR--NADVVFSKTWPNDDTVMIT--VNGTLYITKPLDRETKDR-HCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            L +   + I + D NDN P+FS+++    VSE ++K G+ +    A D+D A  NA++ Y + + +      ++      +     LD E +  Y +KI A +    +      + + + D NDN P F  +   V V E T   ++I  + AND D+   L + L    T + E   +F++ +    +++   LDYE  Q Y++ V  +D  +EAR+VL V V DEND +P  +           P++ E+ E+      +  V  TD D    N K+I   E  +       S+G    +++ ++ R + A     S    V +I  D    +    L SS  + VQ  D      +F Q+QY A ++E  P+G+V+L++    LD  L   I  + E  F L Q    +  I +  P+DRE  + YKL +        PL SS+  +      IT+ D NDN P       +E  + E LAP   +I QLQ  D+D     N++VV+  T  ND+ +     V G L++   LD ++  + + L +R  D+       S     + + D NDN+P+ 
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNK-GTFVAQVHAFDSD-AGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNG----VVSVNMSRLQPAV--SSSGDYFVRIIAKDAGKPA----LKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSL-AIIAGNEESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISE-LAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF 2862          

HSP 10 Score: 113.235 bits (282), Expect = 9.661e-25
Identity = 174/731 (23.80%), Postives = 302/731 (41.31%), Query Frame = 2
Query:  422 CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQ----FSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN-DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIG-----TVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGP--VDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPATI-GQLQYEDSDIGRNADVVFS--KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVR--LRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSP--GYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
             F ID ++  + I K +D E+    +EL       + H E        ++  A V +R++  DVNDN P     F        +SE S + G  +   +  D D   E A +   L      F L   +    YL +++  LD E  ++Y + + A +          ++ L + D NDNPP F   L+   V E     + + Q++A+D D    S L + L +T      + F +     +I   S +D E     ++ V   DG     S    ++   +D +   P   Q+   + V EN   G  I +V  +D D            E  +   EF + S   +  +  ++     F+R  S +  V+     G +T+A         I +Q+ D NDN P F   +Y   + E+         T I+ V A D D G  G++ Y +   ++  +F+ID +TG I V  P  +    +  + L+I A D G++  N+   + +++ D     P      + + V+E++   T+ G +     D+   + V +S     P+    + T +G + I KPLD E K +  L ++  L +  + G  Q    V I V DVNDN P                   +  + ISV +S   G  +    A D D  ++ ++TY ++  +     +F+ ++ +G+L L + L +     + + V+  D G P L
Sbjct:  335 MFRIDPRTGAIYINKALDFET----KELHELVVVAKDHGE------QPLETTAFVSIRVT--DVNDNQPTINVIFLSDDASPKISE-SAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTT-RDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHA-QWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELD----FERRSSYEFPVLATDRGGLSTTA--------MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQ----VNIEVEDVNDNAPEF----------------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSL 1016          

HSP 11 Score: 91.2781 bits (225), Expect = 4.631e-18
Identity = 138/628 (21.97%), Postives = 258/628 (41.08%), Query Frame = 2
Query:  371 NLEFHGSLIYKLSGPNCC-------FSIDQKSSVLTIAKNIDLESICINRELSSDC-SSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQR------IERHVSEASHKAGSHIFLET--ATDTDIAPENAQIEY-------GLAEHHKSFQLCLDQQR-QPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSV----------IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAF-------DREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL------EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLA-PA--TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPL 2101
            +++ + +L Y+L   +         F++D+ S  L + + +D E   + +E   D  +S   H           +   V+ VR++  D NDN P F  Q+      I   +SE S        L T  ATD D    N+++ Y       G + H  +  + ++  R QP +    D        Y ++I A +A      +   + +  +D      +F  + +   + E  P  S++ QL  +  D +      L   A NE    F +LQ+  ++L+   LD ER+  YK+ + ++                 +     L  N +            E+ E +     I Q+   D D   T    +           + ++SG ++ + T D+ T   F       D    S   ++  C    ++     L S     +++ D NDN PKF  ++Y   +AEN P+G+ + + +A DLD G  G+++YS+      E  + +F++DS +G++T     D E ++ Y + + A D G     +SV + + ++  ++ +P      + F +   +A P    +GQ+   DSD G +  VV+  + P+    +   +G + I + L
Sbjct: 2453 DVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE---LQQEYELDVIASDAAH-----------EARTVLTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD--------YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNE-ESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVV----------YDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRAC----DSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKL 3032          

HSP 12 Score: 90.1225 bits (222), Expect = 1.068e-17
Identity = 106/423 (25.06%), Postives = 179/423 (42.32%), Query Frame = 2
Query: 1424 SGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLA-PATIGQLQYEDSDIGRNADVVFSKTWP-------NDDTVMIT---------VNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLI--NPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYI---GHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGS 2617
            S ++++ LT    +  A    + ++I VVL+      T+    L S   + +++ D NDN PKF Q Q+ A V+E    GT + +V+A+D D G N ++ Y +    HD +     + +G++     +DRE+++ YKL I A D G   +  +  + + + DVNDN P        +V E     A I  +   D D           T+P        + TV I           +G L + + LD E +  + L V   D     R      + +RV D NDN P  +   P     I  A S   S+S+S+       + +  + A D D   N     +I+ P     + FS + + G +S++       +   G Y +++  KD+G P L    +              ++Q+N+ GS
Sbjct: 2266 STRSQRALT---SSSFALTNSQPNEIRVVLVA----RTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVD-----------TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV----LTVRVNDENDNAPVFLAQQPPAYFAILPAIS-EISESLSVD------FDLLTVNATDADSEGNNSKVIYIIEPA---QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLL-------------RVQANDNGS 2643          

HSP 13 Score: 74.3294 bits (181), Expect = 7.289e-13
Identity = 175/685 (25.55%), Postives = 294/685 (42.92%), Query Frame = 2
Query:  536 LELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL-AEHHKSFQ----LCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNS----SLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNE--------LRKLFSV-LQNGTVILISSWLD--YERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSS--QISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF-RQSQYFAHVAENGPIGTVILKVNAYDLD--DGLNGKIHYSLE--HDFSLFQIDSTTGVITVQGPVDREL-KEHYKLHIHAVDSG-SIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVREN-LAPATIGQLQYEDSDIGRNADVVFS-KTWPNDDTV--MITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRV-IDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPL 2467
            L++I       Q+     +R+ ++DVNDN P F    +   VSEA+ + G+ I   +A D D  P    + Y L AE     +      LD+     L L   LD E Q  Y + + A +A    +     + + V+D NDN P F +    + F++L     PA S I + ++ D D  +V   D     NN          ++ FSV   NG V +  S L         Y V +   D      ++ ++L V   D      Q +QN    ++ E +  G V+ Q+    +D    +  +I  +E +     F L   K   ++          DRE++   ++ +VL    G    ++++ +S  ++ + ILD NDN P F R ++Y A ++E  P+   I ++ A D D  +  N ++ Y +   +D  +F ID  TGV+ V   +D +   + Y+L I A DS    PL S     + + D NDN P   LT +   + EN    +++ +    D D G    + +S    P+D++   M  V+   G +      D E + R+ + +   D G  G++ S   V +RV I+  D        R  R +     PAA       V    GYV+ Q+ A D D   + ++ Y +  P++     F  N ++G + + + L
Sbjct: 2396 LKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVT-VSEAT-ELGAVITSISANDVDTYP---ALTYRLGAESTVDIENMSIFALDRYSG-KLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQQPPAYFAIL-----PAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL---GQDALDQSLAIIAGNEESA----FELLQSKAIVLVK-------PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKAS---VAVRVEIESRDEFTPQFTERTYRFV----LPAA-------VALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKL 3032          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 186.037 bits (471), Expect = 5.066e-47
Identity = 204/785 (25.99%), Postives = 343/785 (43.69%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFH---GSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIE---RHVSEASHKAGSH-IFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLND-LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDST--SVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRT-----KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-------------EHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPATI-GQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQ-IFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMF 2551
            + ENEP+ R +  ++      G+N   +   G     L+     F +   S  + IA  +D E               +   E  V       L     +++ + DVNDN P F  +  +   R   +AS +A S  I    ATD D      Q+ Y +   +++    +D+       +  D L    Q  +++ I A +  + +   +  V L + D    PP F  + ++  VKE+ P  +++  +IA   D    S +R+ +Y   + +    FS+  N   I I+  LD+E   +  + +  T G   +Y   + + + VED ND +P+   +   I V E++  G  +      DKD S ++G++            +SL     K +   D R+         D E S + ++++  +DG   S    L+++ TI V + D NDNPP F + +Y  +V+E+  I   I++VNA DLD G N +I Y +               D S  F I   +G I ++ P+DRE ++ Y+L + A D+G+   ++   + + V D NDN P    + +EF + ENL   ++ G +   D D+G NA + +S    N    +  V G +   +PLDRE ++ + L V  RD G    R +   V I V DVNDN P + +P+                +S+   Q PG  + ++ AVD D   N  +TY I+         +FS + T+G +     L H     Y + V+  D G+PP    +M 
Sbjct:  620 VAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLT----EFEVRSASGEICIAGELDFER--------------RSSYEFPVLATDRGGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYG-NFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIY---SGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVY-GHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKD-SGSSGQVT-----------YSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPS----LSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQG-TPVRSARVPVRIHVSDVNDNAPEIADPQ-------------EDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRML 1351          

HSP 2 Score: 162.155 bits (409), Expect = 1.333e-39
Identity = 213/783 (27.20%), Postives = 334/783 (42.66%), Query Frame = 2
Query:  419 CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDL----------DAENQTHYLIKIRAWNAQDN---KQWNELNVDLYVDDFNDNPPRF---NSS---LFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWL----DYERHQRYKVPVFVTD-GLYEARSXXXXX---XXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLIC---------------------SDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQ-SQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD--FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNIT--VDDVNDNSPCL-LTPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKP 2575
              F ID+ S  L +A+ +D       RE+ S+    +  +  +    SN    + + V+I V DVNDN P++ +  I+  VSEA+   G+ I   TATD D    N  ++Y L  +    QL   Q++   LF ++ L          D E    YL+ ++A +   N   +    + V L + D ND+ P F   NSS     S+ + + T    ++  ++A D DS    +     T  N   +     Q G + L+ S      D E+  R+ + +   D G  E +     L   V+  ++  P+ +Q      ++EN   G  + QV                 H      L + + +G    +   D     I T+  FDRE  SQ S VL                       SD    ++N       TI + + D NDN P+FR  S Y   V EN   G VI  V A DLD+G N  + YS+      + F IDS++G ++ + P+DRE    Y L I A D G  P +     NIT  V+D NDN+P   L+ +  SV+E+ AP   ++ Q+   D+D+G NA +V+S    N+      ++G    +     LDRE +  +   V   D G    R ++  V I V+D+NDN+P       + ++     PA  Q         PG  + ++ A+D D   N ++ Y +   N+  S  F  N +TG LS  + L+        ++V  +D G+PP     +  L I   P
Sbjct: 1424 AAFDIDRHSGNLVVARLLD-------REVQSEF---RLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEAT-PVGTIIHNFTATDADTG-TNGDLQYRLIRYFP--QLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAK------------SLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRE--SQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEGPNADLIYSITGGNLGNKFSIDSSSGELSAR-PLDREQHSRYTLQIQASDRGQ-PKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED-APLGTSVVQISAVDADLGVNARLVYS--LANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQV-----PALIQ---------PGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAP 2158          

HSP 3 Score: 160.614 bits (405), Expect = 4.091e-39
Identity = 163/581 (28.06%), Postives = 270/581 (46.47%), Query Frame = 2
Query:  551 NLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIA---PENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVME---NSGKGLVI-GQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD--------IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFE--FSVRENLAPAT-IGQLQYEDSDIGRNADVVFS--KTWPNDDTVMITVNGTLYITKP---LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP 2224
            NL SN   +    V +S++D     P F K R   +V E   + G+ +    A   D+A   P    I  G  + + S +      R     +   LD E ++  L+ I+A   +    +    V++ V+D NDN P F +S+  + V E+    + ++   A+D DS S  +   Y       + LF++      +++S  LDYE  QR+ + V  TDG   + S    ++ D  D +     NP V E  E   N  +   I  Q+I  +  D  T       +   +  ++   +S  +  +  +         I  +   DRE   +  + ++ +D    +A+    +   + V++LD NDN PKF++S+Y   + EN   G+V+  V A DLD G N  I YSL    S FQ+   TG I+ + P+DREL+E Y L + A D G+   ++ V + I V DVNDN+P +  P E   SVRE   P T + +++  D D G+NA + +S  K   +D   + +++ T  + +    LD E +  + L V   D G N  R++   + + V+D+NDN+P
Sbjct:  804 NLRSNADAV----VFLSIIDAMQRPPIFEKARYNYYVKEDIPR-GTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIR-----IAKPLDHEAKSQVLLNIQATLGEP-PVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKDSGSSGQV-TYSLVKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVN----DNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAH----AKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGG-NPPRETVRMLRVEVLDLNDNRP 1363          

HSP 4 Score: 159.844 bits (403), Expect = 5.945e-39
Identity = 182/682 (26.69%), Postives = 305/682 (44.72%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH--KSFQLCLDQQRQPYLFL----LNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQL----IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILT------YDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL----EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPF-EFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITV---NGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPR----GLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKP--LSHHYIGHYPIKVSVKDSG 2521
            +RV ++V D NDN P F +  +     E + +      L  A D D+ P N Q  Y +   +   +F+L   ++R   L+L       LD E    Y + I A +         + V++ + D NDN P FN S +   V EN    + + Q+ A+D D+    ++ + + +  +++  ++F +      I I+  LD+E  + +++ V   D      E  + + + V D ND  P +    + + +  ++ E++  G  + ++ V D D            +T    +  +L+ G     LT      Y +      DRE  S  ++ ++ +D         L +S +I ++I D NDNPP+F Q  Y A+V E    GT +L+V A+D D+GLN  + YSL    E     FQID  TG+IT +  +D E +   +L + A D G  PL+S+  + +T+ DVNDN P     F   SV EN      I ++   D D G NA V ++            V   +G + I   LD E +  +   V   D    G   ++  + +++ DVNDN+P +  PR     LRE   A+S A+S              I  ++A D D     +++Y I+  N   + IF  + +TG + + +P  LS      + + +S  D G
Sbjct:  158 IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLL-PARDLDLEPYNTQ-RYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDK-EQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDS-----------KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPP----LHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATD---RGGLSTTAMIKMQLTDVNDNRP-VFYPREYKVSLRESPKASSQASSTP------------IVAVVATDPDYGNFGQVSYRIVAGNE--AGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG 803          

HSP 5 Score: 148.673 bits (374), Expect = 1.822e-35
Identity = 172/694 (24.78%), Postives = 301/694 (43.37%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQL----CLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVL-VKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI-LTYDIRTKTA-------FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----------EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGS---IPLNSSVGLNITVDDVNDNSPCLLTPFEFSVREN---LAPAT-----IGQLQYEDSDIGRNADVVFSKTWPNDDT--VMITVNGTLYITKPLDRETKD-----RHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDS 2518
            A  RV + VLD NDN P+F K + E  + E + + GS + + TA+D D+  ENA I Y L   + SFQ+         R+P       LD E +  Y + + A +     +   + V ++V D NDN P        V+ V+E  P  + + ++ A D D    + + + + +  +++   LFS+     VI     LD+E    Y++ V  +DG    R  + +L  +  D +   P    +  V  V E++  G V+G +   ++        +  E    + R+ ++L+      I   +DI   +         DRE  S+  + +   D   T++N   +S+ T+ +++ D NDN P++ Q      V+E  P+GT+I    A D D G NG + Y L           E   SLF++DS TG +++Q P+D E  + Y L + A+D  S     L +SV + + + D ND++P  ++P     +     ++ AT     +  +   D D G N  + +  T  N +    + +  G + + K L   T+D     R  L +  +D+G    ++SS  + + V   ++N PR +               A    +I      G  + Q+ A     A N  L+Y I  P  + + +F  +   G ++            Y + V V+D+
Sbjct: 1135 AKTRVIVRVLDANDNDPKFQKSKYEFRIEE-NLRRGSVVGVVTASDLDLG-ENAAIRYSLLPINSSFQVHPVTGEISTREP-------LDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSV--EESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALD--TTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQ--------------AVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI--PAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDA 1799          

HSP 6 Score: 138.658 bits (348), Expect = 1.850e-32
Identity = 170/679 (25.04%), Postives = 285/679 (41.97%), Query Frame = 2
Query:  572 LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHK-SFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFN----SSLFSVLVKENTPARSMIFQLIANDPDS-TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG----LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQ--------LQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKP--LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            L   + V I++ DVNDN P F++ R    V E +   G+ +    A+DTD A EN  +EY +        Q+     R   +++   LD E +  + + + A +  +        V + V D NDN P  N    S   S  + E+      + ++  +DPDS T     ++     +    L +   +  ++++   LD E    Y + V  TD     L+ ++S+   + +  ++  P+  Q+     VME +  G  + QV+  D+D+   +       ET E   ++     +   I T   R+    + E   Q++VV    DG        L+S+ T+ V I D NDN P F QS Y   VAEN P+G  ILKV+A D D G+N  ++Y++   F   + F++ S +G I + G +D E +  Y+  + A D G +   + + + +T  DVNDN P    P E+ V    +P    Q        +   D D G    V +     N+  +  +    G +++ +P  L   T+  H L +   D G N R  +   V + +ID     P     R    + +                  G V+  +IA   D A  + + Y I   +  P   FS  + +G + + KPL H       + +     G PP+
Sbjct:  266 LRGFMTVNITIQDVNDNQPIFNQSRYFATVPENA-TVGTSVLQVYASDTD-ADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDN-PPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITT---RSHIDCETEPVPQLTVV--ARDGGVPP----LSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIKMQLT--DVNDNRPVFY-PREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGG-NLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDI--------------PRGTVVGSVIAASGDVAHRSPVRYSIYSGD--PDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQAT-LGEPPV 911          

HSP 7 Score: 137.887 bits (346), Expect = 3.612e-32
Identity = 170/671 (25.34%), Postives = 282/671 (42.03%), Query Frame = 2
Query:  332 VGTIATDIEGLGINLEFHGSLIYKL-----------SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNL--WSNV--QLLAVVRVRISVLDVNDNIPQF------SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDL-----DAENQTHYLIKIRAWN-AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG----------LYEARSXXXXXXXXXXXX----------------SPQLIQNPSV-IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSS-VGLNITVDDVNDNSPCL-LTPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDD-TVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNG 2155
            VGTI  +      +   +G L Y+L                 F +D  +  L++   +D E++             Q +L ++  L   SNV  +L   V VR+ +LD ND+ P F        +     +S+A+ + G  +    A D D + +N Q+ Y +   +   +  ++ Q    + L+  L     D E    + + I A +  Q   + + LN+ L V   ++NPPRF  +++   + EN P+ S + Q+ A             Y+        LF V     +I      D E    Y +PV+V D           + + RS   +                        SP+        + V ENS  G VI  V+ +D D+   N  +I          +FS+ S   +        +    DRE+ S+ ++ +  SD G   S   H      I + + D NDN P+F+ S+Y   V E+ P+GT +++++A D D G+N ++ YSL ++    F ID  +G+IT  G +DREL+  Y   + A D G   + S+ V + I V D+NDN P     P+   V   + P  T+ ++Q  D+D+G NA++V+S    N   +    +N   G L  ++ L  E+     L V  RD G
Sbjct: 1500 VGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAV-------------QEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDAT-RIGEVVAHIVAVDED-SGDNGQLTYEITGGNGEGRFRINSQTG-IIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLS-YEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPG-VIHTVVASDLDEG-PNADLIYSITGGNLGNKFSIDSSSGEL-------SARPLDREQHSRYTLQIQASDRGQPKSRQGHCN----ITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKG 2140          

HSP 8 Score: 116.316 bits (290), Expect = 1.304e-25
Identity = 122/409 (29.83%), Postives = 178/409 (43.52%), Query Frame = 2
Query: 1448 TYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----EHDFSLFQIDSTTGVI----TVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFS-VRENLAPATIG----QLQYEDSDIGRNADVVFS-KTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL-DKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT---NKPAKYDDKLQSNN 2608
            T +IRTK   DRE  +  S+V I   G N            + V + D NDN P F Q+       EN P       + A DLD        Y++        F L       GV+     + G +DRE    Y L I A+D G+ PL   + +NIT+ DVNDN P       F+ V EN   AT+G    Q+   D+D   N  V ++     +D   M  ++   G +YI K LD ETK+ H L V  +D+G     +++  V IRV DVNDN+P +     +  + D  SP  S+S        PG  + + I+V D D+       ++ L         +    + YL +   PL    + +Y + V   D G+PPL   K  +L IT   + P +++  L   N
Sbjct:  129 TGEIRTKVKLDRETRASYSLVAIPLSGRN----------IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPEN---ATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHG-EQPLETTAFVSIRVTDVNDNQPTI----NVIFLSDDASPKISES------AQPGEFVAR-ISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHAN 512          

HSP 9 Score: 115.931 bits (289), Expect = 1.624e-25
Identity = 161/580 (27.76%), Postives = 265/580 (45.69%), Query Frame = 2
Query:  572 LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDL--YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQN---------PSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDI-RTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLN------ITVDDVNDNSPCL--LTPFEFSVRENLAPA--TIGQLQYEDSDIGR--NADVVFSKTWPNDDTVMIT--VNGTLYITKPLDRETKDR-HCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            L +   + I + D NDN P+FS+++    VSE ++K G+ +    A D+D A  NA++ Y + + +      ++      +     LD E +  Y +KI A +    +      + + + D NDN P F  +   V V E T   ++I  + AND D+   L + L    T + E   +F++ +    +++   LDYE  Q Y++ V  +D  +EAR+VL V V DEND +P  +           P++ E+ E+      +  V  TD D    N K+I   E  +       S+G    +++ ++ R + A     S    V +I  D    +    L SS  + VQ  D      +F Q+QY A ++E  P+G+V+L++    LD  L   I  + E  F L Q    +  I +  P+DRE  + YKL +        PL SS+  +      IT+ D NDN P       +E  + E LAP   +I QLQ  D+D     N++VV+  T  ND+ +     V G L++   LD ++  + + L +R  D+       S     + + D NDN+P+ 
Sbjct: 2302 LASYAELVIELEDENDNSPKFSQKQFVATVSEGNNK-GTFVAQVHAFDSD-AGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNG----VVSVNMSRLQPAV--SSSGDYFVRIIAKDAGKPA----LKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSL-AIIAGNEESAFELLQ----SKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISE-LAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKF 2862          

HSP 10 Score: 113.235 bits (282), Expect = 9.661e-25
Identity = 174/731 (23.80%), Postives = 302/731 (41.31%), Query Frame = 2
Query:  422 CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQ----FSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN-DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIG-----TVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGP--VDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPATI-GQLQYEDSDIGRNADVVFS--KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVR--LRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSP--GYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
             F ID ++  + I K +D E+    +EL       + H E        ++  A V +R++  DVNDN P     F        +SE S + G  +   +  D D   E A +   L      F L   +    YL +++  LD E  ++Y + + A +          ++ L + D NDNPP F   L+   V E     + + Q++A+D D    S L + L +T      + F +     +I   S +D E     ++ V   DG     S    ++   +D +   P   Q+   + V EN   G  I +V  +D D            E  +   EF + S   +  +  ++     F+R  S +  V+     G +T+A         I +Q+ D NDN P F   +Y   + E+         T I+ V A D D G  G++ Y +   ++  +F+ID +TG I V  P  +    +  + L+I A D G++  N+   + +++ D     P      + + V+E++   T+ G +     D+   + V +S     P+    + T +G + I KPLD E K +  L ++  L +  + G  Q    V I V DVNDN P                   +  + ISV +S   G  +    A D D  ++ ++TY ++  +     +F+ ++ +G+L L + L +     + + V+  D G P L
Sbjct:  335 MFRIDPRTGAIYINKALDFET----KELHELVVVAKDHGE------QPLETTAFVSIRVT--DVNDNQPTINVIFLSDDASPKISE-SAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTT-RDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHA-QWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELD----FERRSSYEFPVLATDRGGLSTTA--------MIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEAKSQVLLNIQATLGEPPVYGHTQ----VNIEVEDVNDNAPEF----------------EASMVRISVPESAELGAPLYAAHAHDKDSGSSGQVTYSLVKESG--KGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSL 1016          

HSP 11 Score: 91.2781 bits (225), Expect = 4.631e-18
Identity = 138/628 (21.97%), Postives = 258/628 (41.08%), Query Frame = 2
Query:  371 NLEFHGSLIYKLSGPNCC-------FSIDQKSSVLTIAKNIDLESICINRELSSDC-SSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQR------IERHVSEASHKAGSHIFLET--ATDTDIAPENAQIEY-------GLAEHHKSFQLCLDQQR-QPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSV----------IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAF-------DREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL------EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLA-PA--TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPL 2101
            +++ + +L Y+L   +         F++D+ S  L + + +D E   + +E   D  +S   H           +   V+ VR++  D NDN P F  Q+      I   +SE S        L T  ATD D    N+++ Y       G + H  +  + ++  R QP +    D        Y ++I A +A      +   + +  +D      +F  + +   + E  P  S++ QL  +  D +      L   A NE    F +LQ+  ++L+   LD ER+  YK+ + ++                 +     L  N +            E+ E +     I Q+   D D   T    +           + ++SG ++ + T D+ T   F       D    S   ++  C    ++     L S     +++ D NDN PKF  ++Y   +AEN P+G+ + + +A DLD G  G+++YS+      E  + +F++DS +G++T     D E ++ Y + + A D G     +SV + + ++  ++ +P      + F +   +A P    +GQ+   DSD G +  VV+  + P+    +   +G + I + L
Sbjct: 2453 DVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYE---LQQEYELDVIASDAAH-----------EARTVLTVRVN--DENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD--------YFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQS------LAIIAGNE-ESAFELLQSKAIVLVKP-LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVV----------YDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRAC----DSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGG--KKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFKVNRSSGAVLIKRKL 3032          

HSP 12 Score: 90.1225 bits (222), Expect = 1.068e-17
Identity = 106/423 (25.06%), Postives = 179/423 (42.32%), Query Frame = 2
Query: 1424 SGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLA-PATIGQLQYEDSDIGRNADVVFSKTWP-------NDDTVMIT---------VNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLI--NPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYI---GHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGS 2617
            S ++++ LT    +  A    + ++I VVL+      T+    L S   + +++ D NDN PKF Q Q+ A V+E    GT + +V+A+D D G N ++ Y +    HD +     + +G++     +DRE+++ YKL I A D G   +  +  + + + DVNDN P        +V E     A I  +   D D           T+P        + TV I           +G L + + LD E +  + L V   D     R      + +RV D NDN P  +   P     I  A S   S+S+S+       + +  + A D D   N     +I+ P     + FS + + G +S++       +   G Y +++  KD+G P L    +              ++Q+N+ GS
Sbjct: 2266 STRSQRALT---SSSFALTNSQPNEIRVVLVA----RTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATELGAVITSISANDVD-----------TYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEARTV----LTVRVNDENDNAPVFLAQQPPAYFAILPAIS-EISESLSVD------FDLLTVNATDADSEGNNSKVIYIIEPA---QEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLL-------------RVQANDNGS 2643          

HSP 13 Score: 74.3294 bits (181), Expect = 7.289e-13
Identity = 175/685 (25.55%), Postives = 294/685 (42.92%), Query Frame = 2
Query:  536 LELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL-AEHHKSFQ----LCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNS----SLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNE--------LRKLFSV-LQNGTVILISSWLD--YERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSS--QISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF-RQSQYFAHVAENGPIGTVILKVNAYDLD--DGLNGKIHYSLE--HDFSLFQIDSTTGVITVQGPVDREL-KEHYKLHIHAVDSG-SIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVREN-LAPATIGQLQYEDSDIGRNADVVFS-KTWPNDDTV--MITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRV-IDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPL 2467
            L++I       Q+     +R+ ++DVNDN P F    +   VSEA+ + G+ I   +A D D  P    + Y L AE     +      LD+     L L   LD E Q  Y + + A +A    +     + + V+D NDN P F +    + F++L     PA S I + ++ D D  +V   D     NN          ++ FSV   NG V +  S L         Y V +   D      ++ ++L V   D      Q +QN    ++ E +  G V+ Q+    +D    +  +I  +E +     F L   K   ++          DRE++   ++ +VL    G    ++++ +S  ++ + ILD NDN P F R ++Y A ++E  P+   I ++ A D D  +  N ++ Y +   +D  +F ID  TGV+ V   +D +   + Y+L I A DS    PL S     + + D NDN P   LT +   + EN    +++ +    D D G    + +S    P+D++   M  V+   G +      D E + R+ + +   D G  G++ S   V +RV I+  D        R  R +     PAA       V    GYV+ Q+ A D D   + ++ Y +  P++     F  N ++G + + + L
Sbjct: 2396 LKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVT-VSEAT-ELGAVITSISANDVDTYP---ALTYRLGAESTVDIENMSIFALDRYSG-KLVLKRRLDYELQQEYELDVIASDAAHEARTV---LTVRVNDENDNAPVFLAQQPPAYFAIL-----PAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQL---GQDALDQSLAIIAGNEESA----FELLQSKAIVLVK-------PLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKAS---VAVRVEIESRDEFTPQFTERTYRFV----LPAA-------VALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSH----FKVNRSSGAVLIKRKL 3032          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 185.652 bits (470), Expect = 8.255e-47
Identity = 183/688 (26.60%), Postives = 301/688 (43.75%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQP-----YLFL--LNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYK---------VPVFVTD---GLYEARSXXXXXXXXXXXXSPQL-----IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVR-------ENLAPATIGQLQYE-DSDIGRNADVVFS------KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL--DKPLSHHYIGHYPIKVSVKDSG 2521
            + VRI VLDVNDN P+F +  I    SE S  +G+ + L+ ATD D+       +Y +   +   +  L     P     YL L    +LD E++  Y + I A +     ++  L V++ + D NDNPP F+ S ++V + E     + +  ++A+D D     +   Y     E    F+V     VI  +  ++  +    K           VF  D      + R+ + V + D ND  P +          V  V EN+  G V+  V V D D S  NG+      +      F L    +  I    +R     DRE+  + ++ ++  D   T A    T++  + + + D ND+ P F +S+Y A ++E  P G+ +  + A D D G+N ++HY +   ++   F +D  TG+I   GP+DRE+++  +L I A D G  P  +   L + + D ND +P      +FS R       E+  P TI  L    D D G N  V F+      + +P     +  + G L   +PLDRE   ++ + V  RD G    + ++  V + V DVNDN P+      +  +           I +        ++  + A D DD  N  + Y +    +    +F  ++ +G +SL  D P S H+  HY + VS +D+G
Sbjct:  140 IEVRIKVLDVNDNSPEFPEPSIAISFSE-SATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLA---ETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSD-SGLNGRTSVRIVSGNELGHFRLEEAADLHI----VRVNGVLDREEIGKYNLTVVAMD-QGTPAR---TTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAP------QFSQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPL-QFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSL-----ADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRL---ESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAG 799          

HSP 2 Score: 158.688 bits (400), Expect = 1.627e-38
Identity = 195/762 (25.59%), Postives = 327/762 (42.91%), Query Frame = 2
Query:  380 FHGSLIYKLSGPNCC--FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELR----KLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX------SPQLI-QNPSVIEVMENSGKGLVIGQVIVTDKD-DSQTNGKMICEHETTEPRLEFSLSSGKNKKILTY--------DIR-------TKTAFDREK-SSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQ-SQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS---------LFQIDSTTGVITVQGPVDREL-KEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
             +G + Y L+  N    F++D  +  L++ + +D ES  I+  +     +   H      L SN        + I VLD NDN P+F++   E  V E S   G+ +    A+D D    N+Q+ + ++  ++     +D      L+L   LD E+ T Y + I A +         +  ++ V D NDNPP F S+     +KE  P ++ I  + A+DPDS    +   Y  +  E +    + F +     VI     +D E    +++ V  TD    +   L                +P  +  N +++    ++ KG     + V  KD DS +NG ++     + P+  F L   +N  I+T+        ++R       T  A   E+ SS++ + +I      + +++                   P+F Q S+    V EN PIGT IL V A+      + +I Y + +  +         LF ID+  G+++    +DRE   E Y++ ++A+  G  P  S   + +TV D ND+ P  L TPF ++V E+L    TI  L+  D D      V F     +D   ++  + G L +   LDRETK ++ LR+R+ D    G + +     I+V D NDN P   +                 S  I      GY + Q++A D D   N +L+Y ++  +   + +FS N  TG L+L   L +  + HY + V  +D+G P L
Sbjct: 1309 LNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKH-----PLSSNAS------ITIVVLDENDNAPEFTQSSSEVSVLETS-PTGTELMRFRASDADQG-VNSQVVFSISAGNRRDTFHIDSITGS-LYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVS-YAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNG-LVTYEIVSGPQELFKLQ--RNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSV-------------------PQFEQRSKLSGSVYENEPIGTSILTVTAH----LASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT--LGSVTFLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD----GVQYTEAYATIQVSDTNDNPPLFED--------------TVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVV--SDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSL 2007          

HSP 3 Score: 144.821 bits (364), Expect = 2.371e-34
Identity = 200/728 (27.47%), Postives = 296/728 (40.66%), Query Frame = 2
Query:  539 ELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWN---ELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL--YEARSXXXXXXXXXXXXSPQLIQN-------------------------------PSVIE-----VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR---------LEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSG-SIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPATIGQL----QYEDSDIGRNADVVFSKTWPNDDTVMITV-NGTLYITKPLDRETKDRHCLRVRLRDNG---LNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQ---SPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDS 2518
            EL + +   VQ        I V D NDN P F        + E + + G  +    A D D+  +NAQ+ YG+     +    L+ Q    L L   LD E   HY++ ++A   QDN Q +    + V   V D NDN P F+   +S  V EN P  + +  + A D DS +    + Y     ++   F +  NGT I     LD E    Y + V   D    + + S LE         SP+  Q                                P  I      +MEN     V+  V   D D+ + NG +  ++   E R         L FSL+    +      +R   A DRE  S   + +   D          ++   + ++ILD NDN P F   QY A VAEN  IG ++L+V+A D+D+G NG+I YS+      HDFS   I   TGV+ V   ++ E    Y L + A D     P   +  L I + D+NDN P  L +P+   V EN  P   G +     Y+      N+ V +     + D   I   +G + + KPLDRE +  + L +   D G   L G    +G V + V D+NDN P       + E+         QS   +V +   S  +V+T   A D D+  N KL +++L  +      F  +S TG +S    L       Y + +  +DS
Sbjct: 1892 ELRIRVSDGVQYTEAY-ATIQVSDTNDNPPLFEDTVYSFDIPENAQR-GYQVGQIVARDADLG-QNAQLSYGVVSDWANDVFSLNPQTG-MLTLTARLDYEEVQHYILIVQA---QDNGQPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIE-YSITAGDVDSEFGIDSNGT-IRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVVIAVKAVDNDEGR-NGYI--DYLMKEARDEDMGQSDPLPFSLNPTDGQ------LRVVDALDRELRSSYLLNITARDRGEPPQ----STESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFS---ISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTG----TGIVRVEVQDINDNDP-------VFEL---------QSYHATVRENLPSGTHVLTPR-ATDKDEGLNAKLRFNLLGEHM---HRFHIDSETGEISTATTLDREETSVYHLTLMAQDS 2570          

HSP 4 Score: 142.124 bits (357), Expect = 1.887e-33
Identity = 152/513 (29.63%), Postives = 227/513 (44.25%), Query Frame = 2
Query:  569 QLLAVVRVRISVLDVNDNIPQF---SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLND----------LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXX----XXXSPQLIQNPSVIEVMENS--GKGLVIGQVIVTDKDDSQTNGKM-ICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSG-SIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS 2032
            +L + V+V I + DVND +P F   ++  I  +V+       + +    A D D    N  I+Y + E           Q  P  F LN           LD E ++ YL+ I A +  +  Q  E  + + + D NDN P F+   +S  V EN    +M+ Q+ A D D  +  R   Y     +    FS+ ++  V+ ++  L+YER  RY + V   D   E  +     +       ND  P  + +P +  VMEN+    G  +  V   D D    N ++     E        + SSG        DI      DRE+ S+ ++ L+  D    + +  LT +  + V++ D NDN P F    Y A V EN P GT +L   A D D+GLN K+ ++L  EH    F IDS TG I+    +DRE    Y L + A DS  + P  SSV L I+V DVNDN P    T +  +V E ++    +   +  D D G NA V ++
Sbjct: 2146 RLSSTVKVTILIKDVNDEVPVFISANETAIMENVA-----INTVVIAVKAVDNDEG-RNGYIDYLMKEARDEDM----GQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRI-RYSIVLGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSG--------DIALLKPLDREQQSEYTLTLVAMD----TGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEH-MHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYT 2634          

HSP 5 Score: 140.969 bits (354), Expect = 3.561e-33
Identity = 187/754 (24.80%), Postives = 311/754 (41.25%), Query Frame = 2
Query:  332 VGTIATDIEGLGINLEFHGSLIYKLS-GPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQ----QRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXX---XXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSA---NIH-LTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTW-PNDDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNG-LNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            +G+    +    ++L  + +  Y  S  P   F I+ +S  +T+A ++D E               Q    ++  + S+    A   + I++ D NDN P+F          E   ++ + +    ATD D    N+ I Y L +    F +         ++   F  +      +  Y + + A +      ++E  V++ + D ++NPP+F  + +   + ++      I ++ AND         D Y      L  +FSV ++   I +   +    + RY++ V  TD     +S    +V     EN ++P+   N   + V EN   G  I  V  TD DD+  NG            L +S+S G  ++  + D RT     ++   Q+   LI     N +      H L+S   + + + D NDNPP F   +Y  ++ EN P+GT + + +A D D   N  IHY+      D   F ++ + G I+     D E +  Y L I A +  S  + S   L + V  VN+  P  L P F F V E  A  T +G +Q  D D G +  V +      ND    I  N G +Y+ + LDRET++R  L V  ++ G + G      +V I + D ND  P  I       I +A +P  ++             +T + A+D D  T N + +Y I+  N    Q F  +  TG +S    L       Y + +   D+G PP
Sbjct: 2927 IGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDRE---------------QQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPEL-QQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMD-YSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATD-DDTGPNGM-----------LRYSISGGNERQDFSVDERTGGIVIQQ---QLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS-SMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEA-APVGTK-------------VTTVKAIDKDVRTQNNQFSYSIINGNL--KQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPP 3630          

HSP 6 Score: 135.576 bits (340), Expect = 1.578e-31
Identity = 209/787 (26.56%), Postives = 335/787 (42.57%), Query Frame = 2
Query:  302 IQENEPIDRMVGTI-ATDI-EGLGINLEFH--GSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAV-VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN-DLDAENQTH----YLIKIRAWN--AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISS-WLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSP---QLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPF-EFSVRE-NLAPATIGQLQYEDSDI-GRNADVVFSKTWPNDDTVMITVNGTLYITKPLD-------RETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            ++EN P    V T  ATD  EGL   L F+  G  +++       F ID ++  ++ A  +D E   +             HL L+    S  +  A  V + ISV DVNDNIP+F        V E   K G  +F   A D D   ENA + Y ++   + +    D   +  +     +L  + ++H    Y I I A +   Q      EL V L   +         +S F++   E+     MI ++ A  P    V +   Y  A   +     V  N  ++ +    LDYE    Y++ +   DG      + +++ + V D ND +P   QLI N    EV+E      +I  V  +D+D S  NG +I        RL+     G  +   + +I T+   DRE+    + V+   D        H+T + ++ + +LD NDNPPKF +  +  +V EN  IG+ +++V + DLD G N    YS  E+    F+I+  +G ITV G +DRE ++ Y L + A D       +   + IT+ D NDN+P     F  FS  E   + A +GQ+   D D  G N+ + +S   P+    +    G ++  K +        R  ++ + L V   DNG      S   V I ++D ++N P+        E  +  +P    ++        G  I ++ A D  D    ++ Y ++  N   S IFS     G+++L KP+       Y + V   D G PP  DE    + +T +
Sbjct: 2500 VRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR-------FHIDSETGEISTATTLDREETSVY------------HLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISK-GEFVFGARALDLDDG-ENAVVHYTISGRDQHY---FDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAM--SEDVRPGKMITKVSATSPKKGLVGKI-RYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYN---AEVLEEESPPQLIAVVKASDRD-SGDNGNVIY-------RLQNDFD-GTFEITESGEIYTRMRLDREEIGDYAFVVEAVD----QGVPHMTGTASVLLHLLDKNDNPPKFTR-LFSLNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNG-KPPLYSECLVNINIVDAHNNPPKF-------EQAEYLAPLPQDAVR-------GQRIVRVHANDKQDLGTNEMDYSLMTFNL--SSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGE 3222          

HSP 7 Score: 134.035 bits (336), Expect = 5.244e-31
Identity = 174/703 (24.75%), Postives = 291/703 (41.39%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL-AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQ-DNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYE----RHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR------LEFSLSSGKNKKILTYDIRT------KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIG----QLQYEDSDIGRNADVVFSKTW-PNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVD-DDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGH-------YPIKVSVKDSGSPPLIDEKMFYLFIT---NKPAKYD 2587
            VR+ V D+NDN P F  Q     V E +  +G+H+    ATD D    NA++ + L  EH   F +         +     LD E  + Y + + A ++     + + +N+ + V D NDN P+F+S+ ++V V E       +F   A D D    +V+ +    T +   +  F +  N    ++S+ L+ +     H      + ++      +S+            P+L         M NS   +           +    GKMI +   T P+      + ++++ G     L  D  +      +   D E +    + +  +DG   S    L S   I + + D NDN P   Q  Y A V E      +I  V A D D G NG + Y L++DF   F+I + +G I  +  +DRE    Y   + AVD G   +  +  + + + D NDN P     F  +V EN   A IG    ++   D D+G NA+  +S +  P +   +   +G + +   LDRE +D + L+V   D    G  ++   + I + D NDN P   +          + P   QSI++         + Q+IA D D    N+ ++Y +      PS +FS +  TG +   K +   +  +       Y + V   D+G PPL  E +  + I    N P K++
Sbjct: 2477 VRVEVQDINDNDPVFELQSYHATVRE-NLPSGTHVLTPRATDKDEG-LNAKLRFNLLGEHMHRFHI---DSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHY----TISGRDQHYFDI--NTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVILRPPELF---PTFAYMANSHFAM----------SEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPS----LRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEI-TESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSLNVTEN---AEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAGHLDREQQDEYILKVVASD----GAWRAETPITITIQDQNDNAPEFEH-----SFYSFSFPELQQSIAL---------VGQIIATDRDKQGPNSVISYSL----QQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFE 3125          

HSP 8 Score: 131.339 bits (329), Expect = 3.794e-30
Identity = 150/562 (26.69%), Postives = 244/562 (43.42%), Query Frame = 2
Query:  587 RVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVT--DGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAF-----DREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLD-DGLNGKIHYSLEHD--FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFS--VRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDN 2218
            RV I V   N + P+FS    +  V E +   GS I    ATD D  P N  + Y ++  ++     +D+ R   + +   LD +    Y + I   +   +   +   + + + D NDNPP FN   +   + EN P  + +FQ  A D DS   +++ +    +  +  R  F + Q+   I  +   DYE  + Y + +     D   E+ + L V V   N+  PQ +Q     +V E S  G  +G V  TDKD  +            + R+ + L    N K    D  T   +     DRE  +++ + ++  +  +   N    +   I++Q  D ND PP+F +  Y + ++E  P+GT +  V A D D    N +  YS+ +      F+ID  TG I+    +DRE    Y L I A+D+G  P   S  ++I ++DVNDN P   TP   +  + EN    T I  L   D D+ RN      +         ++V+   G +  T   DRE        + + D+G   +++S   + I V+D NDN
Sbjct: 3214 RVVIVVTGENMDTPRFSVNSYQVIVPE-NEPVGSTILTVGATDDDTGP-NGMLRYSISGGNERQDFSVDE-RTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPD--RHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDSSMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSGE------------DGRVYYLLVGSSNDKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQ--DGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPT-FTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVEDSG-KPKQKSQHLLTITVLDQNDN 3753          

HSP 9 Score: 130.954 bits (328), Expect = 4.344e-30
Identity = 104/394 (26.40%), Postives = 169/394 (42.89%), Query Frame = 2
Query: 1466 KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRE---------------------LKEHYKLHIHAVDSGSIP-LNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            +   DRE+    ++ + C D    S     +S   + + ++D NDN P+F  S +   + EN P  T + K+ A D D G N ++ ++L      F ID+  G I    P DRE                     +  +Y L    V    IP L   V + + V DVNDN+P  L  P+  ++ E  +  T I  +  +D+D G N DV +S    N+     + +  G L + + LDRE+++ H L V  +D  L     S+  + I V+D NDN P                  +S  +S+      G  + +  A D D   N+++ + I   N      F  +S TG L L KPL +  I  Y + ++  D G+P L    ++ + + +
Sbjct: 1108 RAPLDREERDYYALTVSCRDAGQPSR----SSVVPVVIHVIDENDNAPQFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQ--------------SSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNR--RDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVD 1481          

HSP 10 Score: 130.568 bits (327), Expect = 5.598e-30
Identity = 170/667 (25.49%), Postives = 273/667 (40.93%), Query Frame = 2
Query:  302 IQENEPIDRMVGTI-ATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLE-----SICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQF-SKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKS-FQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPK-FRQSQYFAH----VAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF--SLFQIDSTTGVITV-QGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL--LTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            + EN  I  MV  + ATD++  G N     S++  L   N  FSI + + V+ +AKN++ E     S+ +  E   DC+        + N   +   L      I++LD+NDN P F     + R +       G ++    A D D  P N+Q+ Y L E     F++         + LL  LD E Q+ Y + + A +           V + V D NDN P F    +   V+EN P+ + +    A D D    + LRF+L      E    F +      I  ++ LD E    Y + +   D  + E R+    L    +D +   P+       + V E   KG  +      D DD    G+    H T   R +          +++  +  KT          ++V+   D    S    L+S   + V +      PP+ F    Y A+    ++E+   G +I KV+A     GL GKI Y++         ++D  +G+++V Q  +D EL   Y++ I A D  +  L S   + + V D NDN+P +  L      + E   P  I  ++  D D G N +V++      D T  IT +G +Y    LDRE    +   V   D G+      +  V + ++D NDN P+ 
Sbjct: 2287 VAENASIGAMVLQVSATDVDE-GANGRIRYSIV--LGDQNHDFSISEDTGVVRVAKNLNYERLSRYSLTVRAE---DCA--------LENPAGDTAELT-----INILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGD---IALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLL----GEHMHRFHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDD----GENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQS----LSSKAELTVIL-----RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVP-HMTGTASVLLHLLDKNDNPPKF 2913          

HSP 11 Score: 127.487 bits (319), Expect = 4.713e-29
Identity = 202/794 (25.44%), Postives = 329/794 (41.44%), Query Frame = 2
Query:  299 LIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNC-CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIF-LETATDTDIAPENAQIEYGLA---EHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWN-AQDNKQWNELNVDLYVDDFNDNPPRFNSSLF---------SVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQR--YKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIE-VMENSGKGLVIGQVIVTDKDDSQTNG---KMICEHE---TTEPRLEFSL-----SSGKNKKILTYDI----------------RTKTA--FDREKSS--QISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF---RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQI--FSFNSTTGYLSLDKPLSHHYIGHYPIKVS 2506
            ++ E  P    V +I    E  G+N + H  +   LSG     FS+D  + ++     +D E I    ELS     G  + +            A  ++++ +LD ND  PQFS++  E++V+         I  L TATD D    N  + + LA   E     Q  LD      L     LD E  + Y I + A +      Q     V L V D NDN P+F    +          + +K+      ++  + A+D D       +    +  E   LF +      I +        H +  YK+ V   D   + RS                 Q  +++E V+++  + L  GQ        +Q  G   +M+ +HE    ++P  E  +     ++GK    + YDI                R  TA   DRE+ +  +++++   S   + +A+        +N+ I+D NDN P F   R+S+    + EN  +G  I      D D G+N +I YSL ++ +  F+I   TGV+ +Q P+  E      + + A D+GS PL+S + L++ + DVND++P    T +E S+ E     T    L   D D+G N  + +     N + +  +  +G L++  PLDRE +D + L V  RD G    R S   V I VID NDN P+  N              ++ + SI         + +L AVD D   N +L++      TL SQ   F+ ++  G++   +P     +    +KVS
Sbjct:  502 VLSELAPTGSFVASITATDEDTGVNAQVHYDI---LSGNELKWFSMDPLTGLIVTTGPLDRE-IRDTVELSISARDGGPNPKF-----------AYTQLKVIILDENDEAPQFSQR--EQNVTLGEDAPPQTIVALMTATDHDQG-TNGSVTFALAPSVERLYPLQFALDALTG-QLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGE--GLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDA-GQRRS-----------------QQDAIVEIVLKSKLEMLECGQ--------AQAGGYEFQMVEDHEQQRNSQPNREVGIVQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAG-QPSRSSVVPVVIHVIDENDNAPQFTN--------------STFTFSIPENAPADTFVGKLTAVDRDIGRNAELSF------TLSSQTQDFTIDTRNGFIKTLRPFDREAL----VKVS 1223          

HSP 12 Score: 120.939 bits (302), Expect = 4.481e-27
Identity = 156/658 (23.71%), Postives = 278/658 (42.25%), Query Frame = 2
Query:  572 LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTK-TAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE--HDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVREN-LAPATIGQLQYEDSDIGRNADVVFSKTWPND--DTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGS 2524
            L +V  + ++V D NDN P   +      V E        I +  A+D D + +N  + Y L      F    +      ++    LD E    Y   + A +          +V L++ D NDNPP+F + LFS+ V EN    S + ++ ++D D  +      Y  + N   K     Q+G  I ++  LD E+   Y + V  +DG + A + + + ++D+ND +P+   +       E      ++GQ+I TD+D    N   +  +   +P   FS+     +      +R K + + R   +  ++ ++ +D         L S   +N+ I+D ++NPPKF Q++Y A + ++   G  I++V+A D  D    ++ YSL   +  S+F +    G IT+  P+       Y+L + A D G  P +    + I V   N ++P   +  ++  V EN    +TI  +   D D G N  + +S +  N+  D  +    G + I + LD +    + L + ++D G +    S   + I + DVNDN P + N +          P              G  + Q  A D D   N  + ++  LP+      F  N + G +S      +     Y +++  K+  S
Sbjct: 2790 LRSVTLITLNVTDANDNAPVMEQLIYNAEVLE-EESPPQLIAVVKASDRD-SGDNGNVIYRL---QNDFDGTFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF-TRLFSLNVTENAEIGSFVIRVTSSDLDLGANANAS-YSFSENPGEKFRIEPQSGN-ITVAGHLDREQQDEYILKVVASDGAWRAETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNS--VISYSLQQPSPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPP----LYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYH-PLSSVAMLTIILTDVNDNPP-VFNHKEYHCYIPENKPV-------------GTFVFQAHAADKDSPKNA-IIHYAFLPSGPDRHFFIMNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS 3417          

HSP 13 Score: 118.627 bits (296), Expect = 2.641e-26
Identity = 202/833 (24.25%), Postives = 340/833 (40.82%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSG--PNCC----FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSH--IFLETATDTDIAPENAQIEYGLAEHHKS-FQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWN--AQDNKQWNELNVDLYVDDFNDNP---PRFNS-SLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANN---ELRKLFSVLQNGTVILISSWLDYERH-QRYKVPVF---VTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDK-DDSQTNGKMICEHETTEPRLEFSLSSGKNKKIL----TYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFS--VRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRD-----------------------------------NGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTY--------HILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I+E  P+   + T+  D    G+N    G + Y +S   P       F I+ ++ V+   + ID ESI   R         Q          S  QL     V + V D+NDN P F          + S   GS   +    A D D +  N  + Y +    +  F+L   Q+    +        + +  Y + +++ +   Q  ++ +E+ + +       +    P+F   S  S  V EN P  + I  + A+   S  +  F    TA     ++ +LF +     ++  ++ LD E   + Y+V V+   +      +R+ + V V D+ND  PQ +  P V  V E+    L IG  I T +  D  T G +            F L  G + K L    T  +      DRE  S+  + +  SDG      +  T ++   +Q+ D NDNPP F  + Y   + EN   G  + ++ A D D G N ++ Y +  D++  +F ++  TG++T+   +D E  +HY L + A D+G   L++++ +   V D+NDN+P +  P  +S  V EN+  AT +  +  +D D G N  + +S T  + D+   I  NGT+   + LDRE +  + L V  RD                                   +    R  S+ +V I + DVND  P  I+         A   A  ++++I+       V+  + AVD+D+  N  + Y         +   + LP   FS N T G L +   L       Y + ++ +D G PP   E    + I ++
Sbjct: 1498 IKEGIPLKTPIVTVTADDPDSGLN----GKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQ---------PSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDAD-SSSNGLVTYEIVSGPQELFKL---QRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLA-SAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSED----LQIGHTISTLRAHDPDTLGSVT-----------FLLMDGHDGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSDG------VQYTEAYA-TIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAP-IFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFIS---------ANETAIMENVAINT------VVIAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLP---FSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDE 2271          

HSP 14 Score: 109.768 bits (273), Expect = 1.320e-23
Identity = 189/791 (23.89%), Postives = 317/791 (40.08%), Query Frame = 2
Query:  290 LKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLES---ICINRELSSDCSSGQGH-------LELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQ-THYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXX--XXSPQLIQNPSVIEVMENSGKGLVIGQVIVT---DKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDN------------PPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMIT----------VN---------GTLYITKPLDRETKDRHCLRVRLRDNGLNGR-RQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
              + I EN P D  VG +      +G N E    L + LS     F+ID ++  +   +  D E+   +  N E S +  S +G        LE  V+     +L   V+V++ V DVNDN P+F +      +SE + + G+HI      D D    N  + Y LA+ +++ Q  LD      L L   LD E+Q  H+LI +    A  +   +  ++ + V D NDN P F  S   V V E +P  + + +  A+D D     +     +A N  R  F +      + +   LDYE    Y + +  +D    + S   +        +++P +  + +++  ++   +G+ +   IVT   D  DS  NGK+       EP+L      G N +  T  I T    DRE      + ++ +D    S    L++   + V + D NDN            PPKF  S+  +         T +++V+A D D   NG + Y +      LF++   TG+IT       + +  Y+L + + D        S  + IT+            P +F  R  L+ +      YE+  IG +   V +     +    +T          V+         G L     LDRE        V +    L G+ R S  +V + V+D ND+ P+ ++   +  +        S+ + I      G+ I+ L A D D  T   +T+ ++  +      F    +TG L L+  L       Y +++ V D
Sbjct: 1158 FTFSIPENAPADTFVGKLTAVDRDIGRNAE----LSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASE-GTHITHVFTQDADEG-LNGDVYYSLAKGNEAGQFNLDSATG-QLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNR-RDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIK---EGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTE--TGVIHTLREIDRESIDTFRLTVVATDRAQPSER-QLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSS---------TAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVP-QFEQRSKLSGSV-----YENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEE-YEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNV--------SEDLQI------GHTISTLRAHDPD--TLGSVTFLLMDGH---DGKFLLEPSTGKLILNDTLDRETKSKYELRIRVSD 1899          

HSP 15 Score: 107.842 bits (268), Expect = 4.452e-23
Identity = 98/342 (28.65%), Postives = 150/342 (43.86%), Query Frame = 2
Query: 1571 INVQILDFNDNPPK-----FRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKI-----------HYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDT--VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNT---LPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            + V +LD ND+ P      F      A V EN   GTV+  V   D D GLNG+            H+ LE    L        ++ V G +DRE    Y L + A+D G+    ++  L I V+DVND+ P        +V   LAP  + +  +   D D G NA V +     N+     M  + G +  T PLDRE +D   L +  RD G N +   + ++ + ++D ND  P+       RE          Q++++     P  ++  + A D D  TN  +T+  L P+     P Q F+ ++ TG L+  +PL    +  Y I V  +D G+P
Sbjct:  368 VTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLH-------IVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYT-QLKVIILDENDEAPQFSQ----RE----------QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTF-ALAPSVERLYPLQ-FALDALTGQLTTRRPLDREKMSQYEISVIARDQGAP 685          

HSP 16 Score: 103.219 bits (256), Expect = 1.335e-21
Identity = 174/714 (24.37%), Postives = 278/714 (38.94%), Query Frame = 2
Query:  596 ISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYG--LAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWN-AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENT--PARSMIFQLIANDPDS---TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIE-------VMENSGKGLVIGQVIVTDKDD---SQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE-HDFSLFQIDSTTGVITVQGPVDRELKEH----YKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPF------EFSVRENLAPAT--------------IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP---RLI-NPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNST-TGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK---PAKY 2584
            I +LD NDN P F  ++    V+E +   G+ +   +ATD D    N +I Y   L + +  F +  D      + +  +L+ E  + Y + +RA + A +N   +   + + + D NDN P F  S +   V ENT  P    +  + A D D+    S +R+ L +  ++    LF +  +   I +   LD E+   Y + +   D      S           E   +  N  V E       V EN   G  +     TDKD+   ++    ++ EH     R      +G        +I T T  DRE++S   + L+  D   T       SS  + + + D NDN PKF  + Y   V E    G  +    A DLDDG N  +HY++   D   F I++ TGV++ +  +  + K H    Y + I A+D G   L+S   L + +       P L   F       F++ E++ P                +G+++Y  +  G   D +  +  PN   + +  +G       LD E    + + +   D      R S   + + V D NDN P   +LI N   L E                  +SP  +I  + A D D   N  + Y   L N       +F  T +G +     L    IG Y   V   D G P +       L + +K   P K+
Sbjct: 2266 IRILDENDNSPVFDPKQYSASVAENA-SIGAMVLQVSATDVDEG-ANGRIRYSIVLGDQNHDFSISEDTG---VVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSD----LFRINASSGDIALLKPLDREQQSEYTLTLVAMD----TGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMH---RFHIDSETG--------EISTATTLDREETSVYHLTLMAQDSSITEPR---ASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIVISAMDQGEQSLSSKAELTVIL-----RPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAG-GIMGDSL--RVDPNSGLLSVGQDG-------LDYELTHLYEIWIEAADGDTPSLR-SVTLITLNVTDANDNAPVMEQLIYNAEVLEE------------------ESPPQLIAVVKASDRDSGDNGNVIYR--LQNDFDG---TFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKF 2913          

HSP 17 Score: 89.7373 bits (221), Expect = 1.791e-17
Identity = 102/386 (26.42%), Postives = 151/386 (39.12%), Query Frame = 2
Query: 1457 IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYK---------LHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEF--------SVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPND----------DTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            + T    DRE      + +   DG +     +L     +NV ILD NDNPP F  S Y   + E    GT ++ V A D D G N KI Y L      F ++  TGVI+    V+   + + K           + A D GS   +    + + + D ND+ P +   F F        +V EN    T +  +  +DSD G N          N+          D  ++ VNG       LDRE   ++ L V   D G    R ++  + I V DVND++P                  +  S  +S     G  +  + A D+D   N ++ Y IL  N L  + FS +  TG +    PL         + +S +D G  P
Sbjct:  222 LETTGNLDRESRGSYQLNISARDGGSPPRFGYLQ----VNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPII--SFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGV------LDREEIGKYNLTVVAMDQGTPA-RTTTAHLIIDVNDVNDHEPVF--------------EKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNEL--KWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNP 578          

HSP 18 Score: 83.5741 bits (205), Expect = 1.104e-15
Identity = 101/439 (23.01%), Postives = 177/439 (40.32%), Query Frame = 2
Query: 1286 IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGK------IHYSLEHDFSLFQIDSTTG-----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDR-----------ETKDRHCL-RVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
             EV+E   +G  +G +    K   + N          EP  EF+L        +T +++T    DRE       +++ S           T    + +++LD NDN P+F +       +E+   GT +L   A D D G NG       +  ++++ F L    + +G      +   G +DRE +  Y+L+I A D GS P    + +N+T+ DVNDN P    + +  S+ E   P T +  +   D+D+G N+ + +   +  +     TVN    +    +R               + C+  V  RD+G + R+     V + ++D ND+ P +      R   D    A     +++     G V+  +   D D   N + +  I+  N L        +    + ++  L    IG Y + V   D G+P
Sbjct:   71 FEVLEGQPRGTTVGFIPTKPKFSYRFN----------EPPREFTLDP------VTGEVKTNVVLDREGMRDHYDLVVLSS--------QPTYPIEVRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITY---YLAETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHG-SPRQDGRTYVTVNLLDTNDHDPII----SFRFFPDGGKVATVDENAVN-----GTVVAAVAVKDSDSGLNGRTSVRIVSGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTP 472          

HSP 19 Score: 65.4698 bits (158), Expect = 3.755e-10
Identity = 111/453 (24.50%), Postives = 184/453 (40.62%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSI-DQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL--AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWN--AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSV-LQNGTVILISSWLDYERHQRYKVPVFVTD-GL--YEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFR 1618
            I EN+P+   V       +    N   H + +   SGP+  F I +Q +  ++ A + D E   I   L     +    +E   NL+            + VL VN+  PQF +      VSE S   G+ +    ATD D + E+ ++ Y L  + + K F++  +      +++   LD E Q   ++ + A N  +      +E  V + + D ND PP F    ++  + E  P  + +  + A D D  +      Y   N  L++ F + +Q G  I  +S LD E    Y + +   D GL      + + + +ED ND  P          + EN   G  I  +I +D D  +  G              + L  GK+K  L+ D     +R+ T+FDRE +  +  ++   D    S      S   + + +LD NDNP   R
Sbjct: 3343 IPENKPVGTFVFQAHAADKDSPKNAIIHYAFL--PSGPDRHFFIMNQSNGTISSAVSFDYEERRI-YTLQIKAKNPDSSMESYANLY------------VHVLGVNEFYPQFLQPVFHFDVSETS-AVGTRVGAVQATDKD-SGEDGRVYYLLVGSSNDKGFRIDTNTG---LIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNLKQSFKIDVQTGE-ISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTFTPEGLNGYISENEPAGTSIMTLIASDPDLPRNGGPFT-----------YQLIGGKHKSWLSVDRNSGVVRSTTSFDREMTPILEAIIEVED----SGKPKQKSQHLLTITVLDQNDNPSTTR 3758          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 181.03 bits (458), Expect = 1.845e-45
Identity = 208/723 (28.77%), Postives = 324/723 (44.81%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESI----CINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGT-VILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKD---DSQT----NGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEH---DFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGT----LYITKPLDRE-TKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            FSID  S  +++ K +D ES+     + R       S     +L+VN                V+D NDN P+F   + +  V E +   G +I    A D+D    NA+I Y ++E   +F L +D  R  ++  +  LD E Q  +  ++ A +     +    +V + V D NDN P FN   +   V E+ P  + +  + A DPD  S L +++  T  N   +     QNG  +I I+  LDY++ +R+ + V  TD G     + + + + D N+ +P     P    V E++  G  +  V  TD D   ++Q     N + I    + +P   FS++        T  I T    DRE +S   + +   DG N S    L+ +  + + + D NDN P F+   Y A + E+  +GT +++V A D D GLNG+I Y L     +   F ID T+G I     +DRE    + L   AVD GS PL+S+V + I ++DVND+ P   +      V EN +P  + +G++   D D G NA V +S    +D     ++T  G+    L     LD E T+ R  L VR     L    ++   + I V DVNDN P L   R  + I +                 P   I ++ A D D   + KL Y IL  N   + +   NS++G L L   L+ +      ++VSV D
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVN----------------VIDANDNAPRFYTSQFQESVLE-NVPVGYNIIRVQAYDSDEG-ANAEITYSISERDDNFPLAVDP-RTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEI--TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP---FSINP------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS----LSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL----RNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRD-----------HFPSGEIGRIPAFDAD--VSDKLHYRILSGNN--ANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          

HSP 2 Score: 176.022 bits (445), Expect = 7.720e-44
Identity = 193/682 (28.30%), Postives = 298/682 (43.70%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINREL--SSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSE-----ASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIE--VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-------SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVREN-LAPATIGQLQYEDSDIGRNADVVF---SKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQ-SP-GYVITQLIAVDDDDATNTKLTYHIL 2392
            F ID +S V++   ++D E+      L  ++D +S Q             +  A   V++ VLD NDN PQFS++     V E           +HI    ATD D    NA I Y +   +   Q  +D      + L+  LD E+   Y + IRA +     + N   + + V D NDN PRF +S F   V EN P    I ++ A D D  +        +  ++   L    + G V  I   LD E   R+   V   DG    +S    +V    D +   P    NP   E  V E+   G  +  V  TD D+   + ++  E  T   R  F+++S   + ++T  I     + +EK   ++V    S G + +A +H        + I D N+  P F  + Y A V E+ P+GT +L V+A D D G+N +I YSL  +          F I+  TG I    P+DRE    Y L + A D G+  L+ +  + I V DVNDN+P   +P ++ S+ E+ L   ++ Q+   D D+G N  + +    +   +   V+   +GT+   K LDRE+     L     D G +    S+ EV IR+ DVND+ P                  AS  I++ V + SP G V+ ++ A D D+  N  + Y I+
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSE-----------RRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHI---RATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGD-VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--NPKYYEANVGEDQPPGTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--------INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG-SPPLSSTVEVQIRLEDVNDSPPTF----------------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSII 1153          

HSP 3 Score: 160.999 bits (406), Expect = 2.611e-39
Identity = 196/746 (26.27%), Postives = 325/746 (43.57%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQ--------RQPYLFLLNDLDAENQTHYLIKIRAWN---AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARS---MIFQLIANDPD--STSVLRFDLYQTANNELRKLFSV-LQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTK-----TAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE--HDFSLFQIDSTTG--VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTV-------MITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREI-DDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            F +D ++ V+T + ++D E + ++            +  ++    S         ++++VLD ND+ P F  ++ E  + E +   GS +    ATD DI  +NA+IEYG+        L  DQ+        R   +   + LD E    Y + + A +   AQ  ++    +V + V D NDN P+F+   ++V V E+    +    +  + A D D  + + +R   Y       +  FS+   +G V L+   LDYE  + Y++ +   DG   +RS    L+ +  D    +P+   +     V+EN   G  I +V   D D            E     + +S+S   +   L  D RT         DRE+  + +  ++  DG     +   +SS  I VQ  D NDN P F    Y A+V E+ P GT +  V A D D+  + ++HY +   +    F I S  G  +IT+   +D + ++ + L + A DSG     ++V +NIT  D N+ +P     P+  SV E+ AP   T+  +   DSD+G NA + +S    N++++         ++N   G +    PLDRET   + L V  +D G N     + +V I V DVNDN P   +P     I +DA                 G  + Q+ A D D   N ++ Y +L    +    F  + T+G +  +K L    +  + +     D GSPPL
Sbjct:  407 FKVDSRTGVVTTSASLDRELMDVH------------YFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGA-TVGSTVITLRATDQDIG-KNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSMSGDVSLVKP-LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD------------EGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--SSSVVITVQ--DVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFED-APVGTTVLVVSATDSDVGVNAQITYSL---NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG-NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---------------GTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL 1093          

HSP 4 Score: 128.257 bits (321), Expect = 2.708e-29
Identity = 153/584 (26.20%), Postives = 237/584 (40.58%), Query Frame = 2
Query:  926 VDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRF------DLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS-------PQLIQNPSVIEVMENSGKGL---VIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP--FEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYIT--KPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLP--NTLPS-QIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT----NKPA 2578
            V D ND+ P F +  F   ++E     S +  L A D D    + + +      D    A ++   +F +     VI   S LD E    Y + V   D L  A+S           +        PQ  +    ++V E+   G     +  +  TD D    N  +         + +FS+ S      ++ D+      D E      +V+   DG + S     +++  + V ++D NDN P+F  SQ+   V EN P+G  I++V AYD D+G N +I YS+   + +F L  +D  TG +    P+DRE +  +   + A D G  P ++S  + ITV DVNDN P    P  +E +V E+  P T +  +   D D         +         + + NG   IT  + LD + + R  L V   D   +G R  +  V I + D N+  P   N              A  S S+      G  +  + A D D   N ++TY +     N L S   FS N  TG +  + PL       Y + V+ KD G+P L D     + +T    N PA
Sbjct:  454 VLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD-LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN-NAAIRYAIIGGNTQSQFSIDS------MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR----SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA-FNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATD---SGGRSDTATVHINITDANNFAPIFEN--------------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPA 1006          
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0300578)

HSP 1 Score: 181.03 bits (458), Expect = 1.845e-45
Identity = 208/723 (28.77%), Postives = 324/723 (44.81%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESI----CINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGT-VILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKD---DSQT----NGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEH---DFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGT----LYITKPLDRE-TKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            FSID  S  +++ K +D ES+     + R       S     +L+VN                V+D NDN P+F   + +  V E +   G +I    A D+D    NA+I Y ++E   +F L +D  R  ++  +  LD E Q  +  ++ A +     +    +V + V D NDN P FN   +   V E+ P  + +  + A DPD  S L +++  T  N   +     QNG  +I I+  LDY++ +R+ + V  TD G     + + + + D N+ +P     P    V E++  G  +  V  TD D   ++Q     N + I    + +P   FS++        T  I T    DRE +S   + +   DG N S    L+ +  + + + D NDN P F+   Y A + E+  +GT +++V A D D GLNG+I Y L     +   F ID T+G I     +DRE    + L   AVD GS PL+S+V + I ++DVND+ P   +      V EN +P  + +G++   D D G NA V +S    +D     ++T  G+    L     LD E T+ R  L VR     L    ++   + I V DVNDN P L   R  + I +                 P   I ++ A D D   + KL Y IL  N   + +   NS++G L L   L+ +      ++VSV D
Sbjct:  632 FSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVN----------------VIDANDNAPRFYTSQFQESVLE-NVPVGYNIIRVQAYDSDEG-ANAEITYSISERDDNFPLAVDP-RTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEI--TTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDP---FSINP------QTGAIVTNAPLDRETTSGYLLTVTAKDGGNPS----LSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPEN-SPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRKRFELVVRAASPPL----RNDAHIEILVTDVNDNAPVL---RDFQVIFNNFRD-----------HFPSGEIGRIPAFDAD--VSDKLHYRILSGNN--ANLLRLNSSSGGLVLSPQLNTNVPKFATMEVSVSD 1297          

HSP 2 Score: 176.022 bits (445), Expect = 7.720e-44
Identity = 193/682 (28.30%), Postives = 298/682 (43.70%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINREL--SSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSE-----ASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIE--VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-------SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVREN-LAPATIGQLQYEDSDIGRNADVVF---SKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQ-SP-GYVITQLIAVDDDDATNTKLTYHIL 2392
            F ID +S V++   ++D E+      L  ++D +S Q             +  A   V++ VLD NDN PQFS++     V E           +HI    ATD D    NA I Y +   +   Q  +D      + L+  LD E+   Y + IRA +     + N   + + V D NDN PRF +S F   V EN P    I ++ A D D  +        +  ++   L    + G V  I   LD E   R+   V   DG    +S    +V    D +   P    NP   E  V E+   G  +  V  TD D+   + ++  E  T   R  F+++S   + ++T  I     + +EK   ++V    S G + +A +H        + I D N+  P F  + Y A V E+ P+GT +L V+A D D G+N +I YSL  +          F I+  TG I    P+DRE    Y L + A D G+  L+ +  + I V DVNDN+P   +P ++ S+ E+ L   ++ Q+   D D+G N  + +    +   +   V+   +GT+   K LDRE+     L     D G +    S+ EV IR+ DVND+ P                  AS  I++ V + SP G V+ ++ A D D+  N  + Y I+
Sbjct:  521 FRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSE-----------RRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHI---RATDADQG-NNAAIRYAIIGGNTQSQFSIDSMSGD-VSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLAVDPRTGWVQTIKP-LDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAF--NPKYYEANVGEDQPPGTPVTTVTATDPDE---DSRLHYEITTGNTRGRFAITSQNGRGLIT--IAQSLDYKQEKRFLLTVAATDSGGRSDTATVH--------INITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKG-SPPLSSTVEVQIRLEDVNDSPPTF----------------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSII 1153          

HSP 3 Score: 160.999 bits (406), Expect = 2.611e-39
Identity = 196/746 (26.27%), Postives = 325/746 (43.57%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQ--------RQPYLFLLNDLDAENQTHYLIKIRAWN---AQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARS---MIFQLIANDPD--STSVLRFDLYQTANNELRKLFSV-LQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTK-----TAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE--HDFSLFQIDSTTG--VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPNDDTV-------MITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREI-DDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            F +D ++ V+T + ++D E + ++            +  ++    S         ++++VLD ND+ P F  ++ E  + E +   GS +    ATD DI  +NA+IEYG+        L  DQ+        R   +   + LD E    Y + + A +   AQ  ++    +V + V D NDN P+F+   ++V V E+    +    +  + A D D  + + +R   Y       +  FS+   +G V L+   LDYE  + Y++ +   DG   +RS    L+ +  D    +P+   +     V+EN   G  I +V   D D            E     + +S+S   +   L  D RT         DRE+  + +  ++  DG     +   +SS  I VQ  D NDN P F    Y A+V E+ P GT +  V A D D+  + ++HY +   +    F I S  G  +IT+   +D + ++ + L + A DSG     ++V +NIT  D N+ +P     P+  SV E+ AP   T+  +   DSD+G NA + +S    N++++         ++N   G +    PLDRET   + L V  +D G N     + +V I V DVNDN P   +P     I +DA                 G  + Q+ A D D   N ++ Y +L    +    F  + T+G +  +K L    +  + +     D GSPPL
Sbjct:  407 FKVDSRTGVVTTSASLDRELMDVH------------YFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGA-TVGSTVITLRATDQDIG-KNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIR---YAIIGGNTQSQFSIDSMSGDVSLVKP-LDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSD------------EGANAEITYSISERDDNFPLAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSA--SSSVVITVQ--DVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDE--DSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSGGRSDTATVHINIT--DANNFAPIFENAPYSASVFED-APVGTTVLVVSATDSDVGVNAQITYSL---NEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGG-NPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALV---------------GTSVIQVAASDPDVGLNGRIKY-LLSDRDIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPL 1093          

HSP 4 Score: 128.257 bits (321), Expect = 2.708e-29
Identity = 153/584 (26.20%), Postives = 237/584 (40.58%), Query Frame = 2
Query:  926 VDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRF------DLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS-------PQLIQNPSVIEVMENSGKGL---VIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP--FEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYIT--KPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLP--NTLPS-QIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT----NKPA 2578
            V D ND+ P F +  F   ++E     S +  L A D D    + + +      D    A ++   +F +     VI   S LD E    Y + V   D L  A+S           +        PQ  +    ++V E+   G     +  +  TD D    N  +         + +FS+ S      ++ D+      D E      +V+   DG + S     +++  + V ++D NDN P+F  SQ+   V EN P+G  I++V AYD D+G N +I YS+   + +F L  +D  TG +    P+DRE +  +   + A D G  P ++S  + ITV DVNDN P    P  +E +V E+  P T +  +   D D         +         + + NG   IT  + LD + + R  L V   D   +G R  +  V I + D N+  P   N              A  S S+      G  +  + A D D   N ++TY +     N L S   FS N  TG +  + PL       Y + V+ KD G+P L D     + +T    N PA
Sbjct:  454 VLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAAD-LASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGN-NAAIRYAIIGGNTQSQFSIDS------MSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSR----SNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPL-AVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPA-FNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEITTGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATD---SGGRSDTATVHINITDANNFAPIFEN--------------APYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPA 1006          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 233.032 bits (593), Expect = 1.942e-62
Identity = 224/793 (28.25%), Postives = 367/793 (46.28%), Query Frame = 2
Query:  224 LKTLFLFLTAVRC---SETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSI-DQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNPSVIEVM--ENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            L+  FL  T V C     T  +E +  Y I+E    + ++G I  D+    +N     +  L+Y+L   +G      +      + T +  ID E +C       S+CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D  P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++K++  +  + ++ +   + + V D NDN P F  S   V + EN+P  + + QL A D D  + + +++      +   R+LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND +P +    I +P+   VM  E       I  + V+DK D+  NGK+IC  E   P   F L +  + +   Y + T    D E + +    ++ SD    S N     +  + V++ D NDNPP F Q      V EN      +  ++A D D G N +I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+  L S   + +T+ D NDNSP      F+F V ENL   +T+G +   D+D G NA V  S    N++ ++   +G +      DRE +  +   VR  DNG +    S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   IG + + V++ D G P
Sbjct:    3 LRDFFLLATLVACFWLDPTIAQELI--YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-----FEIEVVILPN-DYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDTGP-NSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDK-DTDVNGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG-SPPCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV--RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP 760          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 233.417 bits (594), Expect = 1.956e-62
Identity = 226/806 (28.04%), Postives = 373/806 (46.28%), Query Frame = 2
Query:  224 LKTLFLFLTAVRC---SETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSI-DQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNPSVIEVM--ENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            L+  FL  T V C     T  +E +  Y I+E    + ++G I  D+    +N     +  L+Y+L   +G      +      + T +  ID E +C       S+CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D  P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++K++  +  + ++ +   + + V D NDN P F  S   V + EN+P  + + QL A D D  + + +++      +   R+LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND +P +    I +P+   VM  E       I  + V+DK D+  NGK+IC  E   P   F L +  + +   Y + T    D E + +    ++ SD    S N     +  + V++ D NDNPP F Q      V EN      +  ++A D D G N +I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+  L S   + +T+ D NDNSP      F+F V ENL   +T+G +   D+D G NA V  S    N++ ++   +G +      DRE +  +   VR  DNG +    S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   IG + + V++ D G P  +    + +LF+
Sbjct:    3 LRDFFLLATLVACFWLDPTIAQELI--YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-----FEIEVVILPN-DYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDTGP-NSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDK-DTDVNGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG-SPPCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV--RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVLVFLFV 773          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 233.032 bits (593), Expect = 2.129e-62
Identity = 226/806 (28.04%), Postives = 373/806 (46.28%), Query Frame = 2
Query:  224 LKTLFLFLTAVRC---SETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSI-DQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNPSVIEVM--ENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            L+  FL  T V C     T  +E +  Y I+E    + ++G I  D+    +N     +  L+Y+L   +G      +      + T +  ID E +C       S+CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D  P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++K++  +  + ++ +   + + V D NDN P F  S   V + EN+P  + + QL A D D  + + +++      +   R+LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND +P +    I +P+   VM  E       I  + V+DK D+  NGK+IC  E   P   F L +  + +   Y + T    D E + +    ++ SD    S N     +  + V++ D NDNPP F Q      V EN      +  ++A D D G N +I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+  L S   + +T+ D NDNSP      F+F V ENL   +T+G +   D+D G NA V  S    N++ ++   +G +      DRE +  +   VR  DNG +    S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   IG + + V++ D G P  +    + +LF+
Sbjct:    3 LRDFFLLATLVACFWLDPTIAQELI--YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-----FEIEVVILPN-DYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDTGP-NSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDK-DTDVNGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG-SPPCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV--RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVLVFLFV 773          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 233.032 bits (593), Expect = 2.129e-62
Identity = 226/806 (28.04%), Postives = 373/806 (46.28%), Query Frame = 2
Query:  224 LKTLFLFLTAVRC---SETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSI-DQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNPSVIEVM--ENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            L+  FL  T V C     T  +E +  Y I+E    + ++G I  D+    +N     +  L+Y+L   +G      +      + T +  ID E +C       S+CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D  P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++K++  +  + ++ +   + + V D NDN P F  S   V + EN+P  + + QL A D D  + + +++      +   R+LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND +P +    I +P+   VM  E       I  + V+DK D+  NGK+IC  E   P   F L +  + +   Y + T    D E + +    ++ SD    S N     +  + V++ D NDNPP F Q      V EN      +  ++A D D G N +I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+  L S   + +T+ D NDNSP      F+F V ENL   +T+G +   D+D G NA V  S    N++ ++   +G +      DRE +  +   VR  DNG +    S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   IG + + V++ D G P  +    + +LF+
Sbjct:    3 LRDFFLLATLVACFWLDPTIAQELI--YPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNRIDREKLCPGPSFEDSECS-----FEIEVVILPN-DYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDTGP-NSVHKYELLNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPARATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDK-DTDVNGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVRLSILNDNENFILDPDSGVIKSNVSFDREQQSSYTFDVRAVDNG-SPPCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNV--RSLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYPKSLHTLVLVFLFV 773          
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 226.868 bits (577), Expect = 1.664e-60
Identity = 219/779 (28.11%), Postives = 366/779 (46.98%), Query Frame = 2
Query:  296 YLIQENEPIDRMVGTIATDIE-GLGINLEFHGSLIYK---LSGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL-------IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            Y ++E +P +  +G +  D+   L  +++   +L +K    +G      ++  +  +LT A  ID E +C     S   +  + + E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    S   + +A D DI     Q  Y L +    F L +    +  + P L +   LD E +  +++KI+  +  +  + +   + + V D NDN P F  S   V V EN P  + +  L A D D  S + + F      +   ++ F++     +I +   LD E +  +K+ V  +DG    +R+ + V V D ND  P +       + N +V+ + EN+     I  + VTD+ DS  NGK+ C    T+  + F L    N + L   + T    D E + + ++ ++ SD    S    L +S  + ++I D NDN P F Q +    + EN   GT ++K++A D D G N  I YSL  D    F IDS +G+++V   +DRE +E Y   + A D+G+ PL S+V + + V D NDNSP    P + F V ENL    T+G +   D+D G NA V  S     D+ ++    G +      DRE +  +   V+  D GL  +  S  +V I V+DVNDN+P  + P      D   S             SPG V+T++ A+D+D   N +L Y I+  +     +F+ + TTG ++L + +     G + + V VKD G P  +    + +LF+
Sbjct:   28 YTVKEEQPENVRIGNLRKDLNLNLDPDIKLSSALQFKPVYKTGDVPLVKVEASTGEILTTANRIDREKLC-----SGVFNEKRCYYEIEVAVLPD-EIFRLVKIRFLIEDINDNAPLFQSTVINISIPENT-AINSRYPVPSAFDPDIGINGIQ-HYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRATVIVNVTDINDNVPSIDTRYIMNLVNGTVL-LSENAPLNTKIALITVTDR-DSDLNGKVTC---YTDHDVPFRLKPVFNDQFL---LETAAPLDYETTREYAIRIVASD----SGKPPLNTSAMVLIKIKDENDNVPVFPQPEIQLSIPENNDPGTQLIKISATDADSGSNALIIYSLGPDAPDGFNIDSRSGILSVVKRLDREKQEKYSFTVIARDNGTTPLQSNVTVKLIVQDQNDNSPAFTHPEYNFYVPENLPLYGTVGLITVTDADAGDNAVVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDAGL-MQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYDLVPS-----------NTSPGSVVTRVFAIDNDTGMNAELQYSIIGGSL--RGLFTIDKTTGNITLQEKIVAADQGLHRLVVKVKDLGQPESLHAIALVHLFV 772          

HSP 2 Score: 103.605 bits (257), Expect = 7.575e-22
Identity = 102/349 (29.23%), Postives = 156/349 (44.70%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQID---STTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS---KTWPNDDT--VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F+ +     + EN  I +     +A+D D G+NG  HY L    S F +D   +  G     + VQ  +DRE K+ + + I   D G+ P +S+  L +TV DVNDN P    +  E +V EN    T +  L   D+D+G NA + FS   +  P+      + +  G + + +PLDRE    H L V   D      R +   V + V D+NDN P  I+ R +  + + T   +          +P      LI V D D+  N K+T +    + +P ++    +    L    PL +     Y I++   DSG PPL    M  + I ++
Sbjct:  125 IRFLIEDINDNAPLFQSTVINISIPENTAINSRYPVPSAFDPDIGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQSLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTHLHATDADLGSNAQIHFSFSNQISPSTKRHFAIDSTTGLITVKQPLDREVNPVHKLIVLASDGSSTPSRAT---VIVNVTDINDNVPS-IDTRYIMNLVNGTVLLSE--------NAPLNTKIALITVTDRDSDLNGKVTCYT--DHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIRIVASDSGKPPLNTSAMVLIKIKDE 459          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 236.884 bits (603), Expect = 1.598e-63
Identity = 224/804 (27.86%), Postives = 368/804 (45.77%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP-PLIDEKMFYLFI 2563
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN     S  L+Y+L   +G +    +   +  + T +  ID E +C     SS+    +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +A D D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F  S   V + EN P  + + QL A D D  S + +++       +  ++LF++     +I +   LD E    +K+ V  TDG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  N K+IC  E   P   F L +  + +   Y + T +  D E   + S  ++ +D    S N     +  + V++ D NDNPP F Q      V+EN   G  +  V+A D D G N  I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   DSD G N  V  S    N++ V+   +G +      DRE +  +   V+  D G    R S+ +V I ++D NDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  S   +G + + V++ D G P PL    + +L++
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAG---SSNSDENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSTVINISIPENT-LINSRFPIPSAVDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKD-TDVNSKVICFIEREVP---FHLKAVYDNQ---YLLETSSLLDYEGIKEFSFKIVAADTGKPSLN----QTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITATDSDAGENKAVTLSILNDNENFVLDPYSGLIKSNVSFDREQQSSYTFDVKAVDGG-QPPRSSTAKVTINIMDANDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLYV 774          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: ENSXETT00000047804.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 218.009 bits (554), Expect = 2.315e-57
Identity = 213/809 (26.33%), Postives = 368/809 (45.49%), Query Frame = 2
Query:  212 KMDILKTLFLFLTAVRC--SETGIKECVLKYLIQENEPIDRMVGTIATDIE-----GLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL-DKPLSHHYIGHYPIKVSVKDSGSP-PLIDEKMFYLFI 2563
            +MD+L   +L    + C   E+G +E    Y+++E  P + ++G +  D+       L   L+F   L+YK          +    + T +  ID E +C     S   +  +   E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    S   + +A D D+     Q  Y L +    F L +    +  + P L +   LD E +  Y++KI+  +  +  + +   + + V D NDN P F      V + E+    + + QL A D D  S + + F       N  ++ F++  N  +I +   LD E    +K+ V  +DG    +R+ + + + D ND  P +    I NP    +++ E +     I  + VTDKD +  NGK+ C    T+  + F L    + + L   + T    D E + + ++ ++ SD    S    L  S  + ++I D NDN P F          EN P GT + K++A D D G N ++ Y L  +  ++F +D  TG++T    +DRE ++ Y   + A D+G+  L ++  + ++V D NDNSP      + F V ENL    T+G +   D+D G NA V  S     D+ ++  + G +      DRE +  +  +V+  D G + ++ S+ +V I V DVNDNKP  + P      D            +    SPG V+ ++ A+D+D   N  L Y I+  N+    +F+    +G ++L +K L+  +   Y + + V DSG P P       +LF+
Sbjct:   20 EMDLLSGTYLLAVLIACIVFESGAQEK--NYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQFK--LVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC-----SGIFTENKCFYEVEVAVLPD-EVFRLVKIRFLIEDINDNSPLFPSTVINISIPENT-AVNSRYSVPSAIDPDVGVNGIQ-HYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKD-ADLNGKVTC---FTDHDVPFRLKPVFDNQFL---LETAAPLDYESTREYAIKIVASD----SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKG-SPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYD-----------LVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNS--RGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFV 791          

HSP 2 Score: 98.9821 bits (245), Expect = 2.791e-20
Identity = 103/354 (29.10%), Postives = 153/354 (43.22%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR-----LINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  + +     +A D D G+NG  HY L   ++ F L  I++  G     + VQ  +DRE K+ Y + I   D G+   +S+  L +TV DVNDN P       E ++ E+ A  T + QL   D+D+G NA +   F     N       ++   G + + +PLDRE    H L V   D      R +   V I + D+NDN P      +INP              + ++ +S  ++P      LI V D DA  N K+T      + +P ++         L    PL +     Y IK+   DSG PPL    M  + I ++
Sbjct:  143 IRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRAT---VTINITDINDNIPSIDTRYIINP-------------VNGTVQLS-EKAPLNTKIALITVTDKDADLNGKVT--CFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDE 477          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: ENSXETT00000047801.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 217.624 bits (553), Expect = 2.686e-57
Identity = 213/809 (26.33%), Postives = 368/809 (45.49%), Query Frame = 2
Query:  212 KMDILKTLFLFLTAVRC--SETGIKECVLKYLIQENEPIDRMVGTIATDI-----EGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL-DKPLSHHYIGHYPIKVSVKDSGSP-PLIDEKMFYLFI 2563
            +MD+L   +L    + C   E+G +E    Y+++E  P + ++G +  D+       L   L+F   L+YK          +    + T +  ID E +C     S   +  +   E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    S   + +A D D+     Q  Y L +    F L +    +  + P L +   LD E +  Y++KI+  +  +  + +   + + V D NDN P F      V + E+    + + QL A D D  S + + F       N  ++ F++  N  +I +   LD E    +K+ V  +DG    +R+ + + + D ND  P +    I NP    +++ E +     I  + VTDKD +  NGK+ C    T+  + F L    + + L   + T    D E + + ++ ++ SD    S    L  S  + ++I D NDN P F          EN P GT + K++A D D G N ++ Y L  +  ++F +D  TG++T    +DRE ++ Y   + A D+G+  L ++  + ++V D NDNSP      + F V ENL    T+G +   D+D G NA V  S     D+ ++  + G +      DRE +  +  +V+  D G + ++ S+ +V I V DVNDNKP  + P      D            +    SPG V+ ++ A+D+D   N  L Y I+  N+    +F+    +G ++L +K L+  +   Y + + V DSG P P       +LF+
Sbjct:   20 EMDLLSGTYLLAVLIACIVFESGAQEK--NYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQF--KLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC-----SGIFTENKCFYEVEVAVLPD-EVFRLVKIRFLIEDINDNSPLFPSTVINISIPENT-AVNSRYSVPSAIDPDVGVNGIQ-HYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKD-ADLNGKVTC---FTDHDVPFRLKPVFDNQFL---LETAAPLDYESTREYAIKIVASD----SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKG-SPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYD-----------LVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNS--RGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFV 791          

HSP 2 Score: 98.9821 bits (245), Expect = 3.032e-20
Identity = 103/354 (29.10%), Postives = 153/354 (43.22%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR-----LINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  + +     +A D D G+NG  HY L   ++ F L  I++  G     + VQ  +DRE K+ Y + I   D G+   +S+  L +TV DVNDN P       E ++ E+ A  T + QL   D+D+G NA +   F     N       ++   G + + +PLDRE    H L V   D      R +   V I + D+NDN P      +INP              + ++ +S  ++P      LI V D DA  N K+T      + +P ++         L    PL +     Y IK+   DSG PPL    M  + I ++
Sbjct:  143 IRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRAT---VTINITDINDNIPSIDTRYIINP-------------VNGTVQLS-EKAPLNTKIALITVTDKDADLNGKVT--CFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDE 477          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: ENSXETT00000047798.1 (protocadherin 11 X-linked [Source:NCBI gene;Acc:100493938])

HSP 1 Score: 217.238 bits (552), Expect = 4.030e-57
Identity = 213/808 (26.36%), Postives = 367/808 (45.42%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRC--SETGIKECVLKYLIQENEPIDRMVGTIATDI-----EGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL-DKPLSHHYIGHYPIKVSVKDSGSP-PLIDEKMFYLFI 2563
            MD+L   +L    + C   E+G +E    Y+++E  P + ++G +  D+       L   L+F   L+YK          +    + T +  ID E +C     S   +  +   E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    S   + +A D D+     Q  Y L +    F L +    +  + P L +   LD E +  Y++KI+  +  +  + +   + + V D NDN P F      V + E+    + + QL A D D  S + + F       N  ++ F++  N  +I +   LD E    +K+ V  +DG    +R+ + + + D ND  P +    I NP    +++ E +     I  + VTDKD +  NGK+ C    T+  + F L    + + L   + T    D E + + ++ ++ SD    S    L  S  + ++I D NDN P F          EN P GT + K++A D D G N ++ Y L  +  ++F +D  TG++T    +DRE ++ Y   + A D+G+  L ++  + ++V D NDNSP      + F V ENL    T+G +   D+D G NA V  S     D+ ++  + G +      DRE +  +  +V+  D G + ++ S+ +V I V DVNDNKP  + P      D            +    SPG V+ ++ A+D+D   N  L Y I+  N+    +F+    +G ++L +K L+  +   Y + + V DSG P P       +LF+
Sbjct:    1 MDLLSGTYLLAVLIACIVFESGAQEK--NYIVREELPENVLIGNLLKDLNLTLDPDLSTPLQF--KLVYKTGDVPLIRVEENTGEIFTTSNRIDREKLC-----SGIFTENKCFYEVEVAVLPD-EVFRLVKIRFLIEDINDNSPLFPSTVINISIPENT-AVNSRYSVPSAIDPDVGVNGIQ-HYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRATVTINITDINDNIPSIDTRYIINPVNGTVQLSEKAPLNTKIALITVTDKD-ADLNGKVTC---FTDHDVPFRLKPVFDNQFL---LETAAPLDYESTREYAIKIVASD----SGKPPLNQSAMLLIKIKDENDNAPVFTLPMIGLSFVENNPPGTELTKISATDADSGRNAELSYMLGPNAPTIFNLDRRTGILTAVRKLDREKQDRYTFTVIAKDNGNPSLQTNTTVTLSVLDQNDNSPSFTHNEYNFYVPENLPMYGTVGLITVTDADSGENAVVTLSLVNARDNFIIDPLTGVIRPNITFDREQQGSYTFQVKALDKG-SPQKSSTVKVTIFVEDVNDNKPVFVIPSNNYSYD-----------LVQTSTSPGSVVARVYAIDNDTGINADLRYSIIGGNS--RGLFAIGERSGNITLKEKLLAGDHGVLYKLVIKVNDSGKPEPFHTIAFVHLFV 771          

HSP 2 Score: 98.9821 bits (245), Expect = 3.149e-20
Identity = 103/354 (29.10%), Postives = 153/354 (43.22%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR-----LINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  + +     +A D D G+NG  HY L   ++ F L  I++  G     + VQ  +DRE K+ Y + I   D G+   +S+  L +TV DVNDN P       E ++ E+ A  T + QL   D+D+G NA +   F     N       ++   G + + +PLDRE    H L V   D      R +   V I + D+NDN P      +INP              + ++ +S  ++P      LI V D DA  N K+T      + +P ++         L    PL +     Y IK+   DSG PPL    M  + I ++
Sbjct:  123 IRFLIEDINDNSPLFPSTVINISIPENTAVNSRYSVPSAIDPDVGVNGIQHYELLKGQNVFGLDVIETPEGDKWPQLIVQQSLDREQKDTYVMKIKVEDGGNPARSSTAILQVTVTDVNDNRPVFKEKDIEVNIPEDAAVGTSVTQLHATDADLGSNAKIHFYFGNQITNLAKRHFAIDNNTGLITVKEPLDREESPYHKLTVLASDGSSTPSRAT---VTINITDINDNIPSIDTRYIINP-------------VNGTVQLS-EKAPLNTKIALITVTDKDADLNGKVT--CFTDHDVPFRLKPVFDNQFLLETAAPLDYESTREYAIKIVASDSGKPPLNQSAMLLIKIKDE 457          
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 216.083 bits (549), Expect = 9.110e-57
Identity = 218/802 (27.18%), Postives = 358/802 (44.64%), Query Frame = 2
Query:  290 LKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESI--CINRELSSDCSSGQGHLEL---IVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTD------------IAPENAQIEYGLAEHHKSFQLCLDQ-QRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDL-YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQ------------------VIVTDKDDSQTNGKMICEHETTEP-RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS---LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CLLTPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            + Y + E +P + ++G++A+D    G     H   +YKL   +    +D K+  + T   +ID ES+  C N E    C      LE    + +L S V  L  +  +I ++D+NDN P F+   I   + E ++  G    +  ATD D            + PE AQ  +GL       Q+  DQ ++QP L ++  LD E +  Y + I+  +     + +   + + + D NDN P+F    +   + EN+P    + Q+ AND D       D  +  A++ +R+L  + ++  +I +   +D E     K  V   D     ++    +     D +     N  VIE+    G GLV  Q                  V V+D D+   N  + C      P +L+    +G + K   Y ++T TA D E   + ++ ++  D    S N  L+S+ ++ VQ+ D NDN P F QS       EN  I  ++++V+A D D G N ++HYS+  D S   +F I+  +G I V   +DRE +EHY  H+ AVD G   L  +  + ITV D NDN P  +L  + FSV EN+   + +G +   D+D G NA +  S    + + V+    GT+  +   DRE +  +  R++  D G   R    G V I V+D NDN P ++ P  +                ++    PG  +  + A D D   N +L Y I   N  P ++F  +   G ++L+K +   + G + + V V D G P      + + +I
Sbjct:   69 VAYRVPEEQPPNILIGSLASD---YGYPDSKH---LYKLELGHPYLRVDGKTGDIYTTETSIDRESLRECQNLEPGEKC-----FLEFEVSMTDLMSPVPRL--LDGQIEIMDINDNTPNFNSPVITLSIPENTN-IGMLFPIPAATDRDSGVNGVSSYELIVGPE-AQDLFGL-------QVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTN----DNKPVIEI---RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEG-VNAAVTCVVAGDVPFQLKQVSDTGSDSK-KKYFLQTTTALDYESVKEYTIEIVAVD----SGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVG-VTINVLDENDNAPVIVVPSNI------------SYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGN--PFELFQISHNNGEVTLEKAIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          

HSP 2 Score: 104.375 bits (259), Expect = 7.316e-22
Identity = 136/577 (23.57%), Postives = 241/577 (41.77%), Query Frame = 2
Query:  176 SYNYKLIFQQSGKMDILKTLFLFLTAVRCSETGIKECVLKYLIQ--ENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAG-SHIFLETATDTDIA-PENAQIEYGL-------AEHHKSFQL------CLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GL--YEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRL-EFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF--RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE--HDFSLFQIDSTTGVITVQGPVDRELKEHYKLH 1831
            SY+  +  Q  G      +  L ++ +  ++   K   + Y  +  EN P+   V  +  +    G+N E   S             +D+ + ++T+   ID E +            G     ++          A  +V I++ D NDN P        R     +H+ G ++I  +   +T +A  + + I+ G+             FQL        D +++ +L     LD E+   Y I+I A ++ +    +  ++ + V D NDN P F+ SL  V+  EN     ++ ++ A D DS    +       +   R +FS+  +   I +++ LD E+ + Y   V   D G+   +  + + + V D ND  P+ + N     VMEN  +   +G V V D D     G+    H + EP   EF + +G      T  I +  +FDRE  S  +  L   DG +       +S   + + +LD NDN P      +  + ++      GT +  V A D+D G+N ++ YS+   + F LFQI    G +T++  +   +++HY LH
Sbjct:  253 SYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDV------------GTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEI----RGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDAD----KGENAHIHLSVEPESGEFVIQNG------TGTILSSISFDREHQSTYTFRLKAVDGGDPPR----SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGEVTLEKAI---IRKHYGLH 796          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 237.269 bits (604), Expect = 1.838e-64
Identity = 224/808 (27.72%), Postives = 364/808 (45.05%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEF--HGSLIYKLSGPNCCFSIDQKSS----VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPA 2578
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN       SL+Y+L        + + SS    + T +  ID E +C     +S     +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F      V + EN P  + + QL A D D  S + +R+          ++LF++     +I +   LD E    +KV V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + +   Y + T +  D E + + S  ++ SD    S N     +  + V++ D NDNPP F Q      V+EN   G  +  ++A D D G N  I Y L  + S F +D  TGV+T     +RE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   D D G N  V  S    N++ V+   +G +      DRE +  +   V+  D G    R S+ +V I V+DVNDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   +G + + V++ D G P  +   +      N  A
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTL-INSRFPIPSATDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEREVP---FHLKAVYDNQ---YLLETSSLLDYEGTKEFSFKIVASDSGKPSLN----QTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG-QPPRSSTAKVTINVMDVNDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTA 778          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 236.884 bits (603), Expect = 3.134e-63
Identity = 224/808 (27.72%), Postives = 364/808 (45.05%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEF--HGSLIYKLSGPNCCFSIDQKSS----VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPA 2578
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN       SL+Y+L        + + SS    + T +  ID E +C     +S     +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F      V + EN P  + + QL A D D  S + +R+          ++LF++     +I +   LD E    +KV V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + + L   + T +  D E + + S  ++ SD    S    L  +  + V++ D NDNPP F Q      V+EN   G  +  ++A D D G N  I Y L  + S F +D  TGV+T     +RE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   D D G N  V  S    N++ V+   +G +      DRE +  +   V+  D G    R S+ +V I V+DVNDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   +G + + V++ D G P  +   +      N  A
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFPIPSATDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEREVP---FHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG-QPPRSSTAKVTINVMDVNDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTA 778          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 235.728 bits (600), Expect = 3.329e-63
Identity = 220/785 (28.03%), Postives = 365/785 (46.50%), Query Frame = 2
Query:  296 YLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESI--CINRELSSDCSSGQGHLELIVNLWSNVQLLA--VVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL-----AEHHKSFQLCLDQQ-RQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDL-YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQL--------IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP-RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS---LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CLLTPFEFSVRENL-APATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            Y + E +P + ++G++A D    G+    H   +YKL        +D K+  + T   +ID E +  C N+   + C      LE  V++   VQ  +  ++  +I V D+NDN P F+   I   + E ++  GS   +  ATD D  P N    Y L     A+     Q+  DQ+ +QP L ++ +LD E    Y + I+  +  +  + +   + + V D NDN P+F    +   + EN+P    + Q+ AND D  +    D  +  A   +R+L  + +N  +I +   +D E     +  V   D       AR+ + V V+D ND +P +             +  + E+  +   +  V V+D+D+ + N  + C      P +L  +  +G + K   Y ++T T  D EK    ++ ++  D    S N  L+S+ ++ VQ++D NDN P F QS       EN   G V+ +V A D D G N ++ YSLE + +   LF I    G I V+  +DRE ++ Y+L + A D GS  L  +  + + V D NDN P  +L+ + FSV EN+ A + +G +   D D G NA V  S    N D V+    GT+  +   DRE +  +  +++  D G+  R    G V I V+D NDN P +            T+P+ +    ++     G  ++Q+ A D D   N +LTY I   N  P  +F   S +G ++L+K +   + G + + V V D G PP     + +L++
Sbjct:   40 YKVPEEQPPNTLIGSLAAD---YGLPDVGH---LYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCI-----LEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTN-IGSLFPIPLATDRDAGP-NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSK-KKYFLQTTTPLDYEKVKDYTIEIVAVD----SGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG-VTINVLDENDNAPFI------------TAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN--PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 235.728 bits (600), Expect = 3.329e-63
Identity = 220/785 (28.03%), Postives = 365/785 (46.50%), Query Frame = 2
Query:  296 YLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESI--CINRELSSDCSSGQGHLELIVNLWSNVQLLA--VVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL-----AEHHKSFQLCLDQQ-RQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDL-YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD---GLYEARSXXXXXXXXXXXXSPQL--------IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP-RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS---LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CLLTPFEFSVRENL-APATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            Y + E +P + ++G++A D    G+    H   +YKL        +D K+  + T   +ID E +  C N+   + C      LE  V++   VQ  +  ++  +I V D+NDN P F+   I   + E ++  GS   +  ATD D  P N    Y L     A+     Q+  DQ+ +QP L ++ +LD E    Y + I+  +  +  + +   + + V D NDN P+F    +   + EN+P    + Q+ AND D  +    D  +  A   +R+L  + +N  +I +   +D E     +  V   D       AR+ + V V+D ND +P +             +  + E+  +   +  V V+D+D+ + N  + C      P +L  +  +G + K   Y ++T T  D EK    ++ ++  D    S N  L+S+ ++ VQ++D NDN P F QS       EN   G V+ +V A D D G N ++ YSLE + +   LF I    G I V+  +DRE ++ Y+L + A D GS  L  +  + + V D NDN P  +L+ + FSV EN+ A + +G +   D D G NA V  S    N D V+    GT+  +   DRE +  +  +++  D G+  R    G V I V+D NDN P +            T+P+ +    ++     G  ++Q+ A D D   N +LTY I   N  P  +F   S +G ++L+K +   + G + + V V D G PP     + +L++
Sbjct:   40 YKVPEEQPPNTLIGSLAAD---YGLPDVGH---LYKLEVGAPYLRVDGKTGDIFTTETSIDREGLRECQNQIPGNPCI-----LEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTN-IGSLFPIPLATDRDAGP-NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSK-KKYFLQTTTPLDYEKVKDYTIEIVAVD----SGNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVAEVTASDADSGSNAELVYSLEPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVG-VTINVLDENDNAPFI------------TAPSNTSHRLLTPQTRLGETVSQVTAEDIDSGINAELTYSIAGGN--PYGLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 236.498 bits (602), Expect = 4.108e-63
Identity = 224/808 (27.72%), Postives = 364/808 (45.05%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEF--HGSLIYKLSGPNCCFSIDQKSS----VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPA 2578
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN       SL+Y+L        + + SS    + T +  ID E +C     +S     +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F      V + EN P  + + QL A D D  S + +R+          ++LF++     +I +   LD E    +KV V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + + L   + T +  D E + + S  ++ SD    S    L  +  + V++ D NDNPP F Q      V+EN   G  +  ++A D D G N  I Y L  + S F +D  TGV+T     +RE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   D D G N  V  S    N++ V+   +G +      DRE +  +   V+  D G    R S+ +V I V+DVNDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   +G + + V++ D G P  +   +      N  A
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFPIPSATDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEREVP---FHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG-QPPRSSTAKVTINVMDVNDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVNDTA 778          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q9BZA7|PC11X_HUMAN (Protocadherin-11 X-linked OS=Homo sapiens OX=9606 GN=PCDH11X PE=2 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 1.467e-63
Identity = 233/813 (28.66%), Postives = 372/813 (45.76%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK +G      I++ +  + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +DG L  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDKD +  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N KI+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q+IAVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQE--KNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYK-TGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGINGVQ-NYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKD-ADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINYLLGPDAPPEFSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNCSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 125.946 bits (315), Expect = 9.535e-28
Identity = 106/354 (29.94%), Postives = 171/354 (48.31%), Query Frame = 2
Query: 1556 TSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-----LTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P +     + P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A+D D   N K+ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  230 SSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSA-MLFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSAMDADSGPNAKINY-LLGPDAPPE--FSLDCRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 3 Score: 99.7525 bits (247), Expect = 9.449e-20
Identity = 106/354 (29.94%), Postives = 155/354 (43.79%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR-----LINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  I +      A D D G+NG  +Y L   ++ F L  I++  G     + VQ  +DRE K+ Y + +   D G    +S+  L ++V D NDN P    T  E S+ EN    T + QL   D+DIG NA +   FS    N    +  +N T   + I +PLDRE    H L V   D GL   R     V + V DVNDN P      ++NP     ++D      S++I ++           LI V D DA  N ++T      + +P ++    S    L     L +     Y IK+   D+G PPL    M ++ + ++
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSIDIRYIVNP-----VNDTV--VLSENIPLNTK-------IALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDE 459          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 239.965 bits (611), Expect = 2.525e-63
Identity = 224/791 (28.32%), Postives = 361/791 (45.64%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEF--HGSLIYKLSGPNCCFSIDQKSS----VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            L+  +L    + C   ++ I + ++ Y I+E  P +  +G I  D+    IN       SL+Y+L        + + SS    + T +  ID E +C     +S     +   EL V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D      Q  Y L      F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F      V + EN P  + + QL A D D  S + +R+          ++LF++     +I +   LD E    +KV V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + + L   + T +  D E + + S  ++ SD    S    L  +  + V++ D NDNPP F Q      V+EN   G  +  ++A D D G N  I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+ PL S   + +TV D NDNSP      F+F V ENL   +T+G +   D+D G N  V  S    ND+ V+   +G +      DRE +  +   V+  D G    R S+ +V I V+DVNDN P +I+P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   +G + + V++ D G P
Sbjct:    3 LRDFYLLAALIACLRLDSAIAQELI-YTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNRIDREKLCAG---ASYAEENECFFELEVVILPN-DFFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFPIPSATDPDTGFNGVQ-HYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPARATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEREVP---FHLKAVYDNQYL---LETSSLLDYEGTKEFSFKIVASDSGKPS----LNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNFVLDPYSGVIKSNVSFDREQQSSYTFDVKATDGG-QPPRSSTAKVTINVMDVNDNSPVVISP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP 761          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 239.195 bits (609), Expect = 7.038e-63
Identity = 232/813 (28.54%), Postives = 372/813 (45.76%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK +G      I++ +  + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +DG L  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDKD +  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N +I+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q+IAVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQE--KNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYK-TGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGINGVQ-NYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKD-ADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 125.946 bits (315), Expect = 1.150e-27
Identity = 165/588 (28.06%), Postives = 256/588 (43.54%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN----------DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLF------SVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT-----IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDN--KPRLINPRGLREIDDATSP 2275
            +++SV D NDN P F +  IE  + E +   G+ +    ATD DI  ENA+I +  +       L  +  R+  LF LN           LD E   ++ + + A +           V + V D NDN P  +          +V++ EN P  + I  +   D D+    R   +       R L  V  N  ++  +++LDYE  + Y + +   D         ++L + V+DEND +P   Q+   + + EN+  G+ + +V  TD D S  N ++        P  EFSL   +   +LT   +     DREK  +    ++  D         LTS+ T+ V I+D NDN P F  ++Y  +V EN P    +  +   D D G N  +  S+  +   F IDS TGVI      DRE +E Y  ++ A D G +  +SS  + I V DVNDN P  + P      E + P+T     + Q+   D+D G NA+V +S    N   +      T  IT     +  D    RV ++ N L G+  S   V I  + VN++     LIN    + I+   +P
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENA-PVGTSVTQLHATDADIG-ENAKIHFSFS------NLVSNIARR--LFHLNATTGLITIKEPLDREETPNHKLLVLASDG--GLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR-LRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDAD-SGPNAEINYLLGPDAPP-EFSLD--RRTGMLTVVKK----LDREKEDKYLFTILAKDNGVPP----LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL-GQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP 796          

HSP 3 Score: 125.561 bits (314), Expect = 1.352e-27
Identity = 111/381 (29.13%), Postives = 178/381 (46.72%), Query Frame = 2
Query: 1475 FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-----LTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
             DREK     + +   DG         +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P +     + P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A D D   N ++ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  207 LDREKKDTYVMKVKVEDGGFP----QRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSA-MLFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 4 Score: 100.138 bits (248), Expect = 7.451e-20
Identity = 106/354 (29.94%), Postives = 155/354 (43.79%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR-----LINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  I +      A D D G+NG  +Y L   ++ F L  I++  G     + VQ  +DRE K+ Y + +   D G    +S+  L ++V D NDN P    T  E S+ EN    T + QL   D+DIG NA +   FS    N    +  +N T   + I +PLDRE    H L V   D GL   R     V + V DVNDN P      ++NP     ++D      S++I ++           LI V D DA  N ++T      + +P ++    S    L     L +     Y IK+   D+G PPL    M ++ + ++
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSIDIRYIVNP-----VNDTV--VLSENIPLNTK-------IALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDE 459          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 9.920e-63
Identity = 230/812 (28.33%), Postives = 367/812 (45.20%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK          +    + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +DG L  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDKD +  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N +I+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q+IAVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQE--KNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYKTGDVPLTRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGINGVQ-NYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKD-ADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 125.946 bits (315), Expect = 1.029e-27
Identity = 165/588 (28.06%), Postives = 256/588 (43.54%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN----------DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLF------SVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT-----IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDN--KPRLINPRGLREIDDATSP 2275
            +++SV D NDN P F +  IE  + E +   G+ +    ATD DI  ENA+I +  +       L  +  R+  LF LN           LD E   ++ + + A +           V + V D NDN P  +          +V++ EN P  + I  +   D D+    R   +       R L  V  N  ++  +++LDYE  + Y + +   D         ++L + V+DEND +P   Q+   + + EN+  G+ + +V  TD D S  N ++        P  EFSL   +   +LT   +     DREK  +    ++  D         LTS+ T+ V I+D NDN P F  ++Y  +V EN P    +  +   D D G N  +  S+  +   F IDS TGVI      DRE +E Y  ++ A D G +  +SS  + I V DVNDN P  + P      E + P+T     + Q+   D+D G NA+V +S    N   +      T  IT     +  D    RV ++ N L G+  S   V I  + VN++     LIN    + I+   +P
Sbjct:  235 LQVSVTDTNDNHPVFKETEIEVSIPENA-PVGTSVTQLHATDADIG-ENAKIHFSFS------NLVSNIARR--LFHLNATTGLITIKEPLDREETPNHKLLVLASDG--GLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFR-LRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDAD-SGPNAEINYLLGPDAPP-EFSLD--RRTGMLTVVKK----LDREKEDKYLFTILAKDNGVPP----LTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDL-GQPDSLFSVVIVNLFVNESVTNATLINELVRKSIEAPVTP 796          

HSP 3 Score: 124.02 bits (310), Expect = 3.565e-27
Identity = 110/381 (28.87%), Postives = 178/381 (46.72%), Query Frame = 2
Query: 1475 FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-----LTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
             DRE+     + +   DG         +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P +     + P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A D D   N ++ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  207 LDREEKDTYVMKVKVEDGGFP----QRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSA-MLFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          

HSP 4 Score: 100.523 bits (249), Expect = 6.729e-20
Identity = 107/354 (30.23%), Postives = 155/354 (43.79%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADV--VFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPR-----LINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F  +     + EN  I +      A D D G+NG  +Y L   ++ F L  I++  G     + VQ  +DRE K+ Y + +   D G    +S+  L ++V D NDN P    T  E S+ EN    T + QL   D+DIG NA +   FS    N    +  +N T   + I +PLDRE    H L V   D GL   R     V + V DVNDN P      ++NP     I+D      S++I ++           LI V D DA  N ++T      + +P ++    S    L     L +     Y IK+   D+G PPL    M ++ + ++
Sbjct:  125 IRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSIDIRYIVNP-----INDTV--VLSENIPLNTK-------IALITVTDKDADHNGRVT--CFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDE 459          
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 238.424 bits (607), Expect = 1.074e-62
Identity = 231/813 (28.41%), Postives = 372/813 (45.76%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDI-------EGLGINLEFHGSLIYKLSGPNCCFSIDQKSS-VLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMIC--EHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            MD+L   ++F   + C    +G +E    Y I+E  P + ++G +  D+       + L   ++F   L+YK +G      I++ +  + T    ID E +C        C       E+ V +  + ++  +V++R  + D+NDN P F    I   + E S    S   L  A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  Y++K++  +    ++ +   + + V D NDN P F  +   V + EN P  + + QL A D D    + + F      +N  R+LF +     +I I   LD E    +K+ V  +D GL  AR+++ V V D ND  P +    I NP    + + EN      I  + VTDK D+  NG++ C  +HE     + F L    + + L   + T    D E + + ++ L+ +D      N     S  + +++ D NDN P F QS     + EN   G  + KV+A D D G N +I+Y L  D    F +D  TG++TV   +DRE ++ Y   I A D+G  PL S+V + +++ D NDNSP      + F V ENL    T+G +   D D G N+ V  S    NDD  + +  G +      DRE ++ +   V+  D G    R SS +V I V+DVNDNKP  I P           P+      +    +PG V+ Q++AVD+D   N ++ Y I+  NT    +F+ +  TG ++L +      +G + + V   D G P    + +F + I N
Sbjct:    1 MDLLSGTYIFAVLLACVVFHSGAQE--KNYTIREEMPENVLIGDLLKDLNLSLIPNKSLTTAMQF--KLVYK-TGDVPLIRIEEDTGEIFTTGARIDREKLCAGIPRDEHC-----FYEVEVAILPD-EIFRLVKIRFLIEDINDNAPLFPATVINISIPENS-AINSKYTLPAAVDPDVGTNGVQ-NYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDK-DADHNGRVTCFTDHE-----IPFRLRPVFSNQFL---LETAAYLDYESTKEYAIKLLAADAGKPPLN----QSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAVTLSILDENDDFTIDSQTGVIRPNISFDREKQESYTFYVKAEDGG-RVSRSSSAKVTINVVDVNDNKPVFIVP-----------PSNYSYELVLPSTNPGTVVFQVMAVDNDTGMNAEVRYSIVGGNT--RDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQP----DSLFSVVIVN 769          

HSP 2 Score: 124.02 bits (310), Expect = 3.982e-27
Identity = 110/381 (28.87%), Postives = 178/381 (46.72%), Query Frame = 2
Query: 1475 FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPC-----LLTPFEFSV--RENLAPAT-IGQLQYEDSDIGRNADVV-FS-KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
             DRE+     + +   DG         +S+  + V + D NDN P F++++    + EN P+GT + +++A D D G N KIH+S  +  S     LF +++TTG+IT++ P+DRE   ++KL + A D G +P  + V +N+T  DVNDN P      ++ P   +V   EN+   T I  +   D D   N  V  F+    P     + +    L     LD E+   + +++   D G     QS+  + I+V D NDN P                  +  ++SI    SPG  +T++ A D D   N ++ Y +L P+  P   FS +  TG L++ K L       Y   +  KD+G PPL      ++ I ++
Sbjct:  207 LDREEKDTYVMKVKVEDGGFP----QRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSA-MLFIKVKDENDNAPVFTQ--------------SFVTVSIPENNSPGIQLTKVSATDADSGPNAEINY-LLGPDAPPE--FSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQ 563          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A4S2K5U7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011201 PE=4 SV=1)

HSP 1 Score: 343.199 bits (879), Expect = 1.034e-94
Identity = 300/978 (30.67%), Postives = 458/978 (46.83%), Query Frame = 2
Query:  275 IKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS-LIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQ-------GHL------------------------ELIVN-LWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKS----------FQLCLDQQRQPYLFLLNDLDAE-NQTHYLIKIR-----AWNAQDNKQW-----------------NELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR---LEFSLSSGKNKKILTYDIRTKTAFDRE-----KSSQISVVLICSDGWN----TSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFE---------------------FSVRENLAPAT-IGQLQYEDSDIGRNADVVF--SKTWPNDDTVMITV--NGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREI--------DDA---------------------TSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNST---------TGYLSLDKPLSHHYIGHYPIKVSVKDSGSP-PLIDEKMFYLFITNKPA-------------------KYDDKLQSNNGGSWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPC 2722
            I+E  L++ I EN P+   +GT+      + I   + G  L Y+   P+  F++D+ S  LT A  ID ES+C         +S Q       GH+                         L VN + S+  L AV R+ + V D+NDN P+FS+ R  R + E  ++ G  + L  A+D D+  E ++I+Y L     S          F+L +    QP L L  DLDAE N  H  + +       WN   + +W                 + L +++ V D NDN PRF+S  + V + E+TP  +MI++L+A+DPDST+ L + +  +A   +      +++  V+ + S+L++E    YKVP+ V DG + A+S L V V D NDE P+   NP  +   EN+  G +IG+V + D D    NGK+ C       R   L F      N     YD+ T+   DRE     +  ++ V LICSDG          +  T++ T  + + D ND+PP F QS Y   V EN  +G  I++V A D D+G N KI YSL  D + F++DS TG IT     DRE ++ Y++ + A D G   L+SSV LN+T+ DVND+ P LL P E                     F+++ENL+  T IG+L  +D DIG NA + F  +K  P        +  NG+LY  + LDRE K+ + L VR+ D        S+G + I V+DVNDN P  + P GL  +        DD+                     TS     ++ +SV + PGY+IT+L A D D   N  + Y +   +   +   S + T         +G + L + L+   +G +  KV+  D G P PL D K+  + + + PA                   +++ +L    G     K++L ++ +L+ +S    ++LVTAI+C+  PC
Sbjct:   45 IQERTLEFSIDENCPVGTELGTVV-----IPIAPHYMGPPLKYRFGSPSRLFAVDETSGQLTTAAPIDAESLCSKARQQEAGASSQSSDKQADGHMMRRHVPESEFTDQVTCSQSGAVSVHLDVNAIMSDSSLRAVHRISVRVQDLNDNGPKFSQVRWHRRLKEVLYRKGRRLDLPKASDADLLDEYSRIQYRLEPISNSTTKSSKLEIPFRLEVTPSGQPGLVLTEDLDAETNARHEFVLVAYSSAPVWNPSTSGKWSGLERGKMASQVPIPTEDRLYIEIEVADMNDNEPRFDSPSYKVSIAEDTPPGTMIYKLVAHDPDSTAQLVYSMGSSAEVAVMSATFNVESSGVVRLRSFLNFELRHTYKVPIRVNDGEFTAQSSLFVHVLDVNDEPPEFEVNPKRLVADENASVGKLIGRVRIQDPDSEAVNGKVECWEPEDLRRHQVLSFLPDPMSNPSASVYDLTTRVVLDREAFIGPQLGRLFVYLICSDGNGLPNENRPGVKHTATMTATLMVRDVNDHPPVFSQSVYHVAVRENNLLGEKIIQVKATDADEGDNAKISYSL-LDRANFKVDSLTGWITANVIFDRETRDSYQVTVVANDHGKERLSSSVLLNLTILDVNDHRPHLL-PCEGELPIIDRAHLQTGRIGDRNLFAIQENLSGNTFIGELLAKDDDIGLNAKLHFELAKETPLHYLTQFRLLHNGSLYTNRELDREEKEYYRLSVRVTDLSPTDPLSSTGTISIIVLDVNDNAPNFVQPSGLLRVGFDRPVVEDDSSPNILYDQPQLQNEVSSPVPLTSSNPKPTVLLSVREKPGYLITKLHAKDPDTGPNGHIRYTLAEFSDASTDFGSGSKTNPICRVTHDSGNVVLQRHLTVTDLGMHYFKVAAIDDGYPTPLKDTKILAVLVKDIPAVGSEPTNSLSSSYYSNNRTRFEFELWGFEG-----KSNLFIITVLASVSGLLASVLVTAIVCVSGPC 1010          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A4S2KYT3 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010451 PE=4 SV=1)

HSP 1 Score: 336.265 bits (861), Expect = 1.231e-92
Identity = 279/939 (29.71%), Postives = 462/939 (49.20%), Query Frame = 2
Query:  290 LKYLIQENEPIDRMVGTIATDIEGLG----------INLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHV---SEASHKAGSHIFLETATDTDIAPENAQIEYGLAEH-----HK--SFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQ-------------WNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETT----EPRLEFS------------------LSSGKNKKILTYD---IRTKTAFDREK-SSQISVVLICSDGWN-------TSANIH-LTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLN---------------SSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS-----KTWPNDD-----------TVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGL-REIDDATSPAASQ-----SISISVYQSPGYVITQLIAVDDDDATNTKLTYHI------LLPNTL---PSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYD-----------DKLQSNNGGSWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPC 2722
            ++Y I+EN+P +  +G +  D+              I      +L Y+L  P+  F + + +S L+   +IDLE++C  R      S+ Q  L L V +W   +  +V+ V +++LDV+DN PQF       +V    E  +KAG  + L  A D DI PENA+I+Y L  H     H   +F L      +  L L  DLD E    Y   + A +    ++              ++L + + V + ND  P F+ SL++V + E+T   + +  L A D D+ S + + L + +N+    LF V  +G VIL ++ LD+E+  +Y      +DG + A + L++ V D NDE P+ + NP +++V EN      +GQ+++ D+D  + NG++ C    T    +P L F                   + S  N +   Y    + T+  FDRE  S++   ++IC+DG +       T+A I   TS+ TI + + D NDN P F ++ Y A + EN P+GT +++V+A D D   + K  Y L  +    S F ++S TG I     +DRE +  Y+L + A+D G +P                 ++  + I + D NDN+P    P +F+V EN AP+  IG LQ  D D G N DV FS      T  +++            + +T NG+LY T+ LDRE +  +C  V ++D   +    S+  +C+RV+D+NDN P+ +N RG+ +++++ T   A +     ++S++  ++PGY      A D D+  N  L Y I      + P ++   P   F  ++ +G L L + LS + IG YP+ + V+D G P L  EK  Y+ I + P + +             + + +G +  + +++LVVI LS +S    A+L++AI+CM+KPC
Sbjct:   30 IRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLIQSTKRSTLKYRLREPSNYFRLHESTSELSTKLSIDLEALC-PRFCREGLSAAQ--LNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPSTLSRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVTRNDSRVMLVLQKDLDYERVQQYRFYLVASSPVSEERRPFGYVLGPQSAFHDQLEIQVDVLNINDIEPVFSQSLYTVEIPEDTKIGTTVHVLQATDRDANSTIEYSL-ENSND----LFQVQADGKVIL-TNKLDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSSALPMPPGISLDGAIIDSSANPEHHVYQRFGLYTRMEFDRESDSNKHRSLIICTDGQDVLTSHTSTTAAIQPRTSTLTIMLTVTDQNDNAPFFEKTHYEAELQENCPVGTKVIQVHANDADSETHAKPQYHLLRNALFTSPFDVESETGWIITSADIDRETQALYQLTVLAID-GHLPRTNHRNGQTNFRGQQHTATTHVQIKILDDNDNAPEFRGPRQFAVEENQAPSKWIGDLQVLDRDEGINRDVEFSMANLQSTAASEEQNKTFRVRSIAPIKLTNNGSLYTTEVLDREVQAHYCFEVAVKDKSPSKPLSSTDTICVRVLDINDNTPKFVNIRGMSQDLNNRTDAKALEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDAMKPESVSHTPLDAFMMDTQSGRLMLTRTLSGNEIGAYPLTLVVEDGGIPSLKSEKDIYIIIEDGPPRGNWLFPESERSIASSVSAKDGNN--EAHTILVVIGLSGVSAFLAAVLISAILCMIKPC 956          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A3R7CGZ3 (Protocadherin Fat 4 OS=Clonorchis sinensis OX=79923 GN=Fat4 PE=4 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.273e-91
Identity = 280/940 (29.79%), Postives = 459/940 (48.83%), Query Frame = 2
Query:  290 LKYLIQENEPIDRMVGTIATDIEGLG----------INLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIER----HVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEH-----HK--SFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQ-------------WNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETT----EPRLEFS------------------LSSGKNKKILTYD---IRTKTAFDREK-SSQISVVLICSDGWN-----TSANIHL---TSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIP---------------LNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS--------------KTWPNDDTVMI--TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGL-REIDDATSPAASQ-----SISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLP-NTL--------PSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYD-----------DKLQSNNGGSWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPC 2722
            ++Y I+EN+P +  +G +  D+              I      +L Y+L  P+  F + + +S L+   +IDLE++C  R      S+ Q  L L V +W   +  +V+ V +++LDV+DN PQF    I R     + E  +KAG  + L  A D DI PENA+I+Y L  H     H   +F L      +  L L  DLD E    Y   + A +    ++              ++L + + V + ND  P F+ S+++V + E+    + +  L A D D+ S + + L  + +     LF V  +G VILI+  LD+E+  +Y      +DG + A + L++ V D NDE P+ + NP +++V EN      +GQ+++ D+D  + NG++ C    T    +P L F                   + S  N +   Y    + T+  FDRE  S++   ++IC+DG +     TS N+ +   TS+ TI + + D NDN P F ++ Y A + EN P+GT +++V+A D D   + K  Y L  +    S F ++S TG I     +DRE +  Y+L + A+D G +P                 ++  + I + D NDN+P    P +F+V EN AP+  IG LQ  D D G N DV FS              KT+     + I  T NG+LY T+ LDRE +  +C  V ++D   +    S+  +C+RV+D+NDN P+ +N RG+ +++++ T   A +     ++S++  ++PGY      A D D+  N  L Y I    +T+        P   F  ++ +G L L + LS + +G YP+ + V+D GSP L  EK  Y+ I + P + +             + +  G +  + +++LVVI LS +S    A+L++AI+CM+KPC
Sbjct:   30 IRYAIKENQPENLRIGKLDEDLLQTPENENSELFSLIQSTKRSTLKYRLREPSNYFRLHESTSELSTKVSIDLEALC-PRFCRDGLSAAQ--LNLFVAVWYEERPFSVIHVEVTILDVDDNSPQFPPT-ISRPYVLQLKEVIYKAGKQVELPKAIDKDIQPENAEIQYRLQSHLDDSSHALDTFHLVTRNDSRVMLVLQKDLDYERVQQYRFYLVASSPVSEERRPFGYVLDPQSAFHDQLEIQVDVLNINDIEPVFSQSIYNVEIPEDAKIGTTVHVLQATDRDANSTIEYSLENSND-----LFKVQADGKVILINK-LDFEKRNKYTFTARASDGEFYALTRLDITVTDVNDEPPEFVTNPPILKVEENQPSQTSVGQLLIVDRDSPEVNGRVTCHEPPTLAGRQPLLFFPETSNALPMPPGISLDGAIIDSSANPEHHVYQRFGLYTRVEFDRESDSNKHRSLIICTDGQDILTSHTSTNVAIQPRTSTLTILLTVTDQNDNAPFFEKTHYEAELQENCPVGTKVVQVHANDADSETHAKPQYHLLRNALFTSPFDVESETGWIITSADIDRETQALYQLTVLAID-GHLPGTNHRNGRSNFRGQQHTATTHVQIKILDDNDNAPEFRGPRQFAVEENQAPSKWIGDLQVLDRDEGINRDVEFSMANLPSTAASEEQNKTFRVRSVIPIKLTNNGSLYTTEVLDREIQAHYCFEVVVKDKSPSKPLSSTDTICVRVLDLNDNTPKFVNIRGMSQDLNNRTDAKAFEDLRDITVSLTFREAPGYCALIAEAEDSDEGRNALLRYTIKFDGDTMKTESVAHTPLDAFMMDAQSGRLMLTRTLSGNELGAYPLTLVVEDGGSPSLKSEKNIYIIIEDGPPRGNWLFPENERSIASSMSAKEGNN--EAHTILVVIGLSGVSAFLAAVLISAILCMIKPC 956          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: G4V8S4 (Putative cadherin OS=Schistosoma mansoni OX=6183 GN=Smp_129830 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.556e-91
Identity = 301/993 (30.31%), Postives = 456/993 (45.92%), Query Frame = 2
Query:  389 SLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESIC----------INRELSSDC------------------------SSGQGHLELIVN-LWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH-----------KSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAW-----------NAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNE-LRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR---LEFSLSSGKNKKILTYDIRTKTAFDREK-----SSQISVVLICSDG---------WNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFE---------------------FSVRENLAPAT-IGQLQYEDSDIGRNADVVF----SKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGL------------------------------------------REIDDATSP---------AASQSISISVYQSPGYVITQLIAVDDDDATNTKL------TYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL-IDEKMFYLFITNKPAKYDDKLQ--------SNNGGSWVDK------NXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKN-----AGTIDSNSGAL 2833
            +L YKL  P+  FS+D++  +L    +ID E++C          IN    SD                         SSG   +   VN +  +  L AV  + + + D+NDN P+F + R  + + EA ++AG  I L  A D DI  E+++I Y L   H             F+L +    QP L L  DLDAE +T +   + A+           N Q   + + L +D+ V D NDN PRF+ +++++ V ENT   ++I++L+A+DPDSTS L + +  +   + +   F +  +G V L SS LDYE    Y +PV VTDG + AR+ L V V D NDE P    NP  +   ENS  G +IG+V + D D    NG + C       R   L F      N     YD+ T+   DRE         + + LICSDG          N+ + I LTS+ T  + I D ND+ P F  S Y   + EN PIG  ++++ A+D D+G N +I YSL  D + F++DS TG IT     DRE ++ Y++   A+D+G   L+SSV LNITV DVND+SP L + +E                     F VREN+   T +G +   D D G NA + F       +   +   +  NG+LY    LDRE KD + L V + D  L+    ++G + I V+D+NDN+P+ ++P GL                                          +E    +SP         A    + +SVY+ P  VI++L A D D   N  +       Y + +    P+ +      TG L L + ++   +G++  KV+  D G P + ID+K+  L + +KPA               SN  G  +D+       ++L++  LS +S    A+L++A+ C+ KPC +   NR+    +    +GR   ++N      G  DSN+G L
Sbjct:   88 ALNYKLGSPSTLFSVDERKGLLVTKADIDAEALCSYVTTLSPDHINNNDESDLMLEPGTSKNNRSKPIPVVDHIKCNSSGDLTVHFDVNAVQIDGSLRAVHHIVVRIHDLNDNGPKFDQIRWHKRLKEALYRAGRRIDLPKARDIDILAEHSRINYRLESWHNDGSSSIIPFKSPFKLEISNSGQPGLILTEDLDAEMETRHRFVLVAYSPNVIDSKNKLNGQAISRESRLEIDIEVADMNDNEPRFSFTVYNISVAENTSVGTVIYELVAHDPDSTSKLTYTMASSLEYQVMSSTFHIEADGHVRLHSS-LDYELRHIYSIPVEVTDGEFSARTTLNVQVLDVNDEPPAFELNPKQLIADENSPPGKLIGRVRIRDPDSPSVNGLVECSEPPGLVRRQALNFLPDPTVNPNAEVYDLTTRIMLDREDPENPIPGHLIIYLICSDGALSSGGMVSHNSDSKIRLTSTMTATLSIRDVNDHKPIFENSIYHMSIQENNPIGEKVVQIRAHDSDEGENARITYSLL-DRANFKVDSLTGWITPNVMFDRETRDSYQVTAIALDNGKPRLSSSVLLNITVLDVNDHSPVLAS-YEADESLLKTNDLPVGRFGLKNLFIVRENMPVNTYMGNILASDKDEGLNAQLRFMLFPDPVYRIHERFRLLPNGSLYTNVELDREEKDHYRLTVVVSDQSLDEPLTTTGTIGIIVLDLNDNQPQFLSPHGLLIPNNTQLSGYKRHMNRGIELYDQPSEDHNYNVAKGNQKRSDQEYQSESSPLTDTNTQSTAPEPVVRLSVYEKPDQVISKLYAEDPDAGDNGAVFYLLEEFYDLSVDKIRPNPLIRVQPETGELILIRHMAPIDLGYHFFKVTASDRGHPRMKIDQKILPLLVEDKPASGGLGQSSLSSSYYVSNITGLGLDEWGPSGGRNILIITALSIVSGILAAILISAVFCVTKPCSR---NRHGNRCV----NGRHNRLRNRPPTYPGGPDSNNGIL 1070          
BLAST of Protocadherin alpha-2 vs. TrEMBL
Match: A0A3Q0KLK9 (Putative cadherin OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.805e-91
Identity = 301/993 (30.31%), Postives = 456/993 (45.92%), Query Frame = 2
Query:  389 SLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESIC----------INRELSSDC------------------------SSGQGHLELIVN-LWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH-----------KSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAW-----------NAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNE-LRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR---LEFSLSSGKNKKILTYDIRTKTAFDREK-----SSQISVVLICSDG---------WNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFE---------------------FSVRENLAPAT-IGQLQYEDSDIGRNADVVF----SKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGL------------------------------------------REIDDATSP---------AASQSISISVYQSPGYVITQLIAVDDDDATNTKL------TYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL-IDEKMFYLFITNKPAKYDDKLQ--------SNNGGSWVDK------NXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKN-----AGTIDSNSGAL 2833
            +L YKL  P+  FS+D++  +L    +ID E++C          IN    SD                         SSG   +   VN +  +  L AV  + + + D+NDN P+F + R  + + EA ++AG  I L  A D DI  E+++I Y L   H             F+L +    QP L L  DLDAE +T +   + A+           N Q   + + L +D+ V D NDN PRF+ +++++ V ENT   ++I++L+A+DPDSTS L + +  +   + +   F +  +G V L SS LDYE    Y +PV VTDG + AR+ L V V D NDE P    NP  +   ENS  G +IG+V + D D    NG + C       R   L F      N     YD+ T+   DRE         + + LICSDG          N+ + I LTS+ T  + I D ND+ P F  S Y   + EN PIG  ++++ A+D D+G N +I YSL  D + F++DS TG IT     DRE ++ Y++   A+D+G   L+SSV LNITV DVND+SP L + +E                     F VREN+   T +G +   D D G NA + F       +   +   +  NG+LY    LDRE KD + L V + D  L+    ++G + I V+D+NDN+P+ ++P GL                                          +E    +SP         A    + +SVY+ P  VI++L A D D   N  +       Y + +    P+ +      TG L L + ++   +G++  KV+  D G P + ID+K+  L + +KPA               SN  G  +D+       ++L++  LS +S    A+L++A+ C+ KPC +   NR+    +    +GR   ++N      G  DSN+G L
Sbjct:   88 ALNYKLGSPSTLFSVDERKGLLVTKADIDAEALCSYVTTLSPDHINNNDESDLMLEPGTSKNNRSKPIPVVDHIKCNSSGDLTVHFDVNAVQIDGSLRAVHHIVVRIHDLNDNGPKFDQIRWHKRLKEALYRAGRRIDLPKARDIDILAEHSRINYRLESWHNDGSSSIIPFKSPFKLEISNSGQPGLILTEDLDAEMETRHRFVLVAYSPNVIDSKNKLNGQAISRESRLEIDIEVADMNDNEPRFSFTVYNISVAENTSVGTVIYELVAHDPDSTSKLTYTMASSLEYQVMSSTFHIEADGHVRLHSS-LDYELRHIYSIPVEVTDGEFSARTTLNVQVLDVNDEPPAFELNPKQLIADENSPPGKLIGRVRIRDPDSPSVNGLVECSEPPGLVRRQALNFLPDPTVNPNAEVYDLTTRIMLDREDPENPIPGHLIIYLICSDGVLSSGGMVSHNSDSKIRLTSTMTATLSIRDVNDHKPIFENSIYHMSIQENNPIGEKVVQIRAHDSDEGENARITYSLL-DRANFKVDSLTGWITPNVMFDRETRDSYQVTAIALDNGKPRLSSSVLLNITVLDVNDHSPVLAS-YEADESLLKTNDLPVGRFGLKNLFIVRENMPVNTYMGNILASDKDEGLNAQLRFMLFPDPVYRIHERFRLLPNGSLYTNVELDREEKDHYRLTVVVSDQSLDEPLTTTGTIGIIVLDLNDNQPQFLSPHGLLIPNNTQLSGYKRHMNRGIELYDQPSEDHNYNVAKGNQKRSDQEYQSESSPLTDTNTQSTAPEPVVRLSVYEKPDQVISKLYAEDPDAGDNGAVFYLLEEFYDLSVDKIRPNPLIRVQPETGELILIRHMAPIDLGYHFFKVTASDRGHPRMKIDQKILPLLVEDKPASGGLGQSSLSSSYYVSNITGLGLDEWGPSGGRNILIITALSIVSGILAAILISAVFCVTKPCSR---NRHGNRCV----NGRHNRLRNRPPTYPGGPDSNNGIL 1070          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 235.343 bits (599), Expect = 4.195e-63
Identity = 217/778 (27.89%), Postives = 364/778 (46.79%), Query Frame = 2
Query:  296 YLIQENEPIDRMVGTIATDIE-GLGINLEFHGSL----IYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            Y ++E +P +  +G + TD++  L  N++   +L    +YK               + T A  ID E +C     S   +  +   E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    +   + +A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  +++KI+  +  +  + +   + + V D NDN P F  S   V V EN P  + + QL A D D  S + + F      +   ++ F++  +  +I +   LD E +  +K+ V  +DG    +R+ + V V D ND  P +    I NP    + + EN+     I  + VTD+ D+  NGK+ C    T+  + F L    N + L   + T    D E + + ++ ++ SD    S    L +S  + ++I D NDN P F Q +    + EN   GT ++K+ A D D G N  I YSL  D    F ID  +G+++V   +DRE +E Y   + A D+GS PL S+V + + V D NDNSP      + F V ENL    T+G +   D+D G NA V  S     D+ ++    G +      DRE +  +   V+  D+GL  +  S  +V I V+DVNDN+P  + P      D            +    +PG V+T++ A+D+D   N +L Y I+     P  +F+ + TTG ++L + +++   G + + V VKD G P  +    + +LF+
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC-----SGVFNEKRCFYEIEVAVLPD-EIFRLVKIRFLIEDINDNAPLFQSTVINISIPENT-AINNRYPVPSAFDPDVGINGIQ-HYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDR-DADLNGKVTC---YTDHDVPFRLKPVFNDQFL---LETAAPLDYETTREYAIKIVASD----SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGL-IQTTSYAKVTINVVDVNDNRPVFVIPSSNYSYD-----------LVPFTTNPGSVVTRVFAIDNDTGMNAELQYSII--GGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFV 812          

HSP 2 Score: 105.916 bits (263), Expect = 1.348e-22
Identity = 102/349 (29.23%), Postives = 155/349 (44.41%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQID---STTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS---KTWPNDDT--VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F+ +     + EN  I       +A+D D G+NG  HY L    S F +D   +  G     + VQ  +DRE K+ + + I   D G+ P +S+  L +TV DVNDN P    +  E +V EN    T + QL   D+D+G NA + FS   +  P       + +  G + + +PLDRE+   H L V   D      R +   V + V DVNDN P +     +  ++     + +  ++  +          LI V D DA  N K+T +    + +P ++    +    L    PL +     Y IK+   DSG PPL    M  + I ++
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRAT---VIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKI---------ALITVTDRDADLNGKVTCYT--DHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDE 499          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 233.417 bits (594), Expect = 1.249e-62
Identity = 223/807 (27.63%), Postives = 374/807 (46.34%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSI-DQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNPS--VIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFITN 2569
            LK  +L  T V C   +  I + ++ Y I+E    + ++G I  D+    +N     S  L+Y+L   +G N    +      + T +  ID E +C       S+CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D+ P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F  S   V + E++P  + + QL A D D  + + +++      +   R+LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND +P +    I +P+   + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + +   Y + T    D E + +    ++ SD    S N     +  + V++ D NDNPP F Q      V+EN      +  + A D D G N +I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+  L S   + +T+ D NDNSP      F+F V ENL   +T+G +   D+D G NA V  S    N++ ++    G +      DRE +  +   VR  D+G +    S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +    G + + V++ D G P  +    + +L++ N
Sbjct:    3 LKDFYLLATLVACLWLDPAIAQELI-YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECS-----FEIEVVILPN-DYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDMGP-NSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSG-HPPCSSAAKVTINVIDVNDNPPIVIYP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN--KGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNN 775          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 234.958 bits (598), Expect = 1.289e-62
Identity = 217/778 (27.89%), Postives = 364/778 (46.79%), Query Frame = 2
Query:  296 YLIQENEPIDRMVGTIATDIE-GLGINLEFHGSL----IYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            Y ++E +P +  +G + TD++  L  N++   +L    +YK               + T A  ID E +C     S   +  +   E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    +   + +A D D+     Q  Y L +    F L +    +  + P L +  +LD E +  +++KI+  +  +  + +   + + V D NDN P F  S   V V EN P  + + QL A D D  S + + F      +   ++ F++  +  +I +   LD E +  +K+ V  +DG    +R+ + V V D ND  P +    I NP    + + EN+     I  + VTD+ D+  NGK+ C    T+  + F L    N + L   + T    D E + + ++ ++ SD    S    L +S  + ++I D NDN P F Q +    + EN   GT ++K+ A D D G N  I YSL  D    F ID  +G+++V   +DRE +E Y   + A D+GS PL S+V + + V D NDNSP      + F V ENL    T+G +   D+D G NA V  S     D+ ++    G +      DRE +  +   V+  D+GL  +  S  +V I V+DVNDN+P  + P      D            +    +PG V+T++ A+D+D   N +L Y I+     P  +F+ + TTG ++L + +++   G + + V VKD G P  +    + +LF+
Sbjct:   68 YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC-----SGVFNEKRCFYEIEVAVLPD-EIFRLVKIRFLIEDINDNAPLFQSTVINISIPENT-AINNRYPVPSAFDPDVGINGIQ-HYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDR-DADLNGKVTC---YTDHDVPFRLKPVFNDQFL---LETAAPLDYETTREYAIKIVASD----SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLI-QTTSYAKVTINVVDVNDNRPVFVIPSSNYSYD-----------LVPFTTNPGSVVTRVFAIDNDTGMNAELQYSII--GGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFV 812          

HSP 2 Score: 105.916 bits (263), Expect = 1.402e-22
Identity = 102/349 (29.23%), Postives = 155/349 (44.41%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQID---STTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS---KTWPNDDT--VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F+ +     + EN  I       +A+D D G+NG  HY L    S F +D   +  G     + VQ  +DRE K+ + + I   D G+ P +S+  L +TV DVNDN P    +  E +V EN    T + QL   D+D+G NA + FS   +  P       + +  G + + +PLDRE+   H L V   D      R +   V + V DVNDN P +     +  ++     + +  ++  +          LI V D DA  N K+T +    + +P ++    +    L    PL +     Y IK+   DSG PPL    M  + I ++
Sbjct:  165 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKSVSEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRAT---VIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKI---------ALITVTDRDADLNGKVTCYT--DHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDE 499          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 234.187 bits (596), Expect = 2.145e-62
Identity = 215/778 (27.63%), Postives = 362/778 (46.53%), Query Frame = 2
Query:  296 YLIQENEPIDRMVGTIATDIE-GLGINLEFHGSL----IYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQ----IEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-LYEARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFI 2563
            Y ++E +P +  +G + TD++  L  N++   +L    +YK               + T A  ID E +C     S   +  +   E+ V +  + ++  +V++R  + D+NDN P F    I   + E +    +   + +A D D+     Q    ++ G  E         +  + P L +  +LD E +  +++KI+  +  +  + +   + + V D NDN P F  S   V V EN P  + + QL A D D  S + + F      +   ++ F++  +  +I +   LD E +  +K+ V  +DG    +R+ + V V D ND  P +    I NP    + + EN+     I  + VTD+ D+  NGK+ C    T+  + F L    N + L   + T    D E + + ++ ++ SD    S    L +S  + ++I D NDN P F Q +    + EN   GT ++K+ A D D G N  I YSL  D    F ID  +G+++V   +DRE +E Y   + A D+GS PL S+V + + V D NDNSP      + F V ENL    T+G +   D+D G NA V  S     D+ ++    G +      DRE +  +   V+  D+GL  +  S  +V I V+DVNDN+P  + P      D            +    +PG V+T++ A+D+D   N +L Y I+     P  +F+ + TTG ++L + +++   G + + V VKD G P  +    + +LF+
Sbjct:   28 YTVKEEQPENVRIGNLRTDLDLNLDPNIKLSSALQFKPVYKTGDVPLVRVEASTGEIFTTANRIDRERLC-----SGVFNEKRCFYEIEVAVLPD-EIFRLVKIRFLIEDINDNAPLFQSTVINISIPENT-AINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRATVIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKIALITVTDR-DADLNGKVTC---YTDHDVPFRLKPVFNDQFL---LETAAPLDYETTREYAIKIVASD----SGKPPLNTSAMVLIKIKDENDNAPVFPQPEIQLSIPENNDPGTQLIKITATDADSGSNALIIYSLGPDAPDGFNIDPRSGILSVSKRLDREKQEKYSFTVIARDNGSNPLQSNVTVKLIVQDQNDNSPAFTHAEYNFYVPENLPLYGTVGLITVTDADAGDNAIVTLSIINGKDNFIIDPKTGVIKPNITFDREQQSSYTFVVKAVDSGLI-QTTSYAKVTINVVDVNDNRPVFVIPSSNYSYD-----------LVPFTTNPGSVVTRVFAIDNDTGMNAELQYSII--GGSPRGLFAIDKTTGNITLQEKIANADQGLHRLVVKVKDLGQPESLHSIALVHLFV 773          

HSP 2 Score: 105.916 bits (263), Expect = 1.542e-22
Identity = 102/350 (29.14%), Postives = 156/350 (44.57%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEH----DFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS---KTWPNDDT--VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDA-TNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            I   I D NDN P F+ +     + EN  I       +A+D D G+NG  HY L      +F L  I++  G     + VQ  +DRE K+ + + I   D G+ P +S+  L +TV DVNDN P    +  E +V EN    T + QL   D+D+G NA + FS   +  P       + +  G + + +PLDRE+   H L V   D      R +   V + V DVNDN P +     +  ++     + +  ++  +          LI V D DA  N K+T +    + +P ++    +    L    PL +     Y IK+   DSG PPL    M  + I ++
Sbjct:  125 IRFLIEDINDNAPLFQSTVINISIPENTAINNRYPVPSAFDPDVGINGIQHYELVKVGALEFGLDIIETPEGDKWPQLIVQQNLDRETKDTFVMKIKVEDGGNPPKSSTAILQVTVSDVNDNRPVFKDSEVEVNVPENAPMGTSVTQLHATDADLGSNAQIHFSFSNQISPATKRHFAIDSSTGLITVKQPLDRESNPVHKLIVLASDGSATPSRAT---VIVNVTDVNDNVPSIDTRYIMNPVNGTVLLSENAPLNTKI---------ALITVTDRDADLNGKVTCYT--DHDVPFRLKPVFNDQFLLETAAPLDYETTREYAIKIVASDSGKPPLNTSAMVLIKIKDE 460          
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 233.032 bits (593), Expect = 2.222e-62
Identity = 223/807 (27.63%), Postives = 374/807 (46.34%), Query Frame = 2
Query:  224 LKTLFLFLTAVRCS--ETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGS--LIYKL---SGPNCCFSI-DQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNPS--VIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE-KMFYLFITN 2569
            LK  +L  T V C   +  I + ++ Y I+E    + ++G I  D+    +N     S  L+Y+L   +G N    +      + T +  ID E +C       S+CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D+ P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F  S   V + E++P  + + QL A D D  + + +++      +   R+LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND +P +    I +P+   + + E       I  + V+DKD +  NGK+IC  E   P   F L +  + +   Y + T    D E + +    ++ SD    S N     +  + V++ D NDNPP F Q      V+EN      +  + A D D G N +I Y L  + S F +D  TGV+T     DRE +E +   + A D+G+  L S   + +T+ D NDNSP      F+F V ENL   +T+G +   D+D G NA V  S    N++ ++    G +      DRE +  +   VR  D+G +    S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +    G + + V++ D G P  +    + +L++ N
Sbjct:    3 LKDFYLLATLVACLWLDPAIAQELI-YPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNRIDREKLCPGPSYEDSECS-----FEIEVVILPN-DYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDMGP-NSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKD-TDVNGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYIFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILNDNENFILDPYTGVIKSNVSFDREQQSSYTFDVRAVDSG-HPPCSSAAKVTINVIDVNDNPPIVIYP-----------PSNTSFKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN--KGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYPKSLHTLVLVFLYVNN 775          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 216.853 bits (551), Expect = 4.158e-58
Identity = 219/792 (27.65%), Postives = 362/792 (45.71%), Query Frame = 2
Query:  278 KECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKL-------SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQ---LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH----KSFQLCLDQ----QRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTS----VLRF---DLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE---ARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSG 2521
            +E  + Y + E       +G  + D+     NLE    L YK+       + P       +   +    + +D E++C  ++   +C     H+++ V +   VQ      ++ VRI+V D+NDN P F+   +   V E +  AG    ++ A D D +  N    Y L         +F+L + +    ++ PYL +   LD E +  Y + +RA +           + + V D NDN P F+ +  +V + EN+P  + + QL A+D D+ S    V R         +    ++LF + QN  ++ ++  L+ E    Y++ +  TD   E   A + + V V D ND SP +    I  P   VI + E S   L +  + V+D D    NG + C      P + F L      K LTY     + T+   D E  ++  V +  +D   TS    L+ + ++ +++LD NDN P F +  Y   V EN  IG  ++ V+A D D   N ++ Y L  D  ++F +D  TG+I++   +DRE K +Y   I A D G   L  +  + + V DVNDN P   L  F+F V EN+   +T+G +   DSD G N  V  S     D+  + +++   G +      DRE +  + L V+  D G    R S+ +V I V+D+NDN P ++ P           P+ +    +     PG ++T++ AVD+D   N +L YHI+  N  P  +F  +   G ++L +PL+  + G + + V V D G
Sbjct:   35 EEFKVSYRVAEELREGAFIGNPSVDLRLADYNLE----LTYKVMLSKAEDAAPPLVRVNPRTGELFAAGRKMDREALCGGQDPGDEC-----HVDVQVGVLP-VQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENA-PAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIG-ANGAVTC--YIYNPEVPFQL------KKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATS----LSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLS-ILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGG-EPVRSSTVKVVIHVMDINDNSPIVLMP-----------PSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGN--PHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIG 786          

HSP 2 Score: 106.686 bits (265), Expect = 1.363e-23
Identity = 142/604 (23.51%), Postives = 262/604 (43.38%), Query Frame = 2
Query:  833 DAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTS--VLRFDLYQTANNELRKL-FSVLQ--NGTVI---LISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGW--------NTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTG----VITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPATIGQ----LQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYL----SLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            D  ++ H  +++     Q    +  + V + V+D NDN P F + + +V V EN PA        ANDPDS +  V R++L  +    +     SV +  NG  +   ++   LD E  Q Y++ +   DG    +   +VL + V D ND SP   Q    +E+ ENS  G  + Q+  +D+D + +N +++    T+      + S    K++   D     +      +RE+S    ++++ +D            +  +   +  +  ++I D               +++E   +   +  +   D D G NG +   + +    FQ+   T     ++  +  +D E K  Y + I A D+G+  L+ ++ + I + D NDN+P    P ++ SV EN     IG+    +   D D+ +NA++V+    P+  T+  M    G + +T+ LDRE K  +   +  +D G+    + +  V + V+DVNDN+PR      L E D   +    +  ++ +          +   D D+  N ++   IL   T   Q+FS +  +G +      D+   H+Y+    ++V   D G P
Sbjct:  112 DPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRD-AGSNAEVVYRLGTST---GGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDI------VAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPEN---NVIGKHLITVSATDRDMDKNAEMVYF-LGPDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIP-VLEGNATVIVNVLDVNDNRPRF----SLAEFDFYVNENVPKHSTVGM----------VTVADSDEGENGRVRLSIL--GTDNRQLFSIDPESGMIRSNVGFDREQRHYYV----LEVQATDGGEP 680          

HSP 3 Score: 101.293 bits (251), Expect = 6.676e-22
Identity = 143/554 (25.81%), Postives = 232/554 (41.88%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLND----------LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFN-----SSLFSVL-VKENTPARSMIFQLIANDPD---STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-----FEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKPLDRETKDRHCLRVRLRDNGL 2158
            +RI+V D NDN P F +  +   + E S   G+H+    A+D D A  NA++ Y L             +R   LF L+           L+ E    Y I I A +           V + V D NDN P        + +  V+ + E +     +  +  +DPD   + +V  +        +L+KL     N  ++     LDYE    Y V +   D    + S    +     D    +P   +    + V EN+  G  +  V  TD+D  + N +M+       P + F +        LT  +      DREK +  S  ++  D         L  + T+ V +LD NDN P+F  +++  +V EN P  + +  V   D D+G NG++  S+    +  LF ID  +G+I      DRE + +Y L + A D G    +S+V + I V D+NDNSP +L P     ++F V   L    + ++   D+D   NA++ +     N   +  +  V G + + +PL       H L VR+ D G+
Sbjct:  253 LRINVTDTNDNSPVFDQAEVNVEIPENS-PVGTHVVQLHASDRD-AGSNAEVVYRLGTSTGGAGSGQGGKR---LFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKL--TYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVSATDRDMDK-NAEMVYFLGPDAPTM-FHMDPETGIISLTEQL------DREKKANYSFTILAKD----QGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLSILGTDNRQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTYKFVVPRTLPGTIVTEVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGI 787          

HSP 4 Score: 97.8265 bits (242), Expect = 8.993e-21
Identity = 108/426 (25.35%), Postives = 187/426 (43.90%), Query Frame = 2
Query: 1352 DSQTNG----KMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS----------LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT--------------IGQLQYEDSDIGRNADV---VFSKTWPNDDTVMITVNGTLYITKP-LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            DS+ NG    +++     T    E S++   N + + Y +  + + DRE+     + L   DG +       + S  + + + D NDN P F Q++    + EN P+GT +++++A D D G N ++ Y L               LF++D  +G++TV G ++RE    Y++ I A D G  P+ ++  + +TV DVNDNSP +       +R+ +AP                +  +   D DIG N  V   +++   P     +   N  L  T+  LD ETK+ + ++++  D G     ++   V I+++D NDN P    P              +  +S+      G  +  + A D D   N ++ Y  L P+     +F  +  TG +SL + L      +Y   +  KD G P L
Sbjct:  181 DSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPY-LVVRKSLDREERQLYEMNLRAVDGGSPPH----SGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTI------EIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTM-SVTIKLLDSNDNAPVFTEP--------------TYKVSVPENNVIGKHLITVSATDRDMDKNAEMVY-FLGPDA--PTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVL 577          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 183.726 bits (465), Expect = 4.724e-47
Identity = 179/629 (28.46%), Postives = 281/629 (44.67%), Query Frame = 2
Query:  587 RVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTP-----ARSMIFQLIANDPDSTSVLRFDLYQTANNE----LRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSV-IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTY----DIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD-----------FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVF--SKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL-INPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTY 2383
            +V ISV DVNDN P F+   +E  V E + + G  IF  +ATD D   +NA + Y +    +     +D      L     LD E +  YL+ +R   A D     +  + + V D NDN PRF+   +S  V E+        R++I  ++A D DS        Y  A +E        F +      + ++  LD E    Y +    TDG   A +    +   + +++   +QN S+  EV E++  G  + ++  TD D            E     LEFS+SSG  +          +    A DRE+ S  ++V+  SD         L+S+  +++ + D NDN P F  S   A   E+ P+G V+  V A D D G N  + Y+L  D              F +++ TG + +   +DRE ++ Y L + AVD G  PL S+  L +TV D NDN+P      +E ++ E+  P T + +L   D D G N ++ +  +   P  D  +  V GTL + +PLDRE    + L VR RD G    R  +  V + + DVND  P   ++P  +   ++               Q P  +I Q++A DDD  ++ ++TY
Sbjct: 1501 QVEISVEDVNDNPPVFAVPEMELEVEENTGE-GEVIFTLSATDADQG-QNALVTYSVLSGSEG-AFVVDAASG-VLRASRRLDREERASYLLTVR---ASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEV-TYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDD------------EGVNAELEFSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPP-ARLSSAVRVSLILTDVNDNAPAF-TSPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGG-GPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENT--------------QGPPVLILQVVARDDDLGSSGQVTY 2092          

HSP 2 Score: 168.703 bits (426), Expect = 2.400e-42
Identity = 152/569 (26.71%), Postives = 251/569 (44.11%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENA-QIEYGLAEHHKSFQLCLDQQRQPYLFL----LNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSW--LDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSP--QLIQNPSVIE---VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVV--FSKTWPNDDTVMI---TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP 2224
            VR+ V DVNDN P F +  +     +     G  + L+TA D D+ P       Y +   ++  +L   +      FL       LD E    Y + ++A +    +++  L V++ V D NDNPP F    +   V E++P  + +  L+                   +  R   +V  +    ++S+   LD+E  ++Y + +   DG       R+   + + D ND  P  + +  P       V E++  G V   V VTD D    NG++         R  F L +     +    ++  +  DRE+    ++ ++ SD     A    +++ ++ V + D ND+ P+F  S Y A ++E  P G+ +  V A D D GLN K+ YS+   +D   F +D +TG++T  G VDRE+     L+I A D G+ P  +   L +T+ DVND  P    T +  +  EN  P   +  +   DSD+G N  V   F    P     M    ++ G +   K LDRE  + + L V+ +D G +    S+ +V + V D+NDN P
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLL-------------------HRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRV--LKVASQLDRERIPMYNLTILASDNGKPVAR---SATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRG-SPPLGSTAKVTVVVGDLNDNHP 552          

HSP 3 Score: 164.851 bits (416), Expect = 3.397e-41
Identity = 196/775 (25.29%), Postives = 328/775 (42.32%), Query Frame = 2
Query:  332 VGTIATDIEGLGINLEFHGSLIYKLSGPN--CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQ----LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLET--ATDTDIAPENAQIEYGL-----AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLY-EARSXX--XXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSL--SSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEH-----DFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP---FEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRH------CLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSP----GYVITQLIAV---DDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
             G+   D+  +  +   +  L Y +   N    FS+D+ + ++T    +D       RE++S          +++N+ +  Q      A   + +++LDVND  P F++ +   +V+ A   +   +F+ +  A D+D+  EN  + Y       A++ + F+L         +  L  LD E    Y + ++A +       +   V + V D NDN P F    +   + EN P  + +  + A DPD  +   +R+ L  TA +  R   + +       +S  LD E    Y++ V   DG +  ARS     + V D  D  P   ++     V EN   G ++G V  +  D +     +I   +    R  FS+  S G+        I T  A DRE+ +   + ++ + G        +    +++V + D N++ P F ++ Y   +AE+ P+ +    V A D D G NG++ Y +        F +F      G + V+  +DRE +E Y L + A+D+G  PL+SSV +N+TV DVNDN P   +    F F   + +  + +G +Q  D+D G N  V +S   P  +  + +  G +   +  DRE   R          V   D G     Q    V + V DVNDN P+                        SVYQ+        +TQL+ V   D D+  N  L Y I   N      F+ +++TG ++L   L       Y + VS  DSG+ PL
Sbjct:  356 AGSYVKDVTAMDADSGLNAKLRYSIVSGNDLGWFSVDESTGLVTTDGKVD-------REVAS---------SVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTK---YVATAVENSLPGLFVVSVSAADSDLG-ENGTVRYNFDPDMPAQYREMFRL---DSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL--TAGDAARFQVNAVTGAVSTRVS--LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQ---RGSFSIEWSGGR--------IFTANAIDREEQAFYQLRVVANSGG-------VAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFP----DGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVG-SLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAK---------------------SVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNE--GGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPL 1057          

HSP 4 Score: 156.377 bits (394), Expect = 1.338e-38
Identity = 153/614 (24.92%), Postives = 262/614 (42.67%), Query Frame = 2
Query:  404 LSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAG----SHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN---DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS-----PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKK--------------ILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL--FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENL--APATIGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRD 2149
            LSG    F +D  S VL  ++ +D E    +  L+   S G    +               R+ ++V D NDN P+FS+      V+E +   G    + I    A D D  P   ++ Y LA    S          P    LN    LD E++  Y+++ RA +         L V++   D NDN P   +   +  V E+ P  + + ++ A D D       + +  ++ +    F+V  +G  + ++  LD ER   Y + V V+D      + L   V      +          +P      E+S  G V+  V   D D  + +             +E++L++   +                +T ++R     DRE     ++ ++  D         LTS+ T+ V + D NDN P+F + +Y A +AE+ P GT +L+++A+D D+G NG++ Y +        F++D   G + V  P+DRE    Y+L + A D G    + +  + +T+ DVND SP   L+P+    REN    P  I Q+   D D+G +  V ++    ND     ++ +G +++ + LDRE + +H L +   D
Sbjct: 1556 LSGSEGAFVVDAASGVLRASRRLDREERA-SYLLTVRASDGTHATD--------------ARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGP-FGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLYVNVL--DANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELE-FSISSGDPEGRFAVGNDGQ-LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVATVQAVDPDSGRNS------------YVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVD----KGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHARENTQGPPVLILQVVARDDDLGSSGQVTYAAAGGNDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 5 Score: 155.221 bits (391), Expect = 2.780e-38
Identity = 158/571 (27.67%), Postives = 250/571 (43.78%), Query Frame = 2
Query:  914 VDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENS---GKG--LVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGK-NKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-----EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIP---LNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP------ATIGQLQYEDSDIGRNADVVFSKTWPNDDT-----------VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            V++ V+D NDNPP F      + V+ENT    +IF L A D D    +++ + +   +       F V     V+  S  LD E    Y + V  +DG +   + L V V D ND SP+  ++    +V E++   GK    VIG V+  D D    +G          P  +   + G      +T  +      DRE  +   +    +DG   +A   L       V +LD NDN P  +     A V E+ P GT +L+++A D D+G+N ++ +S+     E  F++       G ++V   +DRE +  Y L +   D    P   L+S+V +++ + DVNDN+P   +P     R  LAP      A +  +Q  D D GRN+ V ++     ++             + TV G + + + LDRE +  + L V   D G      S+  + + V D NDN PR   PR  RE + A          I+  + PG  + +L A D D+  N +L Y I   +  P+  F  +   G L++ +PL       Y + V  +D G P
Sbjct: 1502 VEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGA----FVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDAD----SGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATARLY------VNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGRFAV----GNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSP-----RSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKG-RPPLTSTATLAVTVGDANDNAPRF--PR--REYEAA----------IAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGD--PTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGP 2032          

HSP 6 Score: 145.591 bits (366), Expect = 3.058e-35
Identity = 193/742 (26.01%), Postives = 301/742 (40.57%), Query Frame = 2
Query:  392 LIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEAS----HKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLL---NDLDAENQTHYLIKIRAW-NAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXX---XXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP---RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAPAT-IGQLQYEDSDIGRNADVV---------FSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            L+++  GP      D K+ +++  + +D E+    R+ +    +  G          N  L       I +LDVNDN P      +      AS       G+   L T TD D    N ++   +   ++     L     P L +L   + LD E    Y + I A  N +   +    ++ +YV+D ND+ PRF  S ++  + E  PA S +  + A D DS   + LR+ +   + N+L   FSV ++  ++     +D E      + +   D   + ++    L       NDE P   Q   V   +ENS  GL +  V   D D  + NG +    +   P   R  F L S      LT  + T  + DRE+  +  +V+   D      +  L S+  + V + D NDN P F   QYFA + EN P GT +  V A D D G NG + Y L   D + FQ+++ TG ++ +  +DRE +  Y+L + A+D G +   S   + ITV D  D  P      + F V EN+AP T +G +     D+  N   +         FS  W           G ++    +DRE +  + LRV     G+ G       V + V DVN++ P                  AS  +SI+  +        + A D D   N ++ Y I   N    + F      G L +   L       Y + VS  D+G  PL
Sbjct:  158 LLHRGRGP-LAVPFDPKTGMVSTRQPLDFEA---RRQYTLSLRAADG---------GNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSI--VSGNDL-GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGE-NGTVRYNFDPDMPAQYREMFRLDS------LTGKVTTLKSLDREELEEYPLVVQAQD----RGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGSFSIEW---------SGGRIFTANAIDREEQAFYQLRVVANSGGVAGE----ASVSVLVHDVNNHAPVFDR--------------ASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNG--GEKFGI-FPDGQLYVRYELDRETREEYSLTVSAMDTGVEPL 842          

HSP 7 Score: 145.206 bits (365), Expect = 3.444e-35
Identity = 166/625 (26.56%), Postives = 279/625 (44.64%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH--KSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTS----VLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG----LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKT-----AFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEF-SVRENLAPAT-IGQLQYEDSDIGRNADVVFS--KTWPNDDTVMI-TVNGTLYITKPLDRE-TKDRHCLRVRLRDNGL--NGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHI 2389
            V + V DVN++ P F +   E  ++E      S  F   ATD D   +N +++Y + E +  + F +  D Q    L++  +LD E +  Y + + A +       + + V++ V D NDN P FNSS +     E     S++  + A D D+ S       F+  Q  N EL      + +  V    + +       +   V  TDG      + R+ ++V V+D ND  PQ  ++     V E++     + +V  +D D+   NG            L ++++ G      T D  T       + DRE+++  ++V+  +D    S    L +S T+ VQ+LD NDNPP+F +S       E+  +G +++ + A D D G +G + Y++   +  + F ID +TG + +   +D E +  Y+L++ A D G  P +S+  L + V D NDN P  L    F S+ EN+   T +  +   D D   N ++ +S  + +P      I   +G +     +DRE T     + VR  D  +  + RR +   V + V D NDN PR + P  +  + D    AA            G V+  L A D D+A N  + Y +
Sbjct:  744 VSVLVHDVNNHAPVFDRASYEVSIAE-DEPVNSRFFSVRATDKDSG-KNGEVKYEIGEGNGGEKFGIFPDGQ----LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQV-NFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEG-VNGA-----------LRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATD----SGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAI--LVDGLRAAA------------GSVVGTLQASDPDEAENAAVRYAV 1331          

HSP 8 Score: 140.198 bits (352), Expect = 1.218e-33
Identity = 149/543 (27.44%), Postives = 244/543 (44.94%), Query Frame = 2
Query:  572 LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLND---LDAENQTHYLIKIRAWNAQDNKQWNE-LNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR--LEFSLSSGKNKKILTYDIRTKTAF-----DREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEH-YKLHIHAVDSGSIPLNS--SVGLNIT--VDDVNDNSPCLLTPFEFSVR--ENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRET 2113
            L + V V ++VLDVNDN P F+      H  E   + GS +    ATD D A  N  + Y   +   +F+L  +  R   L + +    +       +   + A +    K   +   V ++V D NDNPP+F  S++   V E+    + + ++ A+D D      LR+ + +   NE  K       G + L+ S LD E    Y + V  TD       A   + V V DEND  P+  ++   ++ +E++     +G++++T          +    E T P   + +++ +G        D  T + F     D E      + +   DG         +S+  + V + DFNDNPP F     FA + EN PIGT ++ V A D D  +NG++HYS+   F   + F ID  +G I     +DRE+    +++ + A D  +IP+++  S   N+T  V D NDN+P  +TP    V      A + +G LQ  D D   NA V ++ T   D  ++  ++   G +  +  LDRE+
Sbjct:  842 LSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCE-EQEVGSLVGAVQATDAD-AGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINE--GNEGGKFTVDASTGQITLLGS-LDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALEST----RVGELLIT----------LTASDEDTGPSGDVRYAIVAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPP----RSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDK-AIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYAVTG-GDAAILFRLDRRTGIIETSTELDRES 1359          

HSP 9 Score: 139.813 bits (351), Expect = 1.506e-33
Identity = 156/581 (26.85%), Postives = 253/581 (43.55%), Query Frame = 2
Query:  830 LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD--IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDREL------KEHYKLHIHAVDSGSI-PLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            LD E +  Y +++ A +    +  +   V + V D  D PP F    +S +V EN    +++  + A+  D  + +    Y   + + R  FS+  +G  I  ++ +D E    Y++ V    G     + + VLV D N+ +P   +    + + E+         V  TDKD S  NG++         + E    +G  K  +  D  +  +   DRE   + S+ +   D    +    L+SS T+NV +LD NDN P F  S Y  H  E   +G+++  V A D D G NG + YS E     F++DS TG I      DRE          +   + A D G   PL     + + V DVNDN P    + ++ SV E+ +  T + ++   D D G N  + ++    N+     TV+   G + +   LDRE    + L V   D+G +    +S  V ++V+D NDN PR      L  +D      A +S  +      G ++  L A D+D   +  + Y I+  NT     F+ + +TG + L + L       Y + VS +D G PP
Sbjct:  616 LDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANV---TYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKD-SGKNGEV---------KYEIGEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMD----TGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGG-KFTVDASTGQITLLGSLDREETASYTLVVSATDSGTS-PLAASCTVAVQVLDENDNPPRFTE--SLLSVD------ALESTRV------GELLITLTASDEDTGPSGDVRYAIVAGNT--HATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPP 1161          

HSP 10 Score: 116.701 bits (291), Expect = 1.763e-26
Identity = 100/340 (29.41%), Postives = 151/340 (44.41%), Query Frame = 2
Query: 1559 SSFT-INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYS-LEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAP------ATIGQLQYEDSDIGRNADVVFS------KTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREI-DDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            SSF  + + + D NDNPP F   +    V EN   G VI  ++A D D G N  + YS L      F +D+ +GV+     +DRE +  Y L + A D       +   L++ V D NDNSP      + F V E+ AP      A IG +   D+D G   +V ++        W +    +  V G L +T+PLDRE++  + LR R  D    G   ++  + + V+D NDN P + N     E+ +DA                PG  + ++ A DDD+  N +L + I   +  P   F+  +  G LS+ + L       Y + V V D    P
Sbjct: 1497 SSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHA---TDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATD---GGGLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDA---------------PPGTSLLRISATDDDEGVNAELEFSISSGD--PEGRFAVGN-DGQLSVARALDRERQSFYNLVVRVSDRARHP 1812          

HSP 11 Score: 115.161 bits (287), Expect = 6.172e-26
Identity = 192/869 (22.09%), Postives = 345/869 (39.70%), Query Frame = 2
Query:  170 TVSYNYKLIFQQSGKMDILK---TLFLFLTAVRCSETGIKECVLKYLIQENEP-IDRMVGTIATDIEGLGINLEFHGSLIYKLSGPN--CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELR--KLFSVLQNGTVILISSWLDYE-RHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPI----GTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQG---PVDRELKEHYKLHIHAV------------DSGS-----IPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMI-TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQ-------IFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT----NKPAKYDDKLQS 2602
              S+++ ++    G+   L+   T+ +F+  V  +     + V +  + E+   + +++   A+D++  G+N    G+L Y ++  N    F++D  +  +T+  ++D E       + S   SG               L A   V + VLD NDN P+F++  +     E S + G  +   TA+D D  P +  + Y +   +      +D+     +FL   LD E Q  Y + + A +     + +   + ++V DFNDNPP F        + EN P  + +  + A DPD+   +  +L+ +   +      F++      I  ++ +D E     ++V V  TD    ++  RS L+ +     DE   +P+ +   +++     +  G V+G +  +D D+++               + ++++ G    +   D     I T T  DRE       + + +     +A     +  TI    + FN   P+F Q           PI    G  I   ++Y     L  + H   E +  L       GV    G   P+D   +  + L    +            D+G+      P++S   + I+V+DVNDN P    P  E  V EN      I  L   D+D G+NA V +S    ++   ++   +G L  ++ LDRE +  + L VR  D    G   +   + + V D NDN PR    R     D A   A     + +       VI  ++A D D     ++TY +      PS+        F  +  TG L++ +PL       Y ++    D G   L      Y+ +     N P+  +D L +
Sbjct:  934 AASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVD-EGVN----GALRYAINEGNEGGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTS------------PLAASCTVAVQVLDENDNPPRFTESLLSVDALE-STRVGELLITLTASDEDTGP-SGDVRYAIVAGNTHATFAIDRSTG-SVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDAD--VNGELHYSIARQFPPGAHFTIDPESGEICTAAEIDREVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQASDPDEAENAA------------VRYAVTGGDAAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAPRTQRAENTIIANSMTFNHPLPRFPQDY-------ESPINLLQGQTIPMPSSY-----LFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRRLDREERASYLLTVRASD----GTHATDARLSVAVRDANDNSPRF--SRHAYSFDVAEDAAPDGKTTRA-------VIGTVLAGDADSGPFGEVTYAL-----APSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAA 1736          

HSP 12 Score: 79.7221 bits (195), Expect = 3.398e-15
Identity = 87/335 (25.97%), Postives = 132/335 (39.40%), Query Frame = 2
Query: 1571 INVQILDFNDNPPKFRQSQYF-AHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE-----HDFSLFQIDSTTGV----ITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNG---LNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDAT-NTKLTYHILLPNTLPSQIFSFNSTTGY--LSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            + V + D NDN P F +         E+  +G  +L   A D D G NG  H++ +      +  L      T      +   GP+DRE    Y L + A D GS      + +N+TV D NDN P    P   + R ++A         EDS +G     +  +             G +   +PLD E + ++ L +R  D G   L+GR        I+++DVNDN P          I     P A++S S+    +PG V   +   D D  T N +L+  I+  N     +       G   L +   L    I  Y + +   D+G P
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKP---AYRASVA---------EDSPVGAALRDLLHRGRGPLAVPFDPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGR----ATAVIQLLDVNDNDP---------AIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKP 318          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.007 bits (419), Expect = 1.846e-41
Identity = 201/756 (26.59%), Postives = 326/756 (43.12%), Query Frame = 2
Query:  329 MVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESI------CINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGS--HIFLETATDTDIAPENAQIEYGL---AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIK--IRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD-STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG-----LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVV----LICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL--FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLA-PATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMIT--VNGTLYITKPLDRETKDRHCLRVRLRDNGLNG-RRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDK-PLSHHYIGHYPIKV 2503
            +V  +ATD++  G+     G + Y  S  +  FS+D  S ++++A  +D E+        + R+     ++G                    RVRI++LDVNDN P F +   + +V  A     S   +    ATD D +P N QI Y +   + +   F + +       + L   LD E      I   I A +       + +   + V D NDN P F+ + +S+ + EN  A + +  + A D D S    +  L  +     +  F +      I  ++ LD E   +Y + V   DG          + + + + D ND  P     P  + ++EN+  G  I  V   D D ++ NG ++   +   P    + +SGK +        T    DRE  + IS      ++ S     S     T+S T+ V + D NDN P F    Y   V E  P  + + +V A D D+G NG + YS+        FQ+D+ TG+IT    +DRE    Y+L + A D G+  L+S+  L++ V DVNDN+P         S+ E++A  + +  L   D+D G NA++ F  T  N D        +G +     LDRETK  + L +   DNG  G RR  +  + + V+DVNDN+P  +                S  +S+    + G +I Q+ A D D+  N ++ Y I+  N      F  N ++G +S    PL    +  + ++V
Sbjct:   49 VVQVLATDLDA-GV----FGQVSYHFSDDSDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAG--------------------RVRINLLDVNDNTPVFQR---DSYVGTARENDNSLTPVVRVRATDED-SPPNNQITYSILPTSAYSSYFSITVSGGYG-VVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGSTQ--FRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNE-NGTLVYAIDPPNPFYRINAASGKIRT-------TGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDADSGLNAELSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLE--------------GSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQ--DGNFLVNVSSGLISRGATPLDRETVALHALQV 748          

HSP 2 Score: 134.035 bits (336), Expect = 1.160e-31
Identity = 179/781 (22.92%), Postives = 331/781 (42.38%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSI---DQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENA-QIEYGLAE-HHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDL------------YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---------LYEARSXXXXXXXXXXXXSPQL-IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICE-HETTEPRL--EFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF-RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQ--GPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFE-FSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPS---QIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            I EN P   ++  +   I     +   + +L Y L G +  + +   D+ +  + + + +D E I              G LEL + +    +  A VR+ ++VLDVNDN P F+      HV E S   G+ + +  A D D+   +A  + Y +A   + +F +    +    +  +  +D E +  YL+ + A +           + + + +  D    F+ + +   + E     +++ ++ A    +   L   L            ++   ++  +L + LQ    I   + LD E    Y + V   DG           +  + + V V DEND SP+    + +++EV E++  G ++  +  TD+ D+ +NG +    H  T  R+  ++ L       +   D+  K  F  + S  I   ++  DG +       +++F ++V +LD NDN P F     Y   V E G  GT++  V A D D G NG++ + +E        I  + G+I V     +DRE +  Y L + AVD G+ PL+ S  + + VDDVND  P  L P +  SV E+L+  + +  ++  ++  G N    +       +   +     L  +  L  ++ +R  L     D+G       +G + + V+DVND++P  + P       + T    ++ + + +       I +++AVD D+  N  + Y  L    + S   + F  N+T+G +S  + L       Y + +   D G P
Sbjct: 1509 IPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIP------------GGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGI---DESTGLIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGE--ITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDR-DAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDV-AKADFVEKTSQFILFRIVALDGGSPPR----STTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRL-LKSYERFNLTAVATDHGRPPLWGQAG-LYVEVLDVNDHRPVFVLP------PNGTVVNITEVMPVVIR------IVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSGIISTARALDRESQAVYSLILLASDQGQP 2252          

HSP 3 Score: 131.724 bits (330), Expect = 5.023e-31
Identity = 155/581 (26.68%), Postives = 252/581 (43.37%), Query Frame = 2
Query:  878 NAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREK--SSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLN-GKIH--YSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSS--VGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITK-PLDRET------KDRHCLRVRLRDNGLNGRRQ-SSGEVCIRVIDVNDNKPRLIN-PRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            N    + W    V + + + NDN P F+  L++V V EN    + + Q++A D D+    +   + + +++    FS+     +I +++ LD+E   R+ V V   D G  E    + + + D ND +P   ++  V    EN      + +V  TD+D    N        T+     FS++      ++T       A D EK     IS+ ++  DG +   N    S+ T  V++ D NDN P F ++ Y   + EN   G  +L VNA D D     G++   YSLE   + F+I++ +G IT    +DRE    Y L + AVD G      +    +NIT+ DVNDN P     P+  ++ EN    T I  +   D D+  N  +V++   PN    +   +G +  T   LDRE            + V   D G   RR  +S  V + + DVNDN+P  +  P  L+ ++    PA S              + Q+ A D D+  N  +TY   +   LP   F  ++ TG ++    L    +  Y +++   D G+P L       L +
Sbjct:    4 NETSGEHWGSARVHITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSD---KFSLDPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGRVRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTL----ARALDYEKIPGGTISLTIMALDGGSPPLN----STVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLEGS-TQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGL--PANS-------------TLFQVTATDPDEGANGNVTYS--MTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVV 555          

HSP 4 Score: 117.857 bits (294), Expect = 8.989e-27
Identity = 133/513 (25.93%), Postives = 220/513 (42.88%), Query Frame = 2
Query:  389 SLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQL--CLDQQRQPYLFL----LNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQG-PVDRELKEHYKLHIHAVDSGSIPLNSSV 1876
            SLIY L G +  F I+ +S  +T    +D E++     +      G G          N Q   +  V I++LDVNDN P +        + E +   G+ IF  +A D D+  EN  + Y +   +  +++     + R   L L    LN +   +    ++      +   +      V + + D NDN P F    +++ V E  PA S +FQ+ A DPD  +        TA    R  F +     +I     LD E    Y++ +  TD    A S    L     D    +P      S + +ME+  +  V+  +  TD D S  N +           L F ++ G      +       +RT  + DRE  +  S+V+   D  N  A    T + T++V +LD NDN P F +  Y   V EN   G +IL+V A D+D+G+NG++ Y +   +    F ++ ++G+I+    P+DRE    + L + A ++ S+ L+S +
Sbjct:  278 SLIYSLEG-STQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDG----------NDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENT-PGGTDIFTVSAADPDLN-ENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALP-RPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTFHPARSAVSLMESVARDSVVISLNCTDAD-SGLNAE-----------LSFFITGGNQDGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAID--NGPAGSRRTGTTTLDVLVLDVNDNRPLFLEGSYEVSVPENVTRGAIILQVQATDIDEGINGRVWYRIISGNQDGNFLVNVSSGLISRGATPLDRETVALHALQVEAFNNDSVGLSSVI 762          

HSP 5 Score: 99.7525 bits (247), Expect = 3.192e-21
Identity = 105/376 (27.93%), Postives = 169/376 (44.95%), Query Frame = 2
Query: 1304 SGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPV--DRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFS---KTWPNDDTVMI--TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGR--RQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHIL 2392
            S  G+ +  V  +D D+   N +++    +      F + +G    +LT       A D E S+ + ++++ +          LTS+ T++V + D ND  P F +S         G  G  I    A D D GLNG++ YS+      + F I    G + V+  V  DRE +  Y L I A D G+ PLNS++ + + V DV+DN P  L  P   S+ E  A  A + +++  D++ GRN   +      ++ N +      +  G +Y+ +PLDRE    + L + +RDN  N    R+ S  + + ++D NDN P         EI +  SP  +    ++V   P Y      A D D   N  L Y +L
Sbjct: 1186 STAGVAVANVTASDPDEGD-NARVVYAIVSGNTAATFGIDNGTG--VLT----AVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPE-NSPNGT---VLTVLNGPIY------ASDADFGVNATLAYSLL 1544          

HSP 6 Score: 93.5893 bits (231), Expect = 2.272e-19
Identity = 104/389 (26.74%), Postives = 175/389 (44.99%), Query Frame = 2
Query: 1409 EFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGP--IGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEH-YKLHIHAVDSGSIP---LNSSVGLNITVDDVNDNSPCLLTPFE--FSVRENLAPATIGQLQYEDSDIGRNADVVFS--KTWPNDDTVMITVNGTLYITK--PLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATN-TKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            E +L+   + KI T   R  T    ++++  S   IC     T+     T+S  I  +I D NDN P F  + Y   + E GP   G  +  V A D D+G N ++ Y++   +  + F ID+ TGV+T    +D E+    Y L + A D    P   L S+  +++ V DVND +P  L  +E    V E      I      D D G N ++ +S     P ++ V+   +G L + +   LDRET+  + L +  +D G      S+  V +RV+DV+DN P  +N      + +A +  A              +++++ A D ++  N   L  H         + F  +S TG + +++PL    +  Y + ++V+D+   P
Sbjct: 1110 EATLNKQASIKITTITQRLCTKVLVKRAASASTRGICL----TATPAQATTSVLI--RITDENDNAPAFGAATYEVLLTE-GPSTAGVAVANVTASDPDEGDNARVVYAIVSGNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMG-TPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLA--------------IVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNP 1476          

HSP 7 Score: 93.2041 bits (230), Expect = 3.238e-19
Identity = 150/557 (26.93%), Postives = 239/557 (42.91%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAE-NQTHYLIKIRAWNAQDN---KQWNELNVDLYVDDFNDNPPRFNSSLFSVL-VKENTPARSMIFQLIANDPDSTSVLRFDL-YQTANNELRKLFSVLQNGTVILISSW--LDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXX--XSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAF-----DREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVN----AYDLDDGLNGKIHYSLEHDFSL-FQIDSTTGVITV---QGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPA---TIGQLQYEDSDIG--RNADVVFSKTWPNDDTVMITVNGTLYIT-KPLDRETKDRHCLRVRLRDNG 2155
            A   V I + D NDN P F     E  ++E    AG  +   TA+D D   +NA++ Y +   + +    +D      L  +  LD E +   YL+ + A +   +   +  +   V ++V D ND  P F  S    + V E  P    I   +A+D DS   L  +L Y   + + R  F +      + +  +  LD E    Y + +   D G     S L V V   +     P  +  P+   + E +    ++ +V  +D ++ + N   + +H  T      S  +G  ++    D +T   +     DRE+ ++  + L   D  +  +     S   I V ILD NDN P F Q  Y A + EN P GTV+  +N    A D D G+N  + YSL    S  F ID   G +++   QG +DRE     +L +  +       N++V L +TV DVNDN+P   +T     V EN +PA   ++  ++  D D+G      V +S     +DT  I  +  L +T  P+D ET+  + L V   D  
Sbjct: 1154 ATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEG-DNARVVYAIVSGNTAATFGIDNGTG-VLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEGQPG-PRIATFMASDQDSG--LNGELEYSIIDGDPRNEFVISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGR-NCAALLQHSPT------SFCNG--ERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMI-VTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQG-LDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLEN-SPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQA 1693          

HSP 8 Score: 81.2629 bits (199), Expect = 1.390e-15
Identity = 99/389 (25.45%), Postives = 167/389 (42.93%), Query Frame = 2
Query: 1286 IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEH-DFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAV--DSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRE--NLAPATIG--QLQYEDSDIGRNADV---------VFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLI-AVDDDDATNTKLTYHILLPN 2401
            + V+E    G ++  V  TD D +  NG++    E+        LS G +  I+   +      DRE  +  +++++  D      N  L+ S  + V + D ND  P F        V E+  +G+ +  V A +   G N K  Y +     + F + +T+G++T      R LK + + ++ AV  D G  PL    GL + V DVND+ P  + P   +V     + P  I   ++   D D G+N  V         V S+ W  +   +   +G +   + LDRE++  + L +   D G     +S+  + + + D++DN+P  I       + D  +P   QS SI  +  PG  +  +  AVD D   N  + Y I   N
Sbjct: 1961 VSVVELGAPGTLVASVWATDAD-AGPNGQVTFRIESGGGD---KLSIGPSDGIIR--VAPGANIDRETRAAYTLMVVAVD----RGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTST----RLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDW--ESFRINATSGIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFI------VLPDGGAP--YQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGN 2325          

HSP 9 Score: 73.9442 bits (180), Expect = 2.491e-13
Identity = 182/815 (22.33%), Postives = 308/815 (37.79%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPY-------LFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVD---DFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVL------QNGTVILISSWLDYE--RHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI----LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDL--------------DDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGS----IPLNSSVG--LNITVDDVNDNSPCLLTPFE------FSVRENLAPAT-IGQLQYEDSDIGRNADVVF------SKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNG---RRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSL--DKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            + E +P  R+   +A+D +  G+N E   S+I     P   F I      L + + ++L+     RE     +    +L ++        L + + V + VLDV+DN P F        +SEA+        L   +    +  N          H     C + +R  Y       +++   LD E    Y + +   +  DN  +   + D+ +    D NDN P F+   +   + EN+P  +++  L  N P   S   F +  T    L    S        +    + +   LD E     R ++ + V D G   A   L V V D ND +P          V+ENS     +G  ++  K   +  G  +C+  T    + +S++SG N        T  I T    D E   +  ++++ +D     A    T+S  + V + +  D    F  + Y A ++E    GTV+++V A  +                    K H   E D +   I +  G IT Q  +DRE  + Y L + + D G       L +  G  + + V D NDNSP     FE        VRE+ AP T +  L   D D G N  V            P    ++I     + I      +  ++    +  R   L+G    R ++  + + V+DVNDN P  ++P G              ++S+    +PG ++  + A D D   N ++T+ I    +      S   + G + +     +       Y + V   D G+PPL    +  + +
Sbjct: 1292 VSEGQPGPRIATFMASDQDS-GLNGELEYSIID--GDPRNEFVISPADGDLRVRRYVELD-----RE-----TQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAA------AVLAIVSRVRASDANEGRNCAALLQHSPTSFC-NGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNGTVLTVL--NGPIYASDADFGVNATLAYSLLGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPA---VGTSVIVVKAMDRDLG--VCDAGT----VRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATD----QAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAEL-IAALQGEITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSP----EFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGY-------------AVSVVELGAPGTLVASVWATDADAGPNGQVTFRI---ESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLV 2050          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004043.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004043.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.688 bits (400), Expect = 3.379e-39
Identity = 154/553 (27.85%), Postives = 249/553 (45.03%), Query Frame = 2
Query:  596 ISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFV---TDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI--LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDT----VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDN 2218
            ISV + N   P+F+   +E  + E +H AGS +   TATDTD A  N  I Y +A    S    + +     L L+ +LD E +  Y + + A +     +     V + V D NDNPP  N+S +  ++ EN P+ + +  + A D DS S     +Y   + E   LF + Q   V+    +LDYE  Q Y++ V      D  + + + + V +   N+  P+ +Q      V E++  G  +G V  TD+D +  +G +          + F  S  K   +   T +I   +  DRE+ +  ++ +I  +  +            +NV I D ND PP F  + Y   V+E   +GT ++ V+A+D D     +    L    +    F I++ TG+I V  P+DRE    Y L + AVD G  P   +  + + ++DVNDN P LLT          A  T+  L+  D D+  N      +   +D        ++ +G L   +P+DRE K    L V + D G +    S+  + + V+D NDN
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPE-NHPAGSSLARVTATDTD-AGVNGAIVYSIASGDGSGLFDISRASGDVL-LVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNA-VTMYSLDDGEA-DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRD-AGIDGTVF--------YMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRG--FDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAG-SPPLTSTVTLHLSVLDQNDN 1277          

HSP 2 Score: 157.147 bits (396), Expect = 8.318e-39
Identity = 177/680 (26.03%), Postives = 288/680 (42.35%), Query Frame = 2
Query:  569 QLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL--AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQW-NELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS--PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKN-KKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPL---------SHHYIGHYPIKVSVKDSGSPPL 2533
            +L     V + V D NDN+P+F    +   V E +   GS + L  ATD D A  NA I Y L   + H S      Q     +     LD E +  Y++++ A +        +   + + V D ND+ PRF ++ +      + PA + +F + A D D+     LRF L  +A+      FSV     VI  +  L   R     + V V+DG    RS +  +     D    P+    P      E+   G  I    V     S+  G            + + L+SG N   +   D     +    A D E      +V+   D    S     ++   + V +LD NDN P+F  S+++A V EN P  T+++ + A D D G+NG++ YS+   +  ++F+++  +G I     +DRE    Y+L + A D GS   + +V + I+V D NDNSP     F   VRE+ A    + ++   D+D G NA + FS   P+    +    G + +++ L+RE +  + ++VR  D         S +V I V DVNDN PR        E  +   P+  +++           + ++ A D DD  N ++ + +       ++ F     +G +   +PL         S   +  Y   V+  D G PPL
Sbjct:    5 RLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDA-PIGSDVALVNATDAD-AGLNAIISYRLRGGDGHFSVNPSTGQ-----IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSAS----AGFSVDPRRGVIHAARALQGPRDD-LTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTI---TVVAARSSRRAGP-----------VSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARD----SGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWT----VSTDVTIVVDDVNDNAPRFGQTAYYIEFPE---PSEGEAL-----------VARVSASDADDGANGQVFFFM----RSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPL 631          

HSP 3 Score: 142.124 bits (357), Expect = 3.997e-34
Identity = 169/687 (24.60%), Postives = 298/687 (43.38%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSN--VQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKS-SQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVREN-LAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLS 2452
            F++D +S  +++ + +D E               Q H EL+V    +      A +++ + VLD+NDN P+FS  R    V E +      I + TA D D    N Q++Y + + +      ++      +  ++ LD EN   Y + ++A +     Q   + V + V D NDN PRF + +FS  V+E+      + ++   D D    + + F L   +       FS+  +   I +S  L+ E    Y V V  +D  +   + + ++V+D ND +P+  Q    IE  E S    ++ +V  +D DD   NG++     +          SG+   +     R         + ++ S V+   D         L+S  T+ + I+  N N P+F + +Y   VA     GT IL ++A D D  +NG+I YS+   +    F +D+  G + ++  +  +    + + + A D G  PL+S     I+V + N  +P     P E S+ EN  A +++ ++   D+D G N  +V+S    +   +  +   +G + +   LD ET+  + L V   D G   + + SG V I V DVNDN P ++N      +    +P+             G  +  + AVD D  +N    Y +   +   + +F  N  TG L+
Sbjct:  279 FAVDPQSGEVSVHRALDHEY--------------QHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP--RTIVVLTAVDKDSG-INGQVDYSIIDGNIGNVFRVNPNSG-EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF-TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS-----LPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDG-ANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD----RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSG-VSISVTDVNDNPP-MLNASDYYPVIPENAPS-------------GTTVLVMDAVDADSPSNAVTMYSL---DDGEADLFVLNQKTGVLT 917          

HSP 4 Score: 127.487 bits (319), Expect = 1.068e-29
Identity = 166/675 (24.59%), Postives = 292/675 (43.26%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR---SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPL--NSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT--IGQLQYE-DSDIGRNADVVFSKTWPNDDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGE--VCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNT-KLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            V I+++  N N P+F ++R    V+ A+ +AG+ I   +A D D    N QI Y +   + S +  +D     +L L   L  +  + + + + A +       +     + V + N   PRF      + + EN PA S + ++ A D D+  V    +Y  A+ +   LF + +    +L+   LDYE  + Y + V   DG ++A+   S + + V D ND  P L  +     + EN+  G  +  +   D D S +N   +   +  E  L F L    N+K      +    ++ +++ +++V       +N     H +++  ++VQI   N+  P+F Q +Y   V+E+ P+G  +  V A D D G++G + Y L  E     F ++  TG I V   +DRE +    L + A ++GSI       V +N+ + D ND        +   V E  +  T  +G   ++ DS  G        ++        I  + G + +  PLDRE+   + L V   D G      ++G   V + + DVNDN P L+                + S  ++  Q  G  +  L A D D   N    T+ +L  +      FS  S++G L   +P+       + + V++ D+GSPPL      +L + ++
Sbjct:  637 VTINIVVPNANAPRFLRERYSTPVA-ATVRAGTRILDMSAVDPDRD-VNGQIAYSVVGGNASRRFDVDAGG--FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDA-GVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDAD-SPSNAVTMYSLDDGEADL-FVL----NQKTGVLTTQGFLDYETKQTYELTV-----RAFNYPDTFHYSTA-QVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMG---EPPATGTTVVVVALEDVNDNGPFLL----------------TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQ 1274          

HSP 5 Score: 110.153 bits (274), Expect = 2.139e-24
Identity = 144/583 (24.70%), Postives = 225/583 (38.59%), Query Frame = 2
Query:  830 LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKE---------HYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-----TPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSG 2521
            LD E Q HY + + A ++        L +++ V D NDN P F+SS F   V ENTP R+++  L A D DS    + D Y   +  +  +F V  N   I   S LD E    Y++ V  TD     +     ++    DE   SP+  Q  S   V E++  G  + +V   D D+              +P L FS+         T +I      +RE  S  +V +  SD  W  S ++         + + D NDN P+F Q+ Y+    E      ++ +V+A D DDG NG++ + +      F++   +G I    P+                Y   + A+D G  PL+S   + I +   N N+P  L     TP   +VR   A   I  +   D D   N  + +S    N      +   G L++   L  +      + V  RD G      S     I V + N   PR  +P                 +S+      G  + ++ A D D   N  + Y I   +   S +F  +  +G + L   L +     Y + V   D G
Sbjct:  294 LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVD-YSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSA-HVREDAAVGFPVLRVSTLDADEGP---NAAITFSLLDPSLPFSIHPS------TGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDV--------TIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVR---AGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRG-RPPLSSRATAIISVTEENQYAPRFAHP--------------PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG--SGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGG 836          

HSP 6 Score: 80.4925 bits (197), Expect = 2.374e-15
Identity = 115/502 (22.91%), Postives = 212/502 (42.23%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLL--AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQW--NELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXX----XSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP--RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQ----YFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNI 1888
            F ++QK+ VLT    +D E+              +   EL V  ++       +  +V + +  VN+  P+F ++     VSE S   G+ +    ATD D A  +  + Y L    +S    +++     + + + LD E +    +++ A NA   + +  +E+ V++ + D ND PP F+S+L+   V E     + +  + A+D DS    R   +   +    + FS+  +  +I+++S LD E    Y + V   D + E  +    +V    +      P L+   S  +V EN   G+ +  +   D D     G    +   ++P  R  FSLSS       +  ++T    DRE+  +  + +  +D    + +  LTS+ T+++ +LD NDNP + R  +    YF      G IG V  +    D+ D  N  +       F++F     T  +  Q    R  +  ++L +   D    P  ++  +N 
Sbjct:  907 FVLNQKTGVLTTQGFLDYET--------------KQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSE-SAPVGAPVGSVFATDRD-AGIDGTVFYMLFGESRSKGFSVNEHTG-EIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVD-MGEPPATGTTVVVVALEDVNDNGPFLLT--SSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-------SGLLKTARPIDREQKPEFHLPVAIAD----AGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDV--RPRDPDISDRFNCDL---TSGPFNVFSFQPNTCRLISQ---PRSAEGRFELSVRGSDGKHSPATTTARVNF 1368          
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.303 bits (399), Expect = 3.596e-39
Identity = 154/553 (27.85%), Postives = 249/553 (45.03%), Query Frame = 2
Query:  596 ISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFV---TDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI--LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDT----VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDN 2218
            ISV + N   P+F+   +E  + E +H AGS +   TATDTD A  N  I Y +A    S    + +     L L+ +LD E +  Y + + A +     +     V + V D NDNPP  N+S +  ++ EN P+ + +  + A D DS S     +Y   + E   LF + Q   V+    +LDYE  Q Y++ V      D  + + + + V +   N+  P+ +Q      V E++  G  +G V  TD+D +  +G +          + F  S  K   +   T +I   +  DRE+ +  ++ +I  +  +            +NV I D ND PP F  + Y   V+E   +GT ++ V+A+D D     +    L    +    F I++ TG+I V  P+DRE    Y L + AVD G  P   +  + + ++DVNDN P LLT          A  T+  L+  D D+  N      +   +D        ++ +G L   +P+DRE K    L V + D G +    S+  + + V+D NDN
Sbjct:  743 ISVTEENQYAPRFAHPPLELSLPE-NHPAGSSLARVTATDTD-AGVNGAIVYSIASGDGSGLFDISRASGDVL-LVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDADSPSNA-VTMYSLDDGEA-DLFVLNQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRD-AGIDGTVF--------YMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRG--FDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFLLTSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSSSGLLKTARPIDREQKPEFHLPVAIADAG-SPPLTSTVTLHLSVLDQNDN 1277          

HSP 2 Score: 157.147 bits (396), Expect = 9.637e-39
Identity = 177/680 (26.03%), Postives = 288/680 (42.35%), Query Frame = 2
Query:  569 QLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL--AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQW-NELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS--PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKN-KKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPL---------SHHYIGHYPIKVSVKDSGSPPL 2533
            +L     V + V D NDN+P+F    +   V E +   GS + L  ATD D A  NA I Y L   + H S      Q     +     LD E +  Y++++ A +        +   + + V D ND+ PRF ++ +      + PA + +F + A D D+     LRF L  +A+      FSV     VI  +  L   R     + V V+DG    RS +  +     D    P+    P      E+   G  I    V     S+  G            + + L+SG N   +   D     +    A D E      +V+   D    S     ++   + V +LD NDN P+F  S+++A V EN P  T+++ + A D D G+NG++ YS+   +  ++F+++  +G I     +DRE    Y+L + A D GS   + +V + I+V D NDNSP     F   VRE+ A    + ++   D+D G NA + FS   P+    +    G + +++ L+RE +  + ++VR  D         S +V I V DVNDN PR        E  +   P+  +++           + ++ A D DD  N ++ + +       ++ F     +G +   +PL         S   +  Y   V+  D G PPL
Sbjct:    5 RLTGTGTVTVLVEDENDNLPRFGAAELRAAVPEDA-PIGSDVALVNATDAD-AGLNAIISYRLRGGDGHFSVNPSTGQ-----IITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPRFLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSAS----AGFSVDPRRGVIHAARALQGPRDD-LTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRSFSFREDQPPGTTI---TVVAARSSRRAGP-----------VSYHLASGGNLGDVFAVDPQSGEVSVHRALDHEYQHHYELVVEARD----SGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVDYSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWT----VSTDVTIVVDDVNDNAPRFGQTAYYIEFPE---PSEGEAL-----------VARVSASDADDGANGQVFFFM----RSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPL 631          

HSP 3 Score: 141.739 bits (356), Expect = 4.215e-34
Identity = 172/704 (24.43%), Postives = 303/704 (43.04%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSN--VQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKS-SQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVREN-LAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTV--MITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKV 2503
            F++D +S  +++ + +D E               Q H EL+V    +      A +++ + VLD+NDN P+FS  R    V E +      I + TA D D    N Q++Y + + +      ++      +  ++ LD EN   Y + ++A +     Q   + V + V D NDN PRF + +FS  V+E+      + ++   D D    + + F L   +       FS+  +   I +S  L+ E    Y V V  +D  +   + + ++V+D ND +P+  Q    IE  E S    ++ +V  +D DD   NG++     +          SG+   +     R         + ++ S V+   D         L+S  T+ + I+  N N P+F + +Y   VA     GT IL ++A D D  +NG+I YS+   +    F +D+  G + ++  +  +    + + + A D G  PL+S     I+V + N  +P     P E S+ EN  A +++ ++   D+D G N  +V+S    +   +  +   +G + +   LD ET+  + L V   D G   + + SG V I V DVNDN P ++N      +    +P+             G  +  + AVD D  +N    Y +   +   + +F  N  TG L+    L +     Y + V
Sbjct:  279 FAVDPQSGEVSVHRALDHEY--------------QHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP--RTIVVLTAVDKDSG-INGQVDYSIIDGNIGNVFRVNPNSG-EIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRF-TQIFSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSLLDPS-----LPFSIHPSTGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDG-ANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMD----RGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVRAGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDA-GGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSG-VSISVTDVNDNPP-MLNASDYYPVIPENAPS-------------GTTVLVMDAVDADSPSNAVTMYSL---DDGEADLFVLNQKTGVLTTQGFLDYETKQTYELTV 934          

HSP 4 Score: 127.102 bits (318), Expect = 1.257e-29
Identity = 166/675 (24.59%), Postives = 292/675 (43.26%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR---SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPL--NSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPAT--IGQLQYE-DSDIGRNADVVFSKTWPNDDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGE--VCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNT-KLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            V I+++  N N P+F ++R    V+ A+ +AG+ I   +A D D    N QI Y +   + S +  +D     +L L   L  +  + + + + A +       +     + V + N   PRF      + + EN PA S + ++ A D D+  V    +Y  A+ +   LF + +    +L+   LDYE  + Y + V   DG ++A+   S + + V D ND  P L  +     + EN+  G  +  +   D D S +N   +   +  E  L F L    N+K      +    ++ +++ +++V       +N     H +++  ++VQI   N+  P+F Q +Y   V+E+ P+G  +  V A D D G++G + Y L  E     F ++  TG I V   +DRE +    L + A ++GSI       V +N+ + D ND        +   V E  +  T  +G   ++ DS  G        ++        I  + G + +  PLDRE+   + L V   D G      ++G   V + + DVNDN P L+                + S  ++  Q  G  +  L A D D   N    T+ +L  +      FS  S++G L   +P+       + + V++ D+GSPPL      +L + ++
Sbjct:  637 VTINIVVPNANAPRFLRERYSTPVA-ATVRAGTRILDMSAVDPDRD-VNGQIAYSVVGGNASRRFDVDAGG--FLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDA-GVNGAIVYSIASGDGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSGTTVLVMDAVDAD-SPSNAVTMYSLDDGEADL-FVL----NQKTGVLTTQGFLDYETKQTYELTV-----RAFNYPDTFHYSTA-QVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDANDPPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMG---EPPATGTTVVVVALEDVNDNGPFLL----------------TSSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSL-SSSGLLKTARPIDREQKPEFHLPVAIADAGSPPLTSTVTLHLSVLDQ 1274          

HSP 5 Score: 109.768 bits (273), Expect = 2.352e-24
Identity = 144/583 (24.70%), Postives = 225/583 (38.59%), Query Frame = 2
Query:  830 LDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKE---------HYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-----TPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSG 2521
            LD E Q HY + + A ++        L +++ V D NDN P F+SS F   V ENTP R+++  L A D DS    + D Y   +  +  +F V  N   I   S LD E    Y++ V  TD     +     ++    DE   SP+  Q  S   V E++  G  + +V   D D+              +P L FS+         T +I      +RE  S  +V +  SD  W  S ++         + + D NDN P+F Q+ Y+    E      ++ +V+A D DDG NG++ + +      F++   +G I    P+                Y   + A+D G  PL+S   + I +   N N+P  L     TP   +VR   A   I  +   D D   N  + +S    N      +   G L++   L  +      + V  RD G      S     I V + N   PR  +P                 +S+      G  + ++ A D D   N  + Y I   +   S +F  +  +G + L   L +     Y + V   D G
Sbjct:  294 LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPPRTIVV-LTAVDKDSGINGQVD-YSIIDGNIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSPRFTQIFSA-HVREDAAVGFPVLRVSTLDADEGP---NAAITFSLLDPSLPFSIHPS------TGEITVSRRLNREDRSGYAVKVRASDPAWTVSTDV--------TIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTPVAATVR---AGTRILDMSAVDPDRDVNGQIAYSVVGGNASRRFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRG-RPPLSSRATAIISVTEENQYAPRFAHP--------------PLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDG--SGLFDISRASGDVLLVGELDYETEKLYNLSVCAADGG 836          

HSP 6 Score: 80.1073 bits (196), Expect = 2.721e-15
Identity = 115/502 (22.91%), Postives = 212/502 (42.23%), Query Frame = 2
Query:  425 FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLL--AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQW--NELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXX----XSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP--RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQ----YFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNI 1888
            F ++QK+ VLT    +D E+              +   EL V  ++       +  +V + +  VN+  P+F ++     VSE S   G+ +    ATD D A  +  + Y L    +S    +++     + + + LD E +    +++ A NA   + +  +E+ V++ + D ND PP F+S+L+   V E     + +  + A+D DS    R   +   +    + FS+  +  +I+++S LD E    Y + V   D + E  +    +V    +      P L+   S  +V EN   G+ +  +   D D     G    +   ++P  R  FSLSS       +  ++T    DRE+  +  + +  +D    + +  LTS+ T+++ +LD NDNP + R  +    YF      G IG V  +    D+ D  N  +       F++F     T  +  Q    R  +  ++L +   D    P  ++  +N 
Sbjct:  907 FVLNQKTGVLTTQGFLDYET--------------KQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSE-SAPVGAPVGSVFATDRD-AGIDGTVFYMLFGESRSKGFSVNEHTG-EIIVSSQLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHVVGVSAHDFDSPPGWRTFSFLIQSGNAGRAFSINAHTGLIVVASPLDRESVPLYNLTVVAVD-MGEPPATGTTVVVVALEDVNDNGPFLLT--SSAKVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRGYFSLSS-------SGLLKTARPIDREQKPEFHLPVAIAD----AGSPPLTSTVTLHLSVLDQNDNPSEARDVRVHVNYFGSPFPGGFIGDV--RPRDPDISDRFNCDL---TSGPFNVFSFQPNTCRLISQ---PRSAEGRFELSVRGSDGKHSPATTTARVNF 1368          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 206.068 bits (523), Expect = 1.044e-53
Identity = 187/631 (29.64%), Postives = 300/631 (47.54%), Query Frame = 2
Query:  383 HGSLIYKLSGPN--CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKS-FQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            +G + Y +   N    F ID  +  +T+   +D E++       S   SG       V  W +   +A     I+V D NDN P F+       + E     GS + + TATD D    NAQ+ Y +     S F +         L +  +++ E    Y + IRA +       ++  + + V+D NDNPP FNS  +   V+EN+   + +  + A+D D  + +VLR+ +  + N+E R  F +     VI+ ++ LD+E   +Y + V  TD  Y A++ + + V + ND +P   Q      V ENS     + +V  +D+D   +              L +S+  GK+    + D     I T    DRE  S  ++ +  +D    + N  L++   + ++ILD NDN PKF  S Y + + EN    +   K+ A D D+G N +I Y+L  +   F I +++GVIT+  P+DRE K  Y L I A D G+ P  SS+ + +TV D+ND+ P +  +    SVREN    T + ++   D+D G NA++ FS    N+   + T++   G +    PLDRE +  + LR+ + D G N    S  +V I VID +DN PR 
Sbjct: 1235 NGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSG-------VPPWVSTAFVA-----ITVADENDNSPIFASNETSYGIDEGV-SIGSRVAVVTATDRDEG-SNAQVFYSIVRGDTSAFAI---NAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSII-SGNDEKR--FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGS--------------LSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTD----AGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRN-DAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFS-LLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKG-NPSLSSVADVIIDVIDEDDNCPRF 1824          

HSP 2 Score: 202.601 bits (514), Expect = 1.361e-52
Identity = 207/758 (27.31%), Postives = 339/758 (44.72%), Query Frame = 2
Query:  317 PIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNC--CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRT-----KTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEF-SVRENLAPAT-IGQLQYEDSD--------IGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            P   ++G+    +    ++    G L Y+L   N    F+ID  S  + ++  +D       RE +   S     L++      +    +  RV I++ D+NDN P F    + R VSE+S   G  I    ATD D +  N  + Y L+++   F +         + L   LD E +T Y++ + A +     + +   V + VDD NDNPP+F  SL++  V EN  A   +  + A D DS +  +      + NE    F++ +    I     LD E    Y + +   DG    + A + + + + DEND  P     PS   + E+S  G  +GQ+  TD+D    NG +            +++ SG        D R+     ++  DRE     ++V+  SD  +   +I    + +I+V +LD NDN P+F +S +   + E+  + + +L+V   D D+G NG I  SL  + S  F IDS TG +  + P+D E    Y+L + A D GS   +++  + IT+ +VNDN P  ++P +  S+ E++A  T + +L   DSD        +  NA   F          +   +G + + K LDRET   + L VR  + G  G    +    IRV+DVNDN P + NP              S + S+      G  + ++ A D D+  N K+TY + + +T     F  N  TG ++  +PL       Y ++V+  D G P
Sbjct:  488 PESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELD-------RETTPSYS-----LQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFR-VSESSSP-GHQIGQVAATDADDS-SNGDVRYALSDNTDVFSI---NTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNE-NMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFT-GPSRFNISEDSPTGTRVGQLTATDRDIGP-NGAVT-----------YAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSI----TASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDS-TGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFK---------IDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYN-NATIRVLDVNDNAP-VFNP-------------GSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDT---SKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKP 1181          

HSP 3 Score: 192.2 bits (487), Expect = 1.913e-49
Identity = 216/762 (28.35%), Postives = 324/762 (42.52%), Query Frame = 2
Query:  293 KYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNC--CFSIDQKSSVLTIAKNIDLESICINREL--SSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSH-IFLETATDTDIAPENAQIEYGLA-EHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSX---XXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKI----LTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMI-TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQL-IAVDDDD-ATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDS 2518
            ++ I E+ P    VG +      +G N    G++ Y +   N    F +D +S +L++   +D E+I     +  +SD  S Q  +                 + +SVLDVNDN P+F K      + E    A  H   L+   +      N  I   L+ E   +F +        ++     LD E    Y + + A +     +     V + + + NDN P F S      + E+    + + +L A D D T  L FD+ +         F + Q+  +I ++  LD E    Y + V  T+   +  SV     + V D ND +P          + EN   G  + +V  TD+D+ + N K+  E           LS G   K      T  + TK   DRE  +  S+ +   D    S +     + TIN    D NDN P+F QS+Y   V EN   G+ IL+V A D D G NG++ YS+   +  + F+IDSTTG ITV G VDRE    Y L I A DSG  P  S+  + ITV D NDNSP   +    + + E ++  + +  +   D D G NA V +S    +     I  +NG L + K ++RET   + L +R  D G +    S  E+ + V DVNDN P                   SQS   SV ++     + L +A DD D   N  L Y I+  N    + F  NST+G +    PL       Y ++V+  DS
Sbjct:  795 RFNISEDSPTGTRVGQLTATDRDIGPN----GAVTYAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSI--------------TASIHVSVLDVNDNAPRFEKSLFSGEIRE---DASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTI----DSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTP-LTFDIVE---GNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGE-NAKVTYE-----------LSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTIN----DLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRG-SPMMTSDKELTVVVNDVNDNPPVF----------------NSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGN--DEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS 1492          

HSP 4 Score: 186.037 bits (471), Expect = 1.654e-47
Identity = 205/750 (27.33%), Postives = 325/750 (43.33%), Query Frame = 2
Query:  323 DRMVGTIATDIEGLGINLEFHGSLIYKL-SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTS--VLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR---SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDT--VMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            D  VG+I   +  + +++  +  L Y L SG    F++D +  + T            +RE  +        + L      +        V I +LDVNDN P FS  +    V E     G+ +   TA+D D    NA + Y     + +    LD      + +   LD E ++ Y + +   +       +  ++ + V+D NDNPP F+ S +   VKENTPA +   Q+ A D DS++   L F + +  N++   +F++  +  +I I+   DYE   RY + V   D     +   + + + +ED ND SP    +    ++ E++  G  +  V  TD D                 RLE+ L SG  K     D     IR  +  DRE +   S+ +   D      +   +SS  + + + D NDN P F Q  Y   V+E+   G  I +V A D DD  NG + Y+L  +  +F I+++TG+IT++  +D E K  Y + + A D G+   +S   + + VDDVNDN P      +  +V ENLA    +  +   D+D G N  + +S    N++    M    G +    PLDRET   + L +   D  L  R  ++  V I + D NDN+P    P      +D  SP  ++             + QL A D D   N  +TY I+  N   S  F  +  +G LS+   L    I  Y + V   D+GSP
Sbjct:  180 DVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKG--------AFDRETKASY-----QVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDE-DVAIGAAMVTVTASDKDNG-NNADLRYSFTSGNTNHAFTLDAVTG-VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIK-GNDD--GVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGP------------RGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD----GGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLV-RFMAATTVNISIADENDNQPTFTGPSRFNISED--SPTGTR-------------VGQLTATDRDIGPNGAVTYAIISGNQGNS--FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSP 872          

HSP 5 Score: 182.57 bits (462), Expect = 1.899e-46
Identity = 215/830 (25.90%), Postives = 364/830 (43.86%), Query Frame = 2
Query:  194 IFQQSGKMDILKTLFLFLTA-----VRCSETGIK------ECVLKYL-----------------IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLS-GPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQ--LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL--AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTS-------VLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVI-EVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATIG-QLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            I Q SG + + K L    TA     VR +ETG +         ++ L                 + EN PI + V  +       G N +    + Y+LS G    F ++  + ++T  + +D E               Q    L V    + +    AV  + +++ D+NDN PQFS+ +    V+E +   GS+I    A+D D A  N ++ Y +    H  +F++     R   + ++  +D E    Y + I A ++      +   V + V D NDN P F S+  S  + E     S +  + A D D  S       ++R D    A N +  + +V +      + ++    R      P+  +D           +V ++ +++P +  + S I  V ENS +      V+    DDS      +         L +S+ SG ++K    +     I T T  D E+ SQ  + +  +D          T+   + +++++ ND  P F Q  Y A V EN P  T ++KV+A D D    G + YS+    D   F ID  +G+I+    +DREL   Y + +   D+G+ PL++   + I + D NDNSP    + +  S+ EN AP++   +L   D+D G NA + ++ +  ND  ++   +G + + +PLDRE K  + L ++ RD+G    + SS  + + VID+ND++P LIN   LR              S+   Q     + +++A D D   N +LT+  LL N   S +F+ ++TTG +S   PL       Y +++ V D G+P L
Sbjct: 1044 IDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAK----VTYELSVGDTSKFEVNPATGLVTTKRPLDRED--------------QASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTAN-GSNILRVLASDPD-AGANGRVTYSIISGNHGNAFRIDSTTGR---ITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSD-------KELTVVVNDVNDNPPVFNSQSYIGSVRENSAQST---SVLTVAADDSDVGANAV---------LRYSIISGNDEKRFKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-------KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSF--GSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSR-NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHG-TPPQASSITIRVTVIDINDHRP-LINSSSLRG-------------SVRENQPKETHVMRILASDADTGLNAELTFS-LLSNEHKS-VFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSL 1804          

HSP 6 Score: 172.555 bits (436), Expect = 2.217e-43
Identity = 192/662 (29.00%), Postives = 290/662 (43.81%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLN-SSVGLNITVDDVNDNSPCLLTPFEFSVR---ENLAPATIGQLQYEDSDIGRNADVVFSKTWPN-DDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            V I V D NDN P+F       ++ E +  A   + + TATD D +  NA I Y L      F +     +   +  +  LD E +  Y ++I A+   D K    + + + VDD NDN P F  S++   V E+    S++ QL A D D     R      + +     F+V   G VI      D E    Y+V +   DG   +RS    +  +  D +   P          V E+   G  +  V  +DKD    NG            L +S +SG      T D     +    + D E+ S  ++ L  +D    S  +  TS   INV   D NDNPP F  S Y + V EN P GT   +V+A D D   NG + + +   +D  +F ID +TG+I++    D E K  Y L + A D G +P+   +  + I ++DVND+SP + +P  +S +     +  +T+  +   D D G    + +     N      I  N G++ ++  LDRET   + L+V  RD   +  R SS  V I + D+NDN P    P   R               +S   SPG+ I Q+ A D DD++N  + Y  L  NT    +FS N++TG ++L   L +     Y + V+ KD G+P
Sbjct:   56 VVIDVKDENDNAPEFPLNSYVFNIRENTPAA--QVAIVTATDRD-SGTNAAITYSLFSGENKFMM---NSKTGEIRTVTPLDHETKDSYTMRISAF---DGKHTTFVPL-ITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT--SYFTVDSQG-VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKD----NGN--------NADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRG--SPPLTDTSHLLINVN--DINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDSSTNGALVFGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRG-VPVKYDTAQVTIFIEDVNDHSP-VFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDG-GSTSRSSSTRVTIALQDINDNSPIFQGPYVFR---------------VSESSSPGHQIGQVAATDADDSSNGDVRYA-LSDNT---DVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTP 663          

HSP 7 Score: 172.17 bits (435), Expect = 3.015e-43
Identity = 179/654 (27.37%), Postives = 290/654 (44.34%), Query Frame = 2
Query:  596 ISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXSPQLIQNPSVIE--VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            I+V DVNDN P F+    +  V E     GS +   TA D D+   NA++ Y L     S+   +D Q    +      D E +  Y + +RA +     +  +  V++ + D NDN P F+S+ ++  V E+    + +  + A+D D+   + LR+       N    L +V     V+ +S  LD+E+   Y + + VTD G         +L+   +      + +PS  +  V EN+  G    QV  TD+D S TNG ++           F +  G +  + T D     I    + D E  ++  + +   D G       + T+  TI ++  D ND+ P F  S Y   + E+  IG+ ++ V A DLD G  G++ Y L   +    F ID+ +G I V   +DRE    Y L + A D GS   +SS  + I + D+NDNSP    P+ F V E+ +P   IGQ+   D+D   N DV ++ +   D   + T  G + +   LD E K ++ + V  +D G    R S   V + V DVNDN P+                 +  + ++    + G  +  + A D D   N K++Y IL  N   +  F+ +  TG ++   PL    I  Y + ++  D
Sbjct:  156 ITVDDVNDNAPFFALSVYKTGVYE-DVAVGSIVRQLTAVDLDVGI-NARLSYSLVSGDTSY-FTVDSQG--VIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTG---VVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRD-SSTNGALV-----------FGIIKGNDDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVK---YDTAQVTIFIE--DVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGG-TPSRSSLTVVKVMVDDVNDNPPQFAK--------------SLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGN--ENMAFAMDRFTGEITTRVPLDRETIASYSLTINADD 764          

HSP 8 Score: 166.392 bits (420), Expect = 1.958e-41
Identity = 168/603 (27.86%), Postives = 267/603 (44.28%), Query Frame = 2
Query:  749 YGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRF--NSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGT---LYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            Y + + +      +D             D E+++ Y + + A +A +        V + V D NDN P F  NS +F+  ++ENTPA + +  + A D DS   + + + L+   N    K     + G +  ++  LD+E    Y + +   DG +    V  + V+D ND +P    +     V E+   G ++ Q+   D D                 RL +SL SG +    T D    IRTK AFDRE  +   V L   DG + S     +   T+ ++ILD NDN P F  +QY A V E+  IG  ++ V A D D+G N  + YS     +   F +D+ TGV+TV   +D E +  Y L +   D GS PL  +  L I V+D+NDN P    + ++  V+EN    T  Q+   D D   N  +VF     NDD V  T++G+   + I K  D E K R+ L V+ RD G+   +  + +V I + DVND+ P        ++I ++T                G  +  + A D D     +L Y ++  N      F+ ++ +G + +   L       Y ++V  +D
Sbjct:    1 YSIMDGNDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFN--IRENTPA-AQVAIVTATDRDSGTNAAITYSLFSGEN----KFMMNSKTGEIRTVTP-LDHETKDSYTMRISAFDGKHTTF-VPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVG------------INARLSYSLVSG-DTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPS----RSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT--QVSATDRDSSTNGALVFGIIKGNDDGVF-TIDGSTGIISIAKSPDYENKTRYDLTVQARDRGV-PVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPEST--------------VIGSTVVTVTATDLDSGPRGRLEYRLISGNV--KGAFNIDANSGSIRVSSELDRETTPSYSLQVEARD 557          

HSP 9 Score: 162.925 bits (411), Expect = 2.423e-40
Identity = 191/753 (25.37%), Postives = 329/753 (43.69%), Query Frame = 2
Query:  383 HGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQ------QRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNS-SLFSVLVKENTPARSMIFQLIANDPD---STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXX---XXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEF--SVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            +G + Y LS     FSI+  + ++T+   +D E               Q  + +           ++  V++ V DVNDN PQF+K      V E +  AG  +   TATD D +  N +I Y +   +++    +D+       R P       LD E    Y + I A +    +      V++ + D NDN P F   S F++   E++P  + + QL A D D   + +V     Y   +      F +     ++ + S LD E    Y + V  +D     +S+       V D ND +P+  ++    E+ E++     + QV V DKD+  +NG            +  SLS G+     T D    + +KT  D E ++   + +   DG + S     +++  + + I++ NDN P F        + E+  I T ++K+NA D  DG          +  S F+ID ++G+I+V   +DRE   +Y L + A ++GS   +      I V DVNDN+P +  P  +  S+ ENL    T+ ++   D D G NA V +  +    DT    VN   G +   +PLDRE +  + LRV   D+G    + +   + + + D+NDN P+    +               +++++   + G  I +++A D D   N ++TY I+  N      F  +STTG +++   +    +  Y + +S KDSG PP +      + + ++
Sbjct:  614 NGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKT------------QYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGE-NLAAGVAVCYVTATDAD-SGANGKISYSILSGNENMAFAMDRFTGEITTRVP-------LDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNI--SEDSPTGTRVGQLTATDRDIGPNGAVT----YAIISGNQGNSFQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEG-SNGA-----------ITLSLS-GEGSDNFTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSK----SATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATD-SDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAP-VFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSV--GDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHG-KPSQSAVAAITLTINDLNDNSPQFSQSK--------------YTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNH--GNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADE 1301          

HSP 10 Score: 155.606 bits (392), Expect = 3.952e-38
Identity = 146/493 (29.61%), Postives = 229/493 (46.45%), Query Frame = 2
Query: 1121 GTVILISSWLDYERHQRYKVPVFVTDGL---YEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKD-DSQTNGKMICEHETTEPRLEFSLSSGKNKKIL---TYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLA-PATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMI--TVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            G++       D E   RY++ V   D     ++ R+V+ + V+DEND +P+   N  V  + EN+    V    IVT  D DS TN             + +SL SG+NK ++   T +IRT T  D E     ++ +   DG +T+        F   + + D NDN P F  S Y   V E+  +G+++ ++ A DLD G+N ++ YSL   D S F +DS  GVI  +G  DRE K  Y++ + A D GS   +    + I + DVNDN P   +  +  SV E++A  A +  +   D D G NAD+ +S T  N +       V G + +++ LD E +  + L + + D G      +S  + I V D+NDN P + +P   +      +PA                 TQ+ A D D +TN  L + I+  N     +F+ + +TG +S+ K   +     Y + V  +D G P   D     +FI
Sbjct:   19 GSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQV---AIVTATDRDSGTNAA-----------ITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTT--------FVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQ-GVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTS-HLLINVNDINDNPP-VFSPSAYQSRVKENTPAG----------------TQVSATDRDSSTNGALVFGIIKGN--DDGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFI 468          

HSP 11 Score: 97.4413 bits (241), Expect = 2.649e-20
Identity = 123/475 (25.89%), Postives = 212/475 (44.63%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPN-CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLY--EARSXXXXXXXXXXXXSPQLIQNPSVI-EVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLD 1699
            ++EN      V T+A D   +G N     S+I   SG +   F I+  S V+     +D E               Q  LE+     ++ +  A   V I V+++ND  P F++Q     V E S  + S + + +A+D D       + Y +     S +  +DQ R   +   + LD E  + Y I++R  +A +    N   V + + D NDN P+F+SS +S  + EN+   S  F+L A D D  +  R   Y  + N+    F +  +  VI ++  LD E    Y + +   D     +A S+   +   + ++   LI + S+   V EN  K   + +++ +D D                  L FSL S ++K + T D     I TK   DRE+ +  ++ +  +D  N S    L+S   + + ++D +DN P+F+ ++Y   ++E+ P G  I++V A D+D
Sbjct: 1421 VRENSAQSTSVLTVAADDSDVGANAVLRYSII---SGNDEKRFKINSTSGVIMTTTPLDFEE------------KSQYGLEVTA---TDSKYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKV-SASDRD---SFGSLSYSIVGGKDSDKFSIDQ-RSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARI-TYNLSRNDA---FMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTG------------LNAELTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPS----LSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          

HSP 12 Score: 91.2781 bits (225), Expect = 2.084e-18
Identity = 77/273 (28.21%), Postives = 121/273 (44.32%), Query Frame = 2
Query: 1736 HDFSLFQIDSTTGVITVQG-PVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSP-------GYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            +D  +F IDS+TG IT  G   DRE +  Y+L + A D+ +        + I V D NDN+P   L  + F++REN   A +  +   D D G NA + +S     +  +M +  G +    PLD ETKD + +R+   D      + ++    I V DVNDN P                       ++SVY++        G ++ QL AVD D   N +L+Y ++  +T     F+ +S  G +             Y + +  +D GSP
Sbjct:    7 NDQGMFTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG-----KHTTFVPLITVDDVNDNAPFF---------------------ALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDT---SYFTVDS-QGVIRTKGAFDRETKASYQVALRAQDGGSP 249          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 202.216 bits (513), Expect = 2.053e-52
Identity = 205/722 (28.39%), Postives = 314/722 (43.49%), Query Frame = 2
Query:  422 CFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQR-YKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENL--APATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFIT 2566
             FS+D  S ++T+AK +D E+   N  L+     G G   +   +           V I+VLDVND  P FSK      + E S +A S I    A   D    NA++ Y +++ +    + ++      L+L +++D E      + ++A +      +   NV + V D NDN P+FNSS   V + E+TP     + +   D DS  + R      +N     LF++  N   + ++  +DY    R Y +PV   DG    RS   +L     D    SP          V+E +     I +V+ TD D  + NG++    ++     +F L +G         I  K+  DRE   + ++ +I  D          +SS  + V + D NDN P F+Q+ Y   V EN P+ T +  V+A D D+G NG + Y  +   + F +D  TG IT    +DRE K  Y   I A D GS P      + + V DVND SP      +  +V E+L    + +  +  +D   G N+D+ +          +  V G L +  PLDRE   RH L V   D G N   ++   + I V+DVNDN P  IN    + +         + + I      G V+  ++AVD D   N K+ Y I+  NT     F  N TTG +S  + L       Y ++VS  D G      +K  Y  +T
Sbjct:  646 VFSVD-GSGLITLAKLLDRET-QDNYLLTVKAVDGGGQDSVNKAI-----------VNITVLDVNDEPPIFSKAEYNFTIQEHS-QALSVIGHVHAISRDKG-TNAEVVYSISKGNTDNIVLINSTGT--LYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPG--TLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGE-NGRISYAFDSKVDTSKFGLRNGGK-------IFIKSKLDREDIEEYNLKVIAID----HGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTV--------PEKLPI------GSVVAAVLAVDSDQGDNGKVRYKIVNGNT--DGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKK---QQKTSYQLVT 1317          

HSP 2 Score: 174.096 bits (440), Expect = 9.832e-44
Identity = 209/764 (27.36%), Postives = 334/764 (43.72%), Query Frame = 2
Query:  275 IKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELN-VDLYVDDFNDNPPRF-NSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL-EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP--FEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS-KTWPNDDTVMITVNGTLYITKP-LDRETKDRHCLRVRLRDNGLN-GRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
             ++    + ++ENEP+   +G ++      G N    G + Y+       F +D+++  +T ++ +D E+      + S  ++  G    +       Q+  +VR      DVND  P+FSK +    V+E     GS +    ATD D    N+ I Y +    K+F L    Q    L L++ LD E    +++ + A +   N+    +  +++ V D NDN P F N + F   V E  P  S++  ++A D D     +   Y+  N      F + +   VI     LD+E   RY + V  TD G  + ++  +++     D +   P   +NP +  + EN      +  +   D DDS  N ++    ++  PR  F ++S       T  I+T    DRE+ S+ S+ +  +D   T  +  L ++ T+ + I D NDN PKF  S+   +V E+ P    +  + A D D G  G + Y +   D   F +D  TGV+ + G +D E    Y LHI A D GS PL +S  L   V    +++P   T   F  +V EN    T + ++   D D G NA++ +S  +    D   I  +  L +T   LDRE KD + L V     G++   R SS  V I V+D NDN P+ I+P    ++ +                SP  +I  L   D D   NTK+ Y I+  NT     F+   +TG LS    L       Y + V  KD   P
Sbjct: 1016 FQQASYAFFVKENEPVATYLGAVSASDSDEGSN----GHVTYRFDTQVAQFIVDKQTGKITTSQVLDREAKA--SYVFSIVATDGGSSPRV----DKTQVTVIVR------DVNDCSPKFSKNKYSVTVNE-DLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL---NQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKT-VPEKLPIGSVVAAVLAVDSDQGDNGKV-RYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHD-DDSGLNSRIWYTIDSQSPRAHFKINSE------TGLIQTTHPIDREEISEYSLKVRATDQAFTEQD-RLYNTATLKIIIQDLNDNAPKF-VSRNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPL-TSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHA--TGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPE---------------NSPARLIYTLTVQDLDYGNNTKVLYSIMSGNT--DGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPP 1728          

HSP 3 Score: 161.77 bits (408), Expect = 5.958e-40
Identity = 185/680 (27.21%), Postives = 284/680 (41.76%), Query Frame = 2
Query:  539 ELIVNLWSNVQ--------LLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTH-YLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLD-DGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVD-SGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP--ATIGQLQYEDSDIGRNADVVFSKTWPN-DDTVMIT-VNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL-INPRGLREIDDATSPAASQSISISVYQSP--GYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKD 2515
            E I +L+  VQ        L     V I+V+D+NDN PQF+   I   + E +   G   +  +  D D +    ++ + L  +  +    LD      L L   +D  N    Y + ++A +     + +   ++L V D ND  P F +  ++  V E TP  S I +++A D DS    R      +  +  K    L+NG  I I S LD E  + Y + V   D     RS    +    +D    +P   Q      V EN      +G V  +D D+  +NG +    +T   +      +GK        I T    DRE  +     ++ +DG  +S  +  T    + V + D ND  PKF +++Y   V E+ P+G+ +L + A D D  G N  I Y +      F ++  TGV+T+  P+DRE+   + LH+ A D  G+  L +   + I V DVNDN P  +    F       P  + +  +   DSD G N  V +     N D T  I    G +   + LD E  +R+ LRV   D G   ++ S   V I V D NDN+P    NP                 I   +Y++      +T + A DDD   N+++ Y I   +  P   F  NS TG +    P+    I  Y +KV   D
Sbjct:  768 EKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSPQFNSSSILVRLPEDT-PIGHTFYTVSVFDAD-SGVLGRVSFSLLSNPGTL-FNLDSNTGA-LSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFG--LRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEG-SNGHVTYRFDTQVAQFIVDKQTGK--------ITTSQVLDREAKASYVFSIVATDG-GSSPRVDKTQ---VTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNP-----------------IITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTI--DSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATD 1409          

HSP 4 Score: 158.688 bits (400), Expect = 5.434e-39
Identity = 186/670 (27.76%), Postives = 294/670 (43.88%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN-DLDAENQTHYLIKIRAWNAQDNKQWNELN-VDLYVDDFNDNPPRFNSSLF---SVLVKENTPARSMIFQLIANDPDSTSVLRFDL-YQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR-----LEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVR--ENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVM-ITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVC-IRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLI 2536
            +R+ I+V D NDN P+FS       + E +   G+ I   +A+D DI   NA+I+Y + E H   Q          + + N  LD E +  YLI ++A +   + Q +    V + V D NDN P  + S     S  V EN    + + ++  +D DS      ++  +  +      F VL + ++I +   LD E H  + +     D     R+  +    +  D    +P+  ++     V EN+    ++  V   D+D    +  +     TTE R          SSG         I T T  DRE+  Q+ + ++  D      +  L+ + ++ V + D NDN P F QS Y A + EN P G+ ++++ A D D G N  I YS+    + F +D   G++T    +D E++  Y   + A D G    N++V +++T  D+NDN P +  P  +SV   EN     +I QL+  D D  + A   F     N D V  +  +G + + K LDRET+D + L V+  D G  G+   +  +  I V+DVND  P                  A  + +I  +     VI  + A+  D  TN ++ Y I   NT    I   NS TG L L   + H  I    + V  KD G+PPL 
Sbjct:  156 LRLSITVEDTNDNKPEFSNVSYSGTIPE-NIDVGTSILQVSASDKDIG-TNAEIQYSI-ETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGM--------ITTATDLDREQIPQVVLTVLVHD----RGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSCNATVHVSLT--DLNDNQP-VFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGG--GQDSVNKAIVNITVLDVNDEPPIF--------------SKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNT--DNIVLINS-TGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLF 788          

HSP 5 Score: 157.532 bits (397), Expect = 1.349e-38
Identity = 204/779 (26.19%), Postives = 330/779 (42.36%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLES-----ICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKA--GSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN-DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNE-LRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARS---XXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRE-NLAPATIGQLQYEDSDIGRNADVVFSKTWPN-DDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNG---LNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSH-HYIGHYPIKVSVKDSGSPPLIDEKMFYLFITN 2569
            I EN  +   +  ++   + +G N E   S I   S P   F I   + V+     +D E+     I +  E       G  H           QL +   VRI VLDVNDN P            + +  A  G+ +   + +D D + +N ++   L      F +  D      +  +   LD E   H+ +K    +  D  +  E +  + V D ND  P+F+   +   V EN    +++  + A D D  S S L + +  T  +      F++  +  +I  ++ LD E+  +  + V V D      S    + V + D ND  P   Q+     + ENS  G  + Q++  D D  + +   +  +    P   F L     +K L  + RT    D E  S  +  +  +DG   S N       T++V + D NDN P F  S Y     EN  IG  I ++ A D D        + +E   +  +F +D  +G+IT+   +DRE +++Y L + AVD G     +   +NITV DVND  P      + F+++E + A + IG +     D G NA+VV+S +  N D+ V+I   GTLY+   +D E      L V+ +D G   L G       V I VID+NDN P+  +   L  + + T P      ++SV+             D D     ++++ +L   + P  +F+ +S TG LSL K + + +    Y + V  +D GSPP     M  L + +
Sbjct:  181 IPENIDVGTSILQVSASDKDIGTNAEIQYS-IETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAE-----DKGSSH-----------QLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDAD-SGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENS---LILYSILTPNTPFFLDP---RKGLVTNSRT---LDHEVQSSYTFQVAATDGGGRSCNA------TVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSISKGNTDNIVLINSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGY----ANVTIAVIDINDNSPQFNSSSILVRLPEDT-PIGHTFYTVSVF-------------DADSGVLGRVSFSLL---SNPGTLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVD 904          

HSP 6 Score: 156.377 bits (394), Expect = 2.404e-38
Identity = 198/720 (27.50%), Postives = 310/720 (43.06%), Query Frame = 2
Query:  293 KYLIQENEPIDRMVGT-----IATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELN-VDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR------SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP---RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL--FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLN-SSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMIT--VNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHI 2389
            KY +  NE  D  VG+     IATD +  G N +    ++   +GP   FS++Q + VLT+   +D E    +R +    +S +G          N  L  +  + I+VLDVNDN P F  +   + V E     GS +    A D+D   +N ++ Y +   +      +++     +  L  LD E    Y++++ A +    +Q      V +YV+D NDN P F+ +     + EN P  + +  + A+D DS    R   Y   +   R  F +     +I  +  +D E    Y + V  TD  +  +      + L+++++D ND +P+ +   ++  VME+      +  +   D D  Q       E+    P   +    L +G  K I         + D E   Q ++ +  +D      +  LTS    NV ++D NDNPP+F +  +   V+EN P GT ++KV AYD D G N ++ YS+     +  F ID  +G+I     +DRE K+ Y L +HA    S P   SS  + I V D NDN P  ++P     V EN     I  L  +D D G N  V++S    N D         G L  T  LDRETK  + L V+ +D        +   + I + D NDN P                  +  S +IS    PG  I  L A D D  +N  + Y +
Sbjct: 1123 KYSVTVNE--DLPVGSSLLTLIATDDDQQGPNSDITYMIV---AGPKA-FSLNQVTGVLTLVSPLDRE--VTHRHILHVVASDKG---------GNQSLETITYIEINVLDVNDNYPVFINETTFKTVPE-KLPIGSVVAAVLAVDSDQG-DNGKVRYKIVNGNTDGTFKINETTG-VISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRI-WYTIDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSR-NLTYVMEDEPFNFQVTSITALDPDTGQGGN---VEYRIVSPDTGKFSLDLKTGVLKLI--------GSLDYEDVPQYTLHISATD----LGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGV-SYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDI-TPPYYTAFANITIFIEDQNDNPPVF--------------QQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTL 1789          

HSP 7 Score: 131.339 bits (329), Expect = 1.153e-30
Identity = 168/673 (24.96%), Postives = 277/673 (41.16%), Query Frame = 2
Query:  590 VRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDL---------DAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVI----------EVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD------FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSP--GYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSG 2521
            V + V D+NDN P F +    + V   + K      +  A D+D    + Q  Y +   +      L  +R     L  DL         D E    Y++ I A +  +      L + + V+D NDN P F++  +S  + EN    + I Q+ A+D D  +          +++ + +F +     VI+ +  LDYE  + Y + V   D   +  S           E   +  N  VI          +V EN+  G  + +V V+D  DS  NG++    E  +           ++ I    I    + DRE      +  +C D  +         SF INV   D ND  PKF +  Y   V EN  + T++  VNA D D G N ++ Y++ +          F ID ++G+IT    +DRE      L +   D GS PL+ +  + + + D NDN P    + +  S+ EN    + + QL  +D DIG N+ +++S   PN    +    G +  ++ LD E +  +  +V   D    G R  +  V + + D+NDN+P + +P                S S+  +++   G  I QL A+D D        + I   N    ++FS +  +G ++L K L      +Y + V   D G
Sbjct:   44 VLVYVQDLNDNSPSFVRGTSAKLVVFENDKDFRQKLI--AVDSDFGSNSTQ-SYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAED---KGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDA-DSGKNGEVNVTLEGGDGYFSMKFDVLNDESI----IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTE--KSFRINVG--DVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATD---GGGRSCNATVHVSLTDLNDNQP-VFDP---------------SSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNA--DEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGG 679          

HSP 8 Score: 124.02 bits (310), Expect = 2.197e-28
Identity = 176/727 (24.21%), Postives = 300/727 (41.27%), Query Frame = 2
Query:  509 SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLL-----NDLDAENQTHYLIKIRAWNAQDNKQWNELN----VDLYVDDFNDNPPRFNSSLFSVLVKENTPA--RSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSX--XXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDI-----------RTKTAFDREKSSQISVVLICSDG---WNTSANIHLTSSFT-INVQILDFNDNP--------------PKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLN-GKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATI-GQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP--RLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVK--DSGSPPL 2533
            S+   G+  L +I     +  L     V+I + ++ D+ P+F  Q   R     + K GS+I    A     A  +AQ+ Y +   +K     +D    P+  ++     + LD E+  ++ + + A      + W  LN    +D+ V D NDN P F+ S     + E+T A     + ++ A D DS +  +        NE   +F++      I  +  LD E    + + +  TD     +S      +V  + +++P L    S + + E++  G V+  V+ TD D               E RL ++L S     I    +           + K +F    S QI   +    G      + ++ +  SF  I VQ +D    P              PKF    YF  V EN  +GT +L V   D   GL  G+I Y++E+  + F+I   +GVI+V  P+D E K  + L + A+D  +      V + I V DVND  P    + +     E +   TI   +   D D G N  V F+     DD     ++   G +   + LD ET   H + VR  D G +    +   V IRV+D+NDN P  R+  P  ++ +++   P  S+             + ++ A D D   N +L++ ++        +F  +  +G+L+ +    +     Y   +++K  D+G+PPL
Sbjct: 1921 SNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR----ASSDAQVTYSIISGNKGRAFYVD----PFTGVISVASADALDYESTKNFRLHLVATP----QGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEA-GVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTD--------------KESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS-NYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFA-IQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEG-SPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENL--PLNSR-------------LYEINATDRDSGANARLSFTVI--GGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPL 2600          

HSP 9 Score: 115.931 bits (289), Expect = 6.365e-26
Identity = 184/778 (23.65%), Postives = 317/778 (40.75%), Query Frame = 2
Query:  383 HGSLIYKLSGPN-CCFSIDQKSSVLTIAKNIDLESICINRELSSDC-SSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDI-APENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRF-NSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISS--WLDYERHQRYKVPVFVTDGLYEARSXXX---XXXXXXXXXSPQLIQNPSVIEVMENSG--KGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF---------------------------RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHY-KLHIHAVDSGSIPLNSSVGLNITV------------DDVNDNSPCLLTPFEFSVRENLAPATIGQLQY--EDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            +G+++Y LS      +SID ++ ++  A   +     I +E +  C +  QG              +A+V VRI + D N++ PQF+K   E H+   +  A + + + TATD D     N ++ Y L +   S  L + +     +          Q  + + I A +           V + + +  D+PPRF N +   V + EN+   S I  + A       V     Y   +    + F V     VI ++S   LDYE  + +++ +  T   + + +      + V D ND SP    +  + ++ E++G  K   + +V  TD  DS TNGK           + +S+ +G    + T D     I T    DRE ++   +V+  +D    S     +++  + V + D NDNPP F                           ++S+   ++      G  IL+V+A D D G N +I YS      D   ++ID+ TGVI+ +  +D  +++ + ++ + A+D G  P  + V + I +              V +N+    +     V +N A   +G++ Y  E+S+  R                +   +G + + KPLD ETK R  L V   D+    +      V I V DVND KP          +   +   A  S  I V    G ++  + A D D   N ++ + I   +   S  F+ +  TG +   + L H  I  + + V   D GSPP+
Sbjct: 1782 NGNIVYTLSNDTYGVYSIDSRTGIVYSAARFE---TSIKQEYNFFCIAKDQGQDPK----------MAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNT-SASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQV----TYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDV-DSGTNGK-----------VTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTD----SGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFR----------------IGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRV-PVYINVSDVNDEKP----------VFGQSGYMAQWSEGIPV----GTIVVNVSAADKDSGANGRVWFAIQSGDDKGS--FAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPM 2492          

HSP 10 Score: 110.923 bits (276), Expect = 2.436e-24
Identity = 141/595 (23.70%), Postives = 247/595 (41.51%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS----TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEARSXXXXXXXXXXXXS--PQLI-QNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-------IRTKTAFDREKSSQISVVLICS-DGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAEN-GPIGT-VILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRE------------------------NLAPAT-----IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHC-LRVRLRDNGLNGRRQSSGEVCIRVI 2203
            A   + I + D NDN P F +      +SE +   G+ I   TA+D D +  N  I Y L+  + ++ +     R   ++     +   +  Y     A +   + +   + V + ++D N++ P+F  + + V +  NT A +++  + A D D+       + + L  + N+    LF V  N   +  S+        R+ + +   D G    R    V +   N +   P+ + Q P+ + + ENS  G  I  V      D+Q               + +S+ SG   +    D       + +  A D E +    + L+ +  GW     + L     +++ ++D NDN P F  S   A +AE+ G      ++KV A D+D G NGK+ YS+   ++  +F IDSTTG IT    +DRE    + L I   DSG  P +++  + + V D+NDN P      E ++RE                        NL  A+     I ++   D D G NA + +S    N D +   ++   G +   + +D   +D    + V+  D G+  +R     V +R+I
Sbjct: 1732 AFANITIFIEDQNDNPPVFQQSLYSSTISELT-PPGTSILNLTASDKD-SGSNGNIVYTLS--NDTYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNST--SLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQ---------------VTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGW-----VSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQR---ALVYVRII 2297          

HSP 11 Score: 83.5741 bits (205), Expect = 4.881e-16
Identity = 104/385 (27.01%), Postives = 163/385 (42.34%), Query Frame = 2
Query: 1457 IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF-RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD-----FSLFQIDSTTG------VITVQG-PVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYL 2557
            I TKT  DREK S  ++ ++    ++T        S+T+ V + D NDN P F R +     V EN        K+ A D D G N    Y++        F L     T G      V+      VDRE  + Y L+I A D G+   +  + L+ITV+D NDN P      +  ++ EN+   T I Q+   D DIG NA++ +S    +D   +  ++   G +     LD E K  + + V+  D G + +  SS  V I V+DVNDN P +             S     S  ++   + G  + ++   D D   N ++   +   +   S  F   +    +++ + L      H+ +K    D G PP   EK F +
Sbjct:   14 ITTKTVLDREKVSAYNLTIVE---FSTPPK-----SYTVLVYVQDLNDNSPSFVRGTSAKLVVFENDK--DFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVI-----------HVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRI 377          

HSP 12 Score: 68.5514 bits (166), Expect = 1.649e-11
Identity = 87/378 (23.02%), Postives = 164/378 (43.39%), Query Frame = 2
Query:  683 GSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD----GLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSS--QISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-LFQIDSTTGVI 1780
            G+ +     TD        +I Y + E+   F++    QR   + +   LD E +  +L+ + A +     +   + V + V D ND  P F  S +     E  P  +++  + A D DS +  R   +   + + +  F++ +   VI     LD+E  + + V V  TD     ++   SV   +++  ++     +  P+ ++V+EN      + ++  TD+D S  N            RL F++  G  + +   D     + T   FD E ++  Q S+ +  +D    + N  L+S+ TI V + D ++  P F +  Y   V  N  IG  + +V A D D G  G++ +   +  S   ++++TTG+I
Sbjct: 2320 GTSVLTVRVTDNAAGLPLGRISYNI-ENSNYFRIG---QRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRV-WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRD-SGANA-----------RLSFTVIGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATD----AGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNALKMNATTGII 2676          

HSP 13 Score: 55.0694 bits (131), Expect = 2.341e-7
Identity = 79/265 (29.81%), Postives = 107/265 (40.38%), Query Frame = 2
Query: 1772 GVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL--TPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITV-----NGTLYI-------TKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGS 2524
            GVIT +  +DRE    Y L I      S P  S   L + V D+NDNSP  +  T  +  V EN       +L   DSD G N+   ++    N   V   +     +G LY        +  +DRE  D + L +   D G N        + I V D NDNKP   N               S S +I      G  I Q+ A D D  TN ++ Y I   ++ P  IF  + TTG +  +  L +     Y I V  +D GS
Sbjct:   12 GVITTKTVLDREKVSAYNLTIVEF---STPPKSYTVL-VYVQDLNDNSPSFVRGTSAKLVVFENDKDFR-QKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGG-NPANHGFLRLSITVEDTNDNKPEFSN--------------VSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIET-HSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGS 255          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO33359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSF2])

HSP 1 Score: 187.193 bits (474), Expect = 8.397e-49
Identity = 205/760 (26.97%), Postives = 327/760 (43.03%), Query Frame = 2
Query:  302 IQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPN--CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL--AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDD---GLNGKIHYSLEHDF--SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYIT--KPLDRETKDRHCLRVRLRDNG---LNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            + EN P+    GTI   ++ +  +   +  LIY +   N    F+ID  +  +   K  D E         S   +G       V   S++    VV   I V+D NDN P+F+++R    V E +   G+ +   TA D D  P NA ++Y +       +F +  D         L+    EN T  LI +        +    + V++ V   N++ PRF +  ++  + EN P  + I ++ A + D +   RF +Y   +    K+F V Q G + L +  LDYE  +RY+                                     E+ EN   G  +  +   D+D+   NG++     T+  +  F+ +S      LT ++      DRE   Q +++++  DG +       T+S  + V++LD NDNPP F    Y   ++E   IGT IL+V+A D DD   G+N +I Y L+       F I+ TTG IT++  VD E +  Y   + A D G   L  S  + IT+ DVNDN P  L T +   + EN+A  T + Q+   D D   N  V+FS    N D   +    T  +T  K LD E    + L ++  D G   LN  +   G + + V+++NDN P          ID+ T              + G+VI ++ A D D + N K+ + IL  N+     F  +  TG ++ +K L +  +  Y + +   D G PPL
Sbjct:  118 VSENTPL----GTIVARVKAVDKDSTSNADLIYSIQNGNNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTG-------VPALSSLNFANVV---IIVVDENDNPPEFAQKRYTATVYE-NFTVGTVVLRVTAHDKDSGP-NAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLI-VTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARF-IYVIKDAASSKVFLVNQTGDITL-ARELDYETRRRYE------------------------------------FEMYENVTSGTQVLTLFAHDRDEG-INGQVFYYIVTSSVKGVFTTNSTTGVVSLTAEL------DRESVYQYNMLVVAQDGGSPPR----TASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQ--PGMLHVSVVNINDNSPVFSQKMYSASIDENT--------------TVGHVILRVTASDLDSSLNGKVLFSILEGNS--DGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPL 793          

HSP 2 Score: 134.035 bits (336), Expect = 5.903e-32
Identity = 120/390 (30.77%), Postives = 184/390 (47.18%), Query Frame = 2
Query:  818 LLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELR---------KLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR----SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVG--LNITVDDVNDNSPC 1921
            L  +LD E+   Y + + A +     +    +V + V D NDNPP F +  +++ + E T   + I ++ AND D       D  +  N E+R         K FS+      I I   +DYE    Y   VF +DG  EAR    S + + + D ND  P  +     ++++EN   G  + QV  +D  DS  NGK++           FS+  G +      D     + T  + D E  ++ ++V+  +D  +   N   +    ++V +++ NDN P F Q  Y A + EN  +G VIL+V A DLD  LNGK+ +S+    S   F +D  TGV+T    +D E    Y L I A D G  PLNSS    L+++V ++NDNSP 
Sbjct:  447 LTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATSIGTRILRVSANDRD-------DKDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDG-GEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDL-DSSLNGKVL-----------FSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLN--SSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPV 814          

HSP 3 Score: 133.265 bits (334), Expect = 1.203e-31
Identity = 152/610 (24.92%), Postives = 256/610 (41.97%), Query Frame = 2
Query:  950 PRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGT-VILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSP-QLIQNPSVIE--VMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSD-GWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNS--SVGLNITVDDVNDNSPCLLTPF-EFSVRENLAPAT-IGQLQYEDSDIGRNADVVFS-KTWPNDDTVMITVNGTLYITKPLDRETKDRH---------------CLRVRLRDNGLNGR--------------------------------------------------RQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
            P FN +L+S ++ E+      +  ++A D D+    R   Y   +      + V+ N T V+  S   DYE  + Y   V   D     RS +  +     D +  + I  P   E  V EN+  G ++ +V   DKD S +N  +I           +S+ +G N    T D     I T+  FD EK+ + ++ +  SD G    ++++  +   I   ++D NDNPP+F Q +Y A V EN  +GTV+L+V A+D D G N  + YS+    +   F I + +G I++  P+D+E  E+Y L +   D G  PL S   + +N+ V  VN+++P  L  F   S+ ENL   T I +++  + D+   A  ++  K   +    ++   G + + + LD ET+ R+                L    RD G+NG+                                                  R +S  V + V+D NDN P         ++ +ATS   ++ + +S               D D+  N ++ Y   L + + S+ FS N TTG +++ + + +     Y  +V   D G   L
Sbjct:    1 PIFNQTLYSAIIPEDFTVGGTLLTVLARDQDAALNARV-TYSIVSFSTESDYFVIDNITGVVRSSKEFDYETQRMYSFSVRAEDRGSPIRSAIATIHVQITDTNDNRPIFQPMEYETRVSENTPLGTIVARVKAVDKD-STSNADLI-----------YSIQNGNNNGSFTIDNSTGEIMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVII---VVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDDAFVIIADSGDISLDKPLDKETIENYTLVLIVTDMGIPPLESIKRMVVNVIVSGVNEHAPRFLNEFYNASIPENLPLGTSIVRVRAVEDDVSVGARFIYVIKDAASSKVFLVNQTGDITLARELDYETRRRYEFEMYENVTSGTQVLTLFAHDRDEGINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEATS-IGTRILRVSANDRD----------DKDEGVNAEIRY--FLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEARL 581          

HSP 4 Score: 121.324 bits (303), Expect = 7.004e-28
Identity = 125/435 (28.74%), Postives = 192/435 (44.14%), Query Frame = 2
Query:  989 ENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSV-------IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKIL-----TYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVG--LNITVDDVNDNSPCLLTP-FEFSVRENLAPA-TIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYIT--KPLDRETKDRHCLRVRLRDNG---LNGRRQSSGEVCIRVIDVNDNKP 2224
            EN  + + +  L A+D D   +     Y    + ++ +F+      V+ +++ LD E   +Y + V   DG    R+    +  +  D +     NP V       +++ E +  G  I +V   D+DD         + E     + + L      K       T  I  K A D E+ S  S  +  SDG        LT S ++ + I+D NDN P F  ++Y+  + EN  IGT + +V A DLD  LNGK+ +S+    S   F ID  TGV+T    +D E    Y L I A D G  PLNSS    L+++V ++NDNSP      +  S+ EN      I ++   D D   N  V+FS    N D   +    T  +T  K LD E    + L ++  D G   LN  +   G + + V+++NDN P
Sbjct:  399 ENVTSGTQVLTLFAHDRDE-GINGQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVYQYNMLVVAQDGGSPPRTASAHVKVEVLDCN----DNPPVFTTLYYTLQLSEATSIGTRILRVSANDRDD---------KDEGVNAEIRYFLKDAIVSKKFSINDTTGQITIKQAVDYEERSSYSFEVFASDGGEA----RLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKVLFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDLDSSLNGKVLFSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQ--PGMLHVSVVNINDNSP 813          

HSP 5 Score: 69.3218 bits (168), Expect = 7.042e-12
Identity = 104/429 (24.24%), Postives = 186/429 (43.36%), Query Frame = 2
Query:  365 GINLEFHGSLIYKL--SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPE--NAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD----GLYEAR-SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPP 1609
            GIN    G + Y +  S     F+ +  + V+++   +D ES+             Q ++ ++     +    A   V++ VLD NDN P F+       +SEA+   G+ I   +A D D   E  NA+I Y L +   S +  ++      + +   +D E ++ Y  ++ A +  + +     +V + + D NDN P F  + + V + EN    + + Q+ A+D DS+   +  L+          F + QN  V+  +  LDYE    Y + +  TD     L  ++  +L V V + ND SP   Q      + EN+  G VI +V  +D  DS  NGK++           FS+  G +      D     + T  + D E  ++ ++V+  +D  +   N   +    ++V +++ NDN P
Sbjct:  418 GIN----GQVFYYIVTSSVKGVFTTNSTTGVVSLTAELDRESVY------------QYNMLVVAQDGGSPPRTASAHVKVEVLDCNDNPPVFTTLYYTLQLSEAT-SIGTRILRVSANDRDDKDEGVNAEIRYFLKDAIVSKKFSINDTTGQ-ITIKQAVDYEERSSYSFEVFASDGGEARLTGSSSVRITIIDVNDNRPYFLPTRYYVQLVENVAIGTPVTQVTASDLDSSLNGKV-LFSILGGNSDGKFVIDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLNSSQPGMLHVSVVNINDNSPVFSQKMYSASIDENTTVGHVILRVTASDL-DSSLNGKVL-----------FSILEGNSDGKFVVDQNTGVVTTNKSLDYEDVTEYTLVIQATDCGDPPLN--SSQPGMLHVSVVNINDNSP 813          

HSP 6 Score: 56.6102 bits (135), Expect = 5.539e-8
Identity = 51/211 (24.17%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHY--LIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD 1198
            A+  + + + D NDN P F     E  VSE +   G+ +    A D D +  NA + Y +   + +    +D      +    + D E    Y   I +           N  NV + V D NDNPP F    ++  V EN    +++ ++ A+D DS   ++L++ ++    ++    F ++ +   I +   LD E  + Y + + VTD
Sbjct:   91 AIATIHVQITDTNDNRPIFQPMEYETRVSENT-PLGTIVARVKAVDKD-STSNADLIYSIQNGNNNGSFTIDNSTGE-IMTRKEFDFEKTERYNLTISVSDTGVPALSSLNFANVVIIVVDENDNPPEFAQKRYTATVYENFTVGTVVLRVTAHDKDSGPNAMLKYSIHSGNTDD---AFVIIADSGDISLDKPLDKETIENYTLVLIVTD 295          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 187.193 bits (474), Expect = 1.003e-48
Identity = 193/665 (29.02%), Postives = 306/665 (46.02%), Query Frame = 2
Query:  302 IQENE----PIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCC-FSIDQKSSVLTI----AKNIDLESIC-INRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL-AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGL-YEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFT----INVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT--IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKP---LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKP 2224
            IQEN     P+      +ATD +     +E +  + Y+L+G +   F+++ ++ V+T       ++D E        + +   +G GH  L               V I VLD NDN P+F    I+  +SEA+   G  +   TA D D +  N +I + + +     F++    +    + +   LD E +  Y++ + A +   + +     V + + D NDN P+F    F+V V E     S+I    A DPD  S + + + +           F++  N   + I+  LD E  Q Y   V   DG   E+   + V + DEND SPQ        +V++ +  G ++  V   D+D    NG +          L F +         T +I T +  DRE+ S  ++V       N S   H  + FT    +N+ + DFNDN P+F QS+Y A V EN P+GT +  V A D D G+N +I YSL     +F I+ +TG I +Q  ++RE KE+Y + I A D G+  L+S   +++ V DVNDN P   +  +E ++ E  A A   + Q+   D+D+ RN  V +  T  +    M T+N T  + +    L+RE+KD + L V  RD G        G + + VID NDN P
Sbjct:  232 IQENSGPGVPVQMASSIMATDRD-----IESNADVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESL-------------AEVVIHVLDANDNTPRFIPSSIQSTISEAA-SIGQSVARVTANDPD-SGLNGRIFFSINSGSEGKFEIG---RSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG-------FAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGN-NGHVTYAILI----LPFIIVPD------TGNINTSSKLDREQQSLYTLVHYV---LNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTY--TIMHGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAV-PYMDFGTIDVHVIDKNDNTP 849          

HSP 2 Score: 177.563 bits (449), Expect = 1.394e-45
Identity = 186/673 (27.64%), Postives = 294/673 (43.68%), Query Frame = 2
Query:  575 LAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLET---ATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN---DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEAR---SXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIV--TDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKE-----HYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLID 2539
            +A+  VRI  LD NDN+P+FS  R    + E S   G  + + +   ATD DI   NA + Y L     S Q  ++ +       ++    LD E  T+Y   + A +       +   V ++V D NDN PRF  S     + E       + ++ ANDPDS   L   ++ + N+     F + ++  V+ +S  LD E    Y + V   DG Y  R     + V ++D ND +P+  +    ++V E    G+ +G VIV  T  D  Q +   I  +  + P    + ++G         +      DRE     S  +   DG    +N+       +NV+I D NDN P+F   QY   V +  P+GT++L VNA D D G NG + Y++      F I   TG I     +DRE +      HY L++   D G     S   LNI+V D NDN P    + +  +V EN+   T +  +   D D G N+ +++S T  +    +    G + + K ++RE K+ + + +   D G      S  +V + V+DVNDN P   +    R + +  + A             G  + Q+ A D D   N  +TY I+        +F+ N TTG +     L+      Y + V  +D G+ P +D
Sbjct:  206 IAIALVRI--LDRNDNVPKFSHARYTGSIQENS-GPGVPVQMASSIMATDRDIE-SNADVRYRL-NGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSG--LNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSE----GVAVGSVIVNATATDPDQGSNAAIT-YSMSYPGFAINSNTGS--------VTITRPLDRETKQAYSFTVHARDGGGLESNV------AVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAIL--ILPFIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTP-VLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAA-------------GEFVVQVNATDADVERNGHVTYTIMHGAL---GMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMD 833          

HSP 3 Score: 163.31 bits (412), Expect = 4.479e-41
Identity = 172/652 (26.38%), Postives = 292/652 (44.79%), Query Frame = 2
Query:  626 PQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHH-----KSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLY----EARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVI---GQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF-SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHIL-LPNTLPSQIFSFNSTTGYLSLDKPLSHHY-IGHYPIKVSVKDSG 2521
            P F+        +E S   G  I    ATD+D    N  ++Y + + +      +    LD      +    +L+ +    Y + I A +           V + V D NDN P FN + +S  V EN+P  + +  + A D DS   + + + +    ++ L +  + + N   I ++  LD E +  Y + +  TDG       A ++  V + D ND  P+         + ENSG G+ +     ++ TD+ D ++N  +      ++  ++F+++      ++T  +    + D E+++  +  +I +D   T       S   + + +LD NDN P+F  S   + ++E   IG  + +V A D D GLNG+I +S+       F+I  + GV+ V G +DRE K  Y L++ A+D    P      + +T+ DVNDN+P    P F   V E +A  + I      D D G NA + +S ++P      I  N G++ IT+PLDRETK  +   V  RD    G  +S+  V + + D NDN P+    +   ++ D T P              G ++  + A D D   N  +TY IL LP  +     + N+++    LD+     Y + HY + +SV D G
Sbjct:    1 PVFTPASYNATFTEGSSTRGVLIATVKATDSDDG-ANGDVDYSIVDGNVGDPRSNSDFTLDPNTG-MIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDR-DIESNADVRYRLNGSD-SIQFAVN--PRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHE----SLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPG---FAINSNTGSVTITRPLDRETKQAYSFTVHARD---GGGLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRT-PV-------------GTIVLAVNAEDRDVGNNGHVTYAILILPFIIVPDTGNINTSS---KLDREQQSLYTLVHYVLNLSVTDHG 619          

HSP 4 Score: 162.54 bits (410), Expect = 7.073e-41
Identity = 191/743 (25.71%), Postives = 327/743 (44.01%), Query Frame = 2
Query:  416 NCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGL--AEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLY-VDDFNDNPPRFNSSLFSVLVKENT----PARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILIS----SWLDYERHQRYKVPVFVTDGL---YEARSXXXXXXXXXXXXSPQLIQNPSVIE--VMENSGKGLVIGQVIVTDKDDSQTNGKMICE-HETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLT-PFEFSVRENLAPATIG-QLQYEDSDIGRNADVVFS-KTWPNDDTVMITVNGTLYITKPLDRETKD-----RHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            N  F++D  + ++  A+N++ +     +  S + + G     L           A  RV I V D+NDN P F+       V E S   G+ +   TATD D + +NA + Y +   + H  F+          + +  +LD E    Y + I A +         + + L  + D NDN P+F+ + ++  ++EN+    P + M   ++A D D  S + +R+ L    N      F+V     VI         LD+ER   Y   V   D     +E+ + + + V D ND +P+ I  PS I+  + E +  G  + +V   D D S  NG++    +  +E + E   S G         +R   + DRE  +   + +   DG  +    +     T+ V + D NDN PKF +  +   V+E   +G+VI+   A D D G N  I YS+   +  F I+S TG +T+  P+DRE K+ Y   +HA D G   L S+V +N+ + D NDNSP   T  ++  V +     TI   +  ED D+G N  V ++    P    +++   G +  +  LDRE +       + L + + D+G+  +  S   + I V D NDN+P+                 +  S ++      G  +T + A D+D   N+++ Y +    T    +FS   +TG + L K ++     +Y + ++  D G+P L  +   ++ +
Sbjct:   54 NSDFTLDPNTGMIKTARNLERQ-----QTFSYNLTIGAADHGL-------PSFSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENS-PVGTSLLDVTATDAD-SGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHARYTGSIQENSGPGVPVQ-MASSIMATDRDIESNADVRYRL----NGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFI--PSSIQSTISEAASIGQSVARVTANDPD-SGLNGRIFFSINSGSEGKFEIGRSDGV--------VRVSGSLDREAKAVYVLNVSAIDGSYSPREGY----GTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS--YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGG--LESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILP---FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVT-QFTSFALLNISVTDFNDNQPQF--------------NQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSL----TGGDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHV 736          

HSP 5 Score: 110.153 bits (274), Expect = 2.067e-24
Identity = 119/432 (27.55%), Postives = 184/432 (42.59%), Query Frame = 2
Query: 1304 SGKGLVIGQVIVTDKDDSQTNGKM---ICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHD-----FSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNS---SVGLNITVDDVNDNSPCLL-TPFEFSVRENLAPATIGQLQYE----DSDIGRNADVVFSKTWPNDDTVMITVNG-----TLYITKP--LDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            S +G++I  V  TD DD   NG +   I +    +PR     +   N  +    I+T    +R+++   ++ +  +D    S     +++  +++ + D NDN P F  + Y   V EN P+GT +L V A D D G N  + YS+        F      S  G I V G +DRE+ + Y L I A D G +P++    ++ L + + D NDN P      +  S++EN  P    Q+       D DI  NADV +       D++   VN      T  ++ P  LD E    +   V   D    G  +S  EV I V+D NDN PR I             P++ QS +IS   S G  + ++ A D D   N ++ + I   N+     F    + G + +   L       Y + VS  D    P
Sbjct:   17 STRGVLIATVKATDSDDG-ANGDVDYSIVDGNVGDPRSNSDFTLDPNTGM----IKTARNLERQQTFSYNLTIGAADHGLPS----FSATTRVSIVVGDLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATD-GGVPISRTAIAIAL-VRILDRNDNVPKFSHARYTGSIQENSGPGVPVQMASSIMATDRDIESNADVRYR--LNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTG-HESLAEVVIHVLDANDNTPRFI-------------PSSIQS-TISEAASIGQSVARVTANDPDSGLNGRIFFSI---NSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSP 417          
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 187.578 bits (475), Expect = 6.577e-48
Identity = 210/782 (26.85%), Postives = 334/782 (42.71%), Query Frame = 2
Query:  317 PIDRMVGTIATDIEGLGINLEFHGSLIYKL---SGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLI---KIRAWN----AQDNKQ---WNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDR--EKSSQISVVLICSDGWNT---------SANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEK-MFYL 2557
            P D+ +G     +     +   +G + Y +    G N  FSI + S  +T+ K +D E +                L++      N    A V V+I++LDVND  PQFSK+     + E        +    ATD D    N ++ + +   +               F +N ++ E +    +    I  +N    AQD  Q   +N+  VD+ + D NDN P+F SS F  ++ EN       +++ A D D  +   + F   Q   N+L   FS+ +N   I I   LD E+  ++   +   D      E  + + + + D ND  P+  Q      + ENS  G  + QV   D D   TN                          + Y I + +  DR    + Q  + L C+  +NT         +++  L+S+  + V + D N + P+F++  Y A V E+  +GT +L V A D D G N KI YS+      F +D TTGVI   G +DRE  + Y+  + A D G   L +   + I + DVNDN P  L P +E  VRE++ P   + ++   D+DIG+NA +++S     D     T++   G +   KPLDRET   + L V   D G     Q+S +V + + DV D+ P    P     + + T P           +SP  VIT + A   D +  T + Y I+  N+   Q+F  N  TG +     L +     Y  +++V+ + SP   +   M YL
Sbjct:  138 PEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKV------------PTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIRE-DVPVNQLVTTVRATDCDQG-SNGEVFFEIVSGNDM-----------NFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSFMQ---NDLP--FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTN--------------------------VVYSIVSSSGHDRCFRINPQGLITLSCTLNYNTKHVYVFSVSASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQG-TPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPP-----------RSP--VIT-VKAKSQDLSPETGMMYSIVRGNS--PQVFDINPNTGAIQTLMKLDYETQSEY--RLTVRATLSPFFTETTVMVYL 844          

HSP 2 Score: 150.984 bits (380), Expect = 1.326e-36
Identity = 186/759 (24.51%), Postives = 316/759 (41.63%), Query Frame = 2
Query:  302 IQENEPI--DRMVGTIATDIEGLGINLEFHGSLIYKLSGPN-----CCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG----LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHY---SLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPP 2530
            +QE+  +  D  VGT+   +     +   +G + Y +S          FSIDQ + V+T  + +D E +  +         G+  LE  ++L             I+VLDVNDN P F +      + E     G  +    A+D D +  N +++Y +             +    + ++  LD E    Y ++++A +  +  +   + V + + D ND  P+F+  ++S  ++E+ P   ++  + A D D  S         + N++   FS+ +    + +   LDYE    + + V   D     LY  ++ +++ + D ND +PQ + +     + EN   G    +V   DKD   TNG++       +  L FS++        T  I  K   DREK  + +  +   D            +  I + +LD NDNPPKF Q +Y   +AEN   GT +L+V A D D G    ++    S  HD   F+I+   G+IT+   ++   K  Y   + A D     L+S+  + + V D N ++P      +   V+E+ +  T +  +   D D G NA + +S      +  +    G +     LDRE  D +   V   D+G+   +  S  V I + DVNDN P  + P              S    +     PG  + ++ A D D   N ++ Y     N      F+ +ST G +   KPL    I  Y + V   D G+PP
Sbjct:   23 LQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDL------------TINVLDVNDNGPIFERNIYAADIPE-DKSIGDFVLAVRASDAD-SGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDM-NFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYN-QTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHG-TNGEITFSFMQND--LPFSINEN------TGGISIKEELDREKVPKFTFGIKARD----KGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHD-RCFRINPQ-GLITLSCTLNYNTKHVYVFSVSASDGM---LSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSF-VYIHIADVNDNDPVFLKP--------------SYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYS-FASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPP 731          

HSP 3 Score: 129.798 bits (325), Expect = 3.342e-30
Identity = 124/438 (28.31%), Postives = 193/438 (44.06%), Query Frame = 2
Query: 1259 PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTY--------DIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL---EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENL-APATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMIT--VNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            PQ  +      V E++  G V+  V  +D D S +NG            + +S+S  +N    TY         I TK   DRE   +    +   DG   S   ++    TINV  LD NDN P F ++ Y A + E+  IG  +L V A D D G NG++ Y +   + D S F I   +G +TV   +DRE    Y L + A D G+ P +++V + IT+ DVND +P      +  ++RE++     +  ++  D D G N +V F     ND        +NG + + + LD E      L V  +D G      +   V I +IDVNDN P+ ++      I +      + ++    Y+   Y        D D  TN ++T+   + N LP   FS N  TG +S+ + L    +  +   +  +D G P
Sbjct:   18 PQFSRLQEDASVSEDAEVGTVVATVSASDPD-SGSNGM-----------IRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYM--DLTINV--LDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKG-QPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPE------NYAVGQEFYRVQAY--------DKDHGTNGEITFS-FMQNDLP---FSINENTGGISIKEELDREKVPKFTFGIKARDKGVP 420          

HSP 4 Score: 122.865 bits (307), Expect = 4.427e-28
Identity = 120/444 (27.03%), Postives = 208/444 (46.85%), Query Frame = 2
Query:  941 DNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTS--VLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKM-ICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTP-FEFSVRENLAPATIGQ----LQYEDSDIGRNADVVFSKTWPNDDTVMITVN-GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL 2230
            +NPP+F+       V E+    +++  + A+DPDS S  ++R+ +  + N      FS+ Q   VI     LD E   R+   V   DG     E    L + V D ND  P   +N    ++ E+   G  +  V  +D  DS +NG++  C   +      FS+        ++  +      DREK    ++ +   D      N   +++ T+ + +LD ND  P+F +  Y A + E+ P+  ++  V A D D G NG++ + +   +D + F I+   G + V+  +D E+   + L + A D G   L +   ++I + DVNDN+P  ++  F+  + EN A   +GQ    +Q  D D G N ++ FS    ND    I  N G + I + LDRE   +    ++ RD G+   ++ + ++ I ++D+NDN P+ 
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDA-DSGSNGEVKYCILNSDGDNSAFSIGE------VSGAVTVMKKLDREKVPTYTLQVQAQD----QGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYA---VGQEFYRVQAYDKDHGTNGEITFS-FMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVP-FKEGTAQITITLLDINDNPPKF 442          

HSP 5 Score: 121.709 bits (304), Expect = 1.202e-27
Identity = 100/332 (30.12%), Postives = 160/332 (48.19%), Query Frame = 2
Query: 1598 DNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSL-----FQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP--ATIG----QLQYEDSDIGRNADVVFSKTWPNDDTVMIT---VNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRL---INPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE 2542
            +NPP+F + Q  A V+E+  +GTV+  V+A D D G NG I YS+    +L     F ID  TGVIT +  +DRE  + +   + A D G   L   + L I V DVNDN P     FE ++     P   +IG     ++  D+D G N +V +     + D    +   V+G + + K LDRE    + L+V+ +D G N  R ++  V I ++DVND  P+    +    +RE              + V Q    ++T + A D D  +N ++ + I+  N +    FS N   G + + + L +  IG + + V+ +D G P L ++
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMSPSQNLMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPI----FERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAFSIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQG-NPPRSATVTVKITLLDVNDCTPQFSKKVYSATIRE-------------DVPVNQ----LVTTVRATDCDQGSNGEVFFEIVSGNDM--NFFSINRINGEVRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQ 322          

HSP 6 Score: 101.293 bits (251), Expect = 1.874e-21
Identity = 153/656 (23.32%), Postives = 274/656 (41.77%), Query Frame = 2
Query:  578 AVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GL--YEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSS-GKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS--LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSV---RENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVN---GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKP-LSHHYIGHY 2491
               ++ I++LD+NDN P+FS++     ++E S + G+ +    A D D  P N       +  H     C     Q  + L   L+   +  Y+  +   +A D    +   V + V D N + P F    +S  VKE+    + +  ++A D D+ S  +   Y  A   L   FSV +   VI  +  LD E+   Y+  V  TD G+   +A+S + + + D ND  P  ++     +V E+   G  + +V  +D D  + N ++I           +S +S G  +   T D     IRT    DRE   +  + ++ +D           +S  + V + D  D+PP F +  Y   V E+ P  + ++ V A   D      + YS+    S  +F I+  TG I     +D E +  Y+L + A  S   P  +   + + + D+NDN+P +L  F  ++      + P    ++   D D+   +D +  K    +    +T+N   G L + K L + +K  + +++ + D    G R +S    I +  V      +I      EIDD            + Y+     ++Q++    D      +T  ++LP  + S  +S    T +L L K      ++G++
Sbjct:  424 GTAQITITLLDINDNPPKFSQEEYHTSIAENS-RWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDR---CFRINPQGLITLSCTLNYNTKHVYVFSV---SASDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKIS-YSIAT--LVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGK-NAQII-----------YSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQ----ASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLS---PFFTETTVMVYLKDINDNTP-VLEAFHMNINVQEGKVPPEARYKIPAYDPDV---SDKLTFKVMEGNAKEWVTLNATSGELSVNKKLIQASKPAN-IKIAVTD----GLRTASATGSIMMTSVTT---EMIQQSIQLEIDD----MEVLEFFNTAYEKLRESVSQIVKCKPDQVLMFDITSRVILP--VSSADYSKTRLTIWLVLRKKNEKEAFVGYF 1032          

HSP 7 Score: 51.6026 bits (122), Expect = 2.208e-6
Identity = 87/415 (20.96%), Postives = 167/415 (40.24%), Query Frame = 2
Query:  560 SNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTD-GLYEAR-SXXXXXXXXXXXXSPQLIQNPSV-IEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRL-EFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLD--DGLNGKIHYSLEHDFSLFQIDSTTGVITV 1786
            S+  L +   V ++V D N + P+F ++     V E +   G+ +    ATD D    NA+I Y +A     F +    +    +     LD E    Y  ++ A +    +   +  V +++ D NDN P F    +   V+E+      + ++ A+D D     +      +N + +  F++     +I     LD E    Y++ V  TD G    + SV   ++ ++  +SP L + P   + V E++     +  V    +D S   G M        P++ + + ++G  + ++  D  T++ +     + +S                  +  T+ V + D NDN P         +V E         K+ AYD D  D L  K+      ++    +++T+G ++V
Sbjct:  519 SDGMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDA-SLGTSVLTVLATDRDTG-SNAKISYSIATLVPEFSV---DETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRATLSPFF---------------TETTVMVYLKDINDNTPVLEAFHMNINVQEGKVPPEARYKIPAYDPDVSDKLTFKVMEGNAKEW--VTLNATSGELSV 911          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 224.172 bits (570), Expect = 9.064e-60
Identity = 220/799 (27.53%), Postives = 361/799 (45.18%), Query Frame = 2
Query:  272 GIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSS---GQG-HLELIVNLWSNVQLLA--VVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKS---FQLCLDQQRQ---PYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQ--------LIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSL-----SSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CLLTPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            G  +  + Y +QE +P + ++G++A D    G+    H   +YKL        +D K+       +I    I I+RE   DC S   G+  +LE  V++   +Q  +  ++  RI V D+NDN PQF    +   V E +   G+   +  ATD D +  N   +Y L     +   F L +   R    P L +L +LD E +  Y + I+A +  + +++++  + + V D NDN P+F    +   V EN+P    + Q+ A+D D      + + L+Q A + + KL  + +   +I +   LD E        V   D   + +S    +  +  D+   +P         +  +  +  + E+   G  +  V V+DKD+ + N  + C      P   F L     S+  NK+   Y ++T T  D E+  +  V ++  D    S N  L+S+ ++ VQ+ D NDN P F  + +    AE    G  IL V A D D G N ++ Y++  D     LF+ID  TG +  + P+DRE KE Y+  + A D GS     +  + I V D NDN P  +L+ + FSV EN+ P + +G +   D D G NA V  S        V+    GT+  +   DRE +  +  R++  D G   R    G V I V+D NDN P +            T P+ S    +S   SP   +  + A D D   N  L + I   N  P Q+F  + ++G ++L K ++  + G + + V V D G PP     + ++++
Sbjct:   18 GPAKGSILYRVQEEQPPNTLIGSLAAD---HGLPDSGH---LYKLEVGAPYLRVDGKTG------DIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENT-IMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQ-AVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGE-NAVVTCVVAGDVP---FQLRPASDSTSDNKR--KYFLQTTTPLDYERVKEYRVEIVAVD----SGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVG-VTINVLDENDNDPVV------------TKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGN--PYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 776          

HSP 2 Score: 64.6994 bits (156), Expect = 5.723e-10
Identity = 83/336 (24.70%), Postives = 133/336 (39.58%), Query Frame = 2
Query: 1637 HVAENGPIGTVILKVNAYDLDDGLNGKIH-YSLEHDFSLFQIDSTTG-VITVQGPVDRE-LKE----------HYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATIGQLQYE-DSDIGRNADVVFSKTWPNDDTVMITVN---------GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
             V E  P  T+I  + A   D GL    H Y LE      ++D  TG + T + P+DRE L++          + +  +   D    P    +   I V D+NDN+P   L+    SV EN     +  +    D D  RN    ++ T   D   +  +            L +   LDRE KD + L ++  D G N +R S   + + V D NDN P+  +P    E+ +  SP              G+ + Q+ A D D   N ++ Y +        ++   + TTG + +  PL    I      V  +D G  P   +    + +T++
Sbjct:   27 RVQEEQPPNTLIGSLAA---DHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGG-NPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSE-NSPV-------------GHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQ 344          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 224.942 bits (572), Expect = 2.118e-59
Identity = 220/799 (27.53%), Postives = 361/799 (45.18%), Query Frame = 2
Query:  272 GIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSS---GQG-HLELIVNLWSNVQLLA--VVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKS---FQLCLDQQRQ---PYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQ--------LIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSL-----SSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDF---SLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CLLTPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
            G  +  + Y +QE +P + ++G++A D    G+    H   +YKL        +D K+       +I    I I+RE   DC S   G+  +LE  V++   +Q  +  ++  RI V D+NDN PQF    +   V E +   G+   +  ATD D +  N   +Y L     +   F L +   R    P L +L +LD E +  Y + I+A +  + +++++  + + V D NDN P+F    +   V EN+P    + Q+ A+D D      + + L+Q A + + KL  + +   +I +   LD E        V   D   + +S    +  +  D+   +P         +  +  +  + E+   G  +  V V+DKD+ + N  + C      P   F L     S+  NK+   Y ++T T  D E+  +  V ++  D    S N  L+S+ ++ VQ+ D NDN P F  + +    AE    G  IL V A D D G N ++ Y++  D     LF+ID  TG +  + P+DRE KE Y+  + A D GS     +  + I V D NDN P  +L+ + FSV EN+ P + +G +   D D G NA V  S        V+    GT+  +   DRE +  +  R++  D G   R    G V I V+D NDN P +            T P+ S    +S   SP   +  + A D D   N  L + I   N  P Q+F  + ++G ++L K ++  + G + + V V D G PP     + ++++
Sbjct:   95 GPAKGSILYRVQEEQPPNTLIGSLAAD---HGLPDSGH---LYKLEVGAPYLRVDGKTG------DIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENT-IMGALFSIPLATDRD-SERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQ-AVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGLVTHSEGIANISEDMPVGTAVALVQVSDKDEGE-NAVVTCVVAGDVP---FQLRPASDSTSDNKR--KYFLQTTTPLDYERVKEYRVEIVAVD----SGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYNIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHLSVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVG-VTINVLDENDNDPVV------------TKPSNSSFRQLSPVASPDSHVDVVEAEDLDSGPNADLVFSIAGGN--PYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYV 853          

HSP 2 Score: 64.6994 bits (156), Expect = 6.539e-10
Identity = 83/335 (24.78%), Postives = 133/335 (39.70%), Query Frame = 2
Query: 1640 VAENGPIGTVILKVNAYDLDDGLNGKIH-YSLEHDFSLFQIDSTTG-VITVQGPVDRE-LKE----------HYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCL-LTPFEFSVRENLAPATIGQLQYE-DSDIGRNADVVFSKTWPNDDTVMITVN---------GTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNK 2572
            V E  P  T+I  + A   D GL    H Y LE      ++D  TG + T + P+DRE L++          + +  +   D    P    +   I V D+NDN+P   L+    SV EN     +  +    D D  RN    ++ T   D   +  +            L +   LDRE KD + L ++  D G N +R S   + + V D NDN P+  +P    E+ +  SP              G+ + Q+ A D D   N ++ Y +        ++   + TTG + +  PL    I      V  +D G  P   +    + +T++
Sbjct:  105 VQEEQPPNTLIGSLAA---DHGLPDSGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETLRDCRSLVKGKPCYLEFEVSVTDLLQNPSPRLIEGRIEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGG-NPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSE-NSPV-------------GHSVLQVKADDSDMGPNGEIEYSLHQAVDPVPKLLRIDRTTGIIYVKGPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQ 421          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 221.476 bits (563), Expect = 8.158e-59
Identity = 211/770 (27.40%), Postives = 350/770 (45.45%), Query Frame = 2
Query:  290 LKYLIQENEPIDRMVGTIATDIE--------GLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            L Y I+E    + ++G I  D+         G   NL +   L+ K         +     + T +  ID E +C       ++CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D  P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F  +   V + EN+P  + + QL A D D    + + +      +   ++LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DK D+  NGK+IC  E   P   F L +  + +   Y + T    D E + + +  ++ SD    S N     +  + V++ D NDNPP F Q      V EN      +  ++A D D G N +I Y L  + S F +D  TGV+T     DRE ++ +   + A D+G+ PL +   + +TV D NDN+P      F+F V ENL   +T+G +   DSD G NA +  S    N++ ++   +G +      DRE +  +   VR  D+G      S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   IG + + V++ D G P
Sbjct:   26 LIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYR--LVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECS-----FEIEVVVLPN-DYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDTGP-NSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDK-DTDINGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYNFKIVASDSGKPSLN----QTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSG-RPPCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 122.094 bits (305), Expect = 1.246e-27
Identity = 105/370 (28.38%), Postives = 167/370 (45.14%), Query Frame = 2
Query: 1475 FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-----CLLTPFEFSV---RENLAPATIGQLQYEDSDIGRNADVV--FSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQS--PGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
             DRE+     + +   DG +       +S+  + V + D NDN P FR++Q   H+ EN PIGT ++++ A D D G N +IHY      S     LF ++ST+G+ITVQ P+DRE    +KL + A D  S P  ++V +N+T  DVNDN P      +++P   +V    ++     I  +   D D   N  V+    K  P     +      L  +  LD E    +  ++   D+G     Q++  V +R+ D NDN P    P                 I ++V ++      +T L A D+D   N ++ Y  L PN   +  F  +  TG L+  +         +   V+ +D+G+PPL
Sbjct:  209 LDREQKDTYVMKIKVEDGGSPQK----SSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVT--DVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTA-LVRVRLEDENDNPPIFTQP----------------VIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQ-LGPN---ASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL 551          

HSP 3 Score: 88.5817 bits (218), Expect = 2.936e-17
Identity = 145/585 (24.79%), Postives = 232/585 (39.66%), Query Frame = 2
Query:  176 SYNYKLIFQQSGKMDILKTLFLFLTAVRCSETG--IKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLS-GPNCCFSIDQKSSVLTIAKNIDLESICINR--ELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVS-----EASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF---RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQ---GPVDRELKEHYKLHIHAVDSG 1852
            +Y  K+  +  G      T  L +T    ++     +E  ++  I EN PI   V  +      +G N E H     ++S      F+++  S ++T+ + +D E   I++   L+SD SS      +I+N                V DVNDN P    + I   ++            + I L T +D D       I +   E    F L      Q  L     LD E    Y  KI A ++          V + ++D NDNPP F   +  + V EN      +  L A D DS       +YQ   N     F + +   V+  S   D E   R+   V   D      +A++ + V V DEND +P+   N     V EN  K   +G + VTD D  +                  SLS   + +    D     I++  +FDRE+ S  +  +   D    S     +S+  + + ++D NDN P       +  F  V  +   G+V+ +V A D D G+N ++ Y++   ++  LF+ID  TG IT++    P D  L   ++L ++  D G
Sbjct:  216 TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIIN----------------VTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICF--IEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEI-VYQLGPNA--SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAA--------------ISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAID----SGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDIGL---HRLVVNISDLG 758          

HSP 4 Score: 68.1662 bits (165), Expect = 4.968e-11
Identity = 89/335 (26.57%), Postives = 152/335 (45.37%), Query Frame = 2
Query:  170 TVSYNYKLIFQQSGKMDILKTLFLFLTAVRCSETG-----IKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCC-FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN---DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRF----NSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTV 1129
            T  YN+K++   SGK  + +T    L  VR  +         + V++  + EN   D  + T++   E  G N E    ++Y+L GPN   F +D+K+ VLT ++  D E    +R L +  +   G             L A   V ++VLD NDN P+F+    +  VSE   K  S + + T TD+D A ENA I   +   +++F L       P+  ++      D E Q+ Y   +RA ++      +   V + V D NDN P      +++ F ++   + P  S++ ++ A D D+   + L++ +    N  L ++  V  N T+
Sbjct:  431 TKEYNFKIVASDSGKPSLNQTA---LVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAE----IVYQL-GPNASFFDLDRKTGVLTASRVFDRED--QDRFLFTVTARDNG----------TPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKY-STVGVITVTDSD-AGENAAISLSILNDNENFIL------DPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPG-SVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITL 736          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 221.861 bits (564), Expect = 1.579e-58
Identity = 211/770 (27.40%), Postives = 350/770 (45.45%), Query Frame = 2
Query:  290 LKYLIQENEPIDRMVGTIATDIE--------GLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELS-SDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCL----DQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD--STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYE-ARSXXXXXXXXXXXXSPQL----IQNP--SVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLL-TPFEFSVRENLAP-ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSP 2527
            L Y I+E    + ++G I  D+         G   NL +   L+ K         +     + T +  ID E +C       ++CS      E+ V +  N     +++++I V D NDN P F    I   + E +    S   + +ATD D  P N+  +Y L     +F L +    + ++ P L +  +LD E +  Y++KI+  +    ++ +   + + V D NDN P F  +   V + EN+P  + + QL A D D    + + +      +   ++LF++     +I +   LD E    +K+ V  +DG    AR+ + + V D ND  P +    I +P    + + E       I  + V+DK D+  NGK+IC  E   P   F L +  + +   Y + T    D E + + +  ++ SD    S    L  +  + V++ D NDNPP F Q      V EN      +  ++A D D G N +I Y L  + S F +D  TGV+T     DRE ++ +   + A D+G+ PL +   + +TV D NDN+P      F+F V ENL   +T+G +   DSD G NA +  S    N++ ++   +G +      DRE +  +   VR  D+G      S+ +V I VIDVNDN P +I P           P+ +    + +   PG V+ ++ AVD D   N +L Y I+  N     +F  +  TG ++L++  +   IG + + V++ D G P
Sbjct:   26 LIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYR--LVSKAGDSPLVRVLGNTGEIFTTSNRIDREKLCPGSSFEDAECS-----FEIEVVVLPN-DYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENT-LINSRFAIPSATDPDTGP-NSVHKYELINGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDK-DTDINGKVICFIEKDVP---FHLKAVYDNQ---YLLETSALLDYEGTKEYNFKIVASD----SGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAAISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAIDSG-RPPCSSAAKVTINVIDVNDNTPIVIYP-----------PSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN--KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP 760          

HSP 2 Score: 122.094 bits (305), Expect = 1.736e-27
Identity = 105/370 (28.38%), Postives = 167/370 (45.14%), Query Frame = 2
Query: 1475 FDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFS-----LFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-----CLLTPFEFSV---RENLAPATIGQLQYEDSDIGRNADVV--FSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQS--PGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPL 2533
             DRE+     + +   DG     +   +S+  + V + D NDN P FR++Q   H+ EN PIGT ++++ A D D G N +IHY      S     LF ++ST+G+ITVQ P+DRE    +KL + A D  S P  ++V +N+T  DVNDN P      +++P   +V    ++     I  +   D D   N  V+    K  P     +      L  +  LD E    +  ++   D+G     Q++  V +R+ D NDN P    P                 I ++V ++      +T L A D+D   N ++ Y  L PN   +  F  +  TG L+  +         +   V+ +D+G+PPL
Sbjct:  209 LDREQKDTYVMKIKVEDG----GSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIINVT--DVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTA-LVRVRLEDENDNPPIFTQP----------------VIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQ-LGPN---ASFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPL 551          

HSP 3 Score: 88.9669 bits (219), Expect = 2.237e-17
Identity = 139/561 (24.78%), Postives = 222/561 (39.57%), Query Frame = 2
Query:  176 SYNYKLIFQQSGKMDILKTLFLFLTAVRCSETG--IKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLS-GPNCCFSIDQKSSVLTIAKNIDLESICINR--ELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVS-----EASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDG---LYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYD-----IRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKF---RQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQ 1789
            +Y  K+  +  G      T  L +T    ++     +E  ++  I EN PI   V  +      +G N E H     ++S      F+++  S ++T+ + +D E   I++   L+SD SS      +I+N                V DVNDN P    + I   ++            + I L T +D D       I +   E    F L      Q  L     LD E    Y  KI A ++          V + ++D NDNPP F   +  + V EN      +  L A D DS       +YQ   N     F + +   V+  S   D E   R+   V   D      +A++ + V V DEND +P+   N     V EN  K   +G + VTD D  +                  SLS   + +    D     I++  +FDRE+ S  +  +   D    S     +S+  + + ++D NDN P       +  F  V  +   G+V+ +V A D D G+N ++ Y++   ++  LF+ID  TG IT++
Sbjct:  216 TYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPARATVIIN----------------VTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICF--IEKDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEI-VYQLGPNA--SFFDLDRKTGVLTASRVFDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGVITVTDSDAGENAA--------------ISLSILNDNENFILDPFSGVIKSNVSFDREQQSSYTFDVRAID----SGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLE 737          

HSP 4 Score: 68.5514 bits (166), Expect = 3.742e-11
Identity = 89/335 (26.57%), Postives = 152/335 (45.37%), Query Frame = 2
Query:  170 TVSYNYKLIFQQSGKMDILKTLFLFLTAVRCSETG-----IKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCC-FSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLN---DLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRF----NSSLFSVLVKENTPARSMIFQLIANDPDS--TSVLRFDLYQTANNELRKLFSVLQNGTV 1129
            T  YN+K++   SGK  + +T    L  VR  +         + V++  + EN   D  + T++   E  G N E    ++Y+L GPN   F +D+K+ VLT ++  D E    +R L +  +   G             L A   V ++VLD NDN P+F+    +  VSE   K  S + + T TD+D A ENA I   +   +++F L       P+  ++      D E Q+ Y   +RA ++      +   V + V D NDN P      +++ F ++   + P  S++ ++ A D D+   + L++ +    N  L ++  V  N T+
Sbjct:  431 TKEYNFKIVASDSGKPSLNQTA---LVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAE----IVYQL-GPNASFFDLDRKTGVLTASRVFDRED--QDRFLFTVTARDNG----------TPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKY-STVGVITVTDSD-AGENAAISLSILNDNENFIL------DPFSGVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTSFKLVPLSSIPG-SVVAEVFAVDSDTGMNAELKYTIVSGNNKGLFRIDPVTGNITL 736          
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 220.705 bits (561), Expect = 1.921e-58
Identity = 210/807 (26.02%), Postives = 358/807 (44.36%), Query Frame = 2
Query:  236 FLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSS----GQGHLELIVNLWSNVQLLAV----VRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQ------QRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSV--LRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXX---SPQL--------IQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSL--EHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSP-CLLTPFEFSVRENLAPAT-IGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFI 2563
             + LT V     G       Y + E +P + ++G++A D   LG+    H   +YKL   +    +D K+  +   +      I I+RE  SDC +     +  LE  V++   V+ + +    +   I VLD+NDN PQFS   +   + E +H  G+   +  A D D    N   EY L+    + QL   Q      ++ P + ++ +LD E +  Y + IR  +     + +   + + V D NDN P+F  + +   + EN+P    + Q+ AND D+ +   + + L+Q A++ +++L  + ++  +I +   +D E     K  V   D    ++S    +     D+   +P +        I    V  + E+   G  +  V V+D+D+ + N  + C      P      S   N +   Y ++T T  D E+     + ++  D    S N  L+S+ ++ VQ+ D NDN P F  +    + AE+   G  ++ V A D D G+N ++ YS+      SLF+I+S TG I V+  +DRE  E Y+  + A D G      +  + I V+D NDN P  +L+ + FSV EN+ P   +G +   D+D G N+ V       N   ++    GT+  +   DRE +  +  R++  D G   R    G V I V+D NDN P +            T PA S    +     P   +  + A D D   N +L Y I   N  P  +F  +  +G + L +  +  + G + + V V D G PP     + ++++
Sbjct:   23 LVLLTIVLMVPCGAVPSNNIYKLSEEQPPNTLIGSLAAD---LGLPDSGH---LYKLEVGSPYLRVDSKTGEIYTTE------IPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTH-TGTLFSIPVAVDRDSG-SNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ-ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGE-NAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVD----SGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVG-VTINVLDENDNAPYV------------TKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGN--PHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          

HSP 2 Score: 90.8929 bits (224), Expect = 6.029e-18
Identity = 113/465 (24.30%), Postives = 202/465 (43.44%), Query Frame = 2
Query:  584 VRVRISVLDVNDNIPQFS--------KQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQL------CLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXS---PQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEP-RLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQ--SQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLE--HDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDN 1912
             +V IS+ D NDN P            Q    ++SE     G+ + L   +D D   ENA +   +A     FQL        D++R+ +L     LD E    Y I+I A ++ +    +  ++ + V D NDN P F+ +L  V   E+      +  ++A D DS       +Y    +    LF +  N   I + + LD E  +RY+  V   D    +++   ++V +  D +   P+ + +     V EN      +G V V+D D  + +   +      EP   +F + +G      T  I +  +FDREK S  +  L   D  +       +S   + + +LD NDN P   +  +  + H+  + P  T +  V A D+D G+N +++Y++   +   LFQI   +G I +      + K  ++L +   D G  P +++  +++ V++  +N
Sbjct:  354 AQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISE-DMPIGTPVALVQVSDRDEG-ENAVVTCVVA-GDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAEL-VYSIIESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLF----VEPDNGKFIIQNG------TGTILSSISFDREKESTYTFRLKAVDAGDPPR----SSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNN 800          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000059102.1 (SMESG000059102.1)

HSP 1 Score: 2184.07 bits (5658), Expect = 0.000e+0
Identity = 1091/1093 (99.82%), Postives = 1091/1093 (99.82%), Query Frame = 2
Query:  143 MRTIEYTFVTVSYNYKLIFQQSGKMDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGSWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPRCHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEIKEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVTLSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP 3421
            MRTIEYTFVTVSYNYKLIFQQSGKMDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSVLEVLVEDENDESPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILD NDNPPKFRQSQYFAHVAEN PIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGSWVDKNSLLVVIILSCISLSFIAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPRCHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEIKEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVTLSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP
Sbjct:    1 MRTIEYTFVTVSYNYKLIFQQSGKMDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSVLEVLVEDENDESPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDLNDNPPKFRQSQYFAHVAENSPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGSWVDKNSLLVVIILSCISLSFIAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPRCHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEIKEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVTLSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP 1093          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000059102.1 (SMESG000059102.1)

HSP 1 Score: 2135.15 bits (5531), Expect = 0.000e+0
Identity = 1067/1069 (99.81%), Postives = 1067/1069 (99.81%), Query Frame = 2
Query:  215 MDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGSWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPRCHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEIKEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVTLSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP 3421
            MDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSVLEVLVEDENDESPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILD NDNPPKFRQSQYFAHVAEN PIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGSWVDKNSLLVVIILSCISLSFIAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPRCHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEIKEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVTLSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP
Sbjct:    1 MDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSVLEVLVEDENDESPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKSSQISVVLICSDGWNTSANIHLTSSFTINVQILDLNDNPPKFRQSQYFAHVAENSPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGGSWVDKNSLLVVIILSCISLSFIAMLVTAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPRCHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEIKEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVTLSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP 1069          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 500.745 bits (1288), Expect = 3.460e-157
Identity = 395/1172 (33.70%), Postives = 598/1172 (51.02%), Query Frame = 2
Query:  218 DILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDI----EGLGINLEFHGSLI-YKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR-------LEFSLSSGKNKKILTYDIRTKTAFDRE-------KSSQISVVLICSDGWN-TSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP---ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISI--SVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGG-SWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNN------------NRYDKNWIKKISSGRTES----MKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCI----ETSIDN---KPFGNIETAIYSDDH--------------LGYISNSSVPRCHGNRMLTGRNTISRLDYG------VCSQCPIMSNYGSPGYATFGH----YIDTSNDEEI--KEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENA-NIPMVTLSGRIDSG-NNSISQKISPT------------------NNYLQS-----------GVLCDEINQLFFHNLI 3415
            +IL   FL +      E GI+   L Y IQEN  ++ ++GT++ D+    +   +   F+  L+ Y L   +  F +  K+  L +   ID++ IC+ +     C S    LEL VNLW N +L+AV+ V ++VLDVNDN P F   +I   V+E +HK G  IFL  A D DI+ + ++I YGL+  +  F+L +    +PYL LL D D E   HY   ++AWN   +     L+V + V DFNDN P F SSL  +++ ENTP  S IFQL A D D T+ + + +  +A  ELR +F V  NG V L    LDYE    Y +PV V+DG+Y     L++ +E+ NDE P+ + NPS ++V+E +  GL IGQV + D DD   NGK+IC     EP+       LEF  +  K+ +   Y+I+TK ++DRE       K + I  +LIC+DGW  +S +  LTS+  I+V + D NDN P+F    Y + V EN       ++V+A+D D G N  I +SL  D   F+ID+ +G I+ +   DRE K +Y +++   D G  PL+S+  +NIT+ DVNDN+P L    + ++ EN        +  L YED D   N  V FSK WP D   ++T NG+++     DRET+DR+CL VRL+D+G + +  S+G VCI+++D NDN+P + +P+GL   D+   P ++  I I  S+Y++PGY +  + A DDDD  N  + + +  P  +P ++F     TG L L++ LS   IG + ++++V+D G P L   ++  + I ++P   +   +   GG  W+   +LLVVIILS +S+  I +L+TAI+C+LKPC    N            NRY  N   KI+    +S    MK            +EN+  + +  + SS+ N+ +    +  +DN    P G+    I  D H              L  + NS+   C     ++      + +        + S  P+ S    P  ++FGH    ++   N  ++   ++ QSDSGRG S+DD    +  +  V+ Q      N     N    P  T S  I S  N  + Q  SPT                  ++ L +           G LC+EIN LFF  LI
Sbjct:    6 NILYVSFLIIQICNFCE-GIERFSLTYTIQENTAVETLIGTVSVDLYDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICV-KSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDFELQVGHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIIC----NEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSL-LDNEDFKIDAISGWISAKHTFDRETKNYYLINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMP-KLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPSSEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRDIENGNGNTLYSYEGTNRYFSNCANKINVDYFQSSILRMKKFC-----ENPDEENIGYSVDRTLLSSYTNNDMINQPQILLDNYIYHPNGDFPEEICVDQHYQQWPVFQASDESKLSQLQNSNFNYCPAEGAISNNLQFFKFNLNNSNENTLNSFIPMSSYNTGPKASSFGHPTPLFLSPMNLSKVLQHDEQQSDSGRGNSDDDIVNLSNNQSSVIYQKIYSPLNLTSISNTYTFPKHTKSCHIASTCNQPLHQLGSPTPPTATRNHQPFTETSGSSDHNLSTDPEEKSRSGDLGHLCEEINDLFFKKLI 1164          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 502.671 bits (1293), Expect = 1.140e-155
Identity = 378/1107 (34.15%), Postives = 582/1107 (52.57%), Query Frame = 2
Query:  197 FQQSGKMDILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDI----EGLGINLEFHGSLI-YKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR-------LEFSLSSGKNKKILTYDIRTKTAFDRE-------KSSQISVVLICSDGWN-TSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP---ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISI--SVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGG-SWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNN------------NRYDKNWIKKISSGRTES----MKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCI----ETSIDN---KPFGNIETAIYSDDH--------------LGYISNSSVPRCHGNRMLTGRNTISRLDYG------VCSQCPIMSNYGSPGYATFGH----YIDTSNDEEI--KEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVT 3292
            F   GK +IL   FL +      E GI+   L Y IQEN  ++ ++GT++ D+    +   +   F+  L+ Y L   +  F +  K+  L +   ID++ IC+ +     C S    LEL VNLW N +L+AV+ V ++VLDVNDN P F   +I   V+E +HK G  IFL  A D DI+ + ++I YGL+  +  F+L +    +PYL LL D D E   HY   ++AWN   +     L+V + V DFNDN P F SSL  +++ ENTP  S IFQL A D D T+ + + +  +A  ELR +F V  NG V L    LDYE    Y +PV V+DG+Y     L++ +E+ NDE P+ + NPS ++V+E +  GL IGQV + D DD   NGK+IC     EP+       LEF  +  K+ +   Y+I+TK ++DRE       K + I  +LIC+DGW  +S +  LTS+  I+V + D NDN P+F    Y + V EN       ++V+A+D D G N  I +SL  D   F+ID+ +G I+ +   DRE K +Y +++   D G  PL+S+  +NIT+ DVNDN+P L    + ++ EN        +  L YED D   N  V FSK WP D   ++T NG+++     DRET+DR+CL VRL+D+G + +  S+G VCI+++D NDN+P + +P+GL   D+   P ++  I I  S+Y++PGY +  + A DDDD  N  + + +  P  +P ++F     TG L L++ LS   IG + ++++V+D G P L   ++  + I ++P   +   +   GG  W+   +LLVVIILS +S+  I +L+TAI+C+LKPC    N            NRY  N   KI+    +S    MK            +EN+  + +  + SS+ N+ +    +  +DN    P G+    I  D H              L  + NS+   C     ++      + +        + S  P+ S    P  ++FGH    ++   N  ++   ++ QSDSGRG S+DD    +  +  V+ Q S+ K  +++ +   I + T
Sbjct:    9 FMSIGK-NILYVSFLIIQICNFCE-GIERFSLTYTIQENTAVETLIGTVSVDLYDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICV-KSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDFELQVGHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIIC----NEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSL-LDNEDFKIDAISGWISAKHTFDRETKNYYLINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMP-KLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPSSEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRDIENGNGNTLYSYEGTNRYFSNCANKINVDYFQSSILRMKKFC-----ENPDEENIGYSVDRTLLSSYTNNDMINQPQILLDNYIYHPNGDFPEEICVDQHYQQWPVFQASDESKLSQLQNSNFNYCPAEGAISNNLQFFKFNLNNSNENTLNSFIPMSSYNTGPKASSFGHPTPLFLSPMNLSKVLQHDEQQSDSGRGNSDDDIVNLSNNQSSVIYQKSNIKTRNSQTDYQTIQLST 1101          
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Match: SMESG000016762.1 (SMESG000016762.1)

HSP 1 Score: 501.13 bits (1289), Expect = 3.933e-155
Identity = 375/1100 (34.09%), Postives = 579/1100 (52.64%), Query Frame = 2
Query:  218 DILKTLFLFLTAVRCSETGIKECVLKYLIQENEPIDRMVGTIATDI----EGLGINLEFHGSLI-YKLSGPNCCFSIDQKSSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRVRISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQIEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDNKQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPDSTSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFVTDGLYEARSXXXXXXXXXXXXSPQLIQNPSVIEVMENSGKGLVIGQVIVTDKDDSQTNGKMICEHETTEPR-------LEFSLSSGKNKKILTYDIRTKTAFDRE-------KSSQISVVLICSDGWN-TSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHVAENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQGPVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEFSVRENLAP---ATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYITKPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPRGLREIDDATSPAASQSISI--SVYQSPGYVITQLIAVDDDDATNTKLTYHILLPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDEKMFYLFITNKPAKYDDKLQSNNGG-SWVDKNXXXXXXXXXXXXXXXXAMLVTAIICMLKPCYQRNN------------NRYDKNWIKKISSGRTES----MKNAGTIDSNSGALQENLLVNGNSDISSSFLNSCI----ETSIDN---KPFGNIETAIYSDDH--------------LGYISNSSVPRCHGNRMLTGRNTISRLDYG------VCSQCPIMSNYGSPGYATFGH----YIDTSNDEEI--KEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVT 3292
            +IL   FL +      E GI+   L Y IQEN  ++ ++GT++ D+    +   +   F+  L+ Y L   +  F +  K+  L +   ID++ IC+ +     C S    LEL VNLW N +L+AV+ V ++VLDVNDN P F   +I   V+E +HK G  IFL  A D DI+ + ++I YGL+  +  F+L +    +PYL LL D D E   HY   ++AWN   +     L+V + V DFNDN P F SSL  +++ ENTP  S IFQL A D D T+ + + +  +A  ELR +F V  NG V L    LDYE    Y +PV V+DG+Y     L++ +E+ NDE P+ + NPS ++V+E +  GL IGQV + D DD   NGK+IC     EP+       LEF  +  K+ +   Y+I+TK ++DRE       K + I  +LIC+DGW  +S +  LTS+  I+V + D NDN P+F    Y + V EN       ++V+A+D D G N  I +SL  D   F+ID+ +G I+ +   DRE K +Y +++   D G  PL+S+  +NIT+ DVNDN+P L    + ++ EN        +  L YED D   N  V FSK WP D   ++T NG+++     DRET+DR+CL VRL+D+G + +  S+G VCI+++D NDN+P + +P+GL   D+   P ++  I I  S+Y++PGY +  + A DDDD  N  + + +  P  +P ++F     TG L L++ LS   IG + ++++V+D G P L   ++  + I ++P   +   +   GG  W+   +LLVVIILS +S+  I +L+TAI+C+LKPC    N            NRY  N   KI+    +S    MK            +EN+  + +  + SS+ N+ +    +  +DN    P G+    I  D H              L  + NS+   C     ++      + +        + S  P+ S    P  ++FGH    ++   N  ++   ++ QSDSGRG S+DD    +  +  V+ Q S+ K  +++ +   I + T
Sbjct:    6 NILYVSFLIIQICNFCE-GIERFSLTYTIQENTAVETLIGTVSVDLYDRFKTNNLPKIFNNKLVTYSLGTTSTYFHLSAKNGKLFVKSIIDVDEICV-KSSKKICKSDYASLELNVNLWFNEKLIAVINVVVNVLDVNDNQPNFPTTKITIPVNEINHKTGRKIFLPQAIDKDISEKFSKIFYGLSTKNSDFELQVGHPHKPYLKLLKDFDCERLDHYTFLLQAWNHDMSDNRAHLSVTIEVLDFNDNEPNFTSSLLKLVISENTPLNSKIFQLTATDRDKTAQITYYMDSSAPQELRNIFEVKPNGGVWLKDQKLDYETTSSYSIPVLVSDGIYSNTGELKISLENVNDEPPKFLLNPSNLKVVEKNTPGLSIGQVTIIDADDDSVNGKIIC----NEPKSLDGYQDLEFHKTLTKDFQENVYEIKTKRSYDREMLTTSHNKEAYIKAILICNDGWGMSSTSPRLTSTLKISVFVEDLNDNAPQFDLKVYHSSVPENSGPEAKCVQVHAHDKDSGDNAAITFSL-LDNEDFKIDAISGWISAKHTFDRETKNYYLINVVVRDKGDPPLSSTALVNITIKDVNDNAPELKHTMDLNLSENQKVNKLELLAVLSYEDKDEDENGRVTFSKIWPYDSNFLLTSNGSIFYNSVFDRETQDRYCLSVRLQDHGYDKQHYSTGTVCIKILDQNDNEPIIKSPKGLLPADNIFGPTSAPFIPIILSLYETPGYKLVTIEAKDDDDGDNGTVIFSLDTPLGMP-KLFKITPNTGDLLLNQTLSVVDIGMHRVRITVQDLGKPSLFTSQVAVIKIEDRPPSSEILTEPGLGGIYWIGGKNLLVVIILSTLSVILIVILITAILCLLKPCRDIENGNGNTLYSYEGTNRYFSNCANKINVDYFQSSILRMKKFC-----ENPDEENIGYSVDRTLLSSYTNNDMINQPQILLDNYIYHPNGDFPEEICVDQHYQQWPVFQASDESKLSQLQNSNFNYCPAEGAISNNLQFFKFNLNNSNENTLNSFIPMSSYNTGPKASSFGHPTPLFLSPMNLSKVLQHDEQQSDSGRGNSDDDIVNLSNNQSSVIYQKSNIKTRNSQTDYQTIQLST 1092          
The following BLAST results are available for this feature:
BLAST of Protocadherin alpha-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH11X6.061e-6528.66protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH99.681e-6528.32protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11X1.847e-6428.66protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
PCDH92.595e-6428.32protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH11X2.796e-6428.66protocadherin 11 X-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-13.034e-3826.92FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-14.801e-3826.92FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-41.809e-2824.02Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
cdh-18.415e-2624.51CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
hmr-18.062e-2525.50Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds5.066e-4725.99gene:FBgn0284247 transcript:FBtr0078045[more]
ds5.066e-4725.99gene:FBgn0284247 transcript:FBtr0343249[more]
ft8.255e-4726.60gene:FBgn0001075 transcript:FBtr0077478[more]
stan1.845e-4528.77gene:FBgn0024836 transcript:FBtr0304899[more]
stan1.845e-4528.77gene:FBgn0024836 transcript:FBtr0300578[more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh91.942e-6228.25protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.11.956e-6228.04pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh92.129e-6228.04protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh92.129e-6228.04protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh111.664e-6028.11protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa1.598e-6327.86VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
ENSXETT00000047804.12.315e-5726.33protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047801.12.686e-5726.33protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
ENSXETT00000047798.14.030e-5726.36protocadherin 11 X-linked [Source:NCBI gene;Acc:10... [more]
pcdh179.110e-5727.18protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh91.838e-6427.72protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh93.134e-6327.72protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh13.329e-6328.03protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh13.329e-6328.03protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh94.108e-6327.72protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin alpha-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BZA7|PC11X_HUMAN1.467e-6328.66Protocadherin-11 X-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q9HC56|PCDH9_HUMAN2.525e-6328.32Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q6X862|PC11X_GORGO7.038e-6328.54Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WXV7|PC11X_PONPY9.920e-6328.33Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q6WYY1|PC11X_PANPA1.074e-6228.41Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin alpha-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2K5U71.034e-9430.67Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2KYT31.231e-9229.71Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A3R7CGZ31.273e-9129.79Protocadherin Fat 4 OS=Clonorchis sinensis OX=7992... [more]
G4V8S42.556e-9130.31Putative cadherin OS=Schistosoma mansoni OX=6183 G... [more]
A0A3Q0KLK92.805e-9130.31Putative cadherin OS=Schistosoma mansoni OX=6183 P... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh114.195e-6327.89protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh91.249e-6227.63protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh111.289e-6227.89protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh112.145e-6227.63protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
pcdh92.222e-6227.63protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh114.158e-5827.65protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.14.724e-4728.46pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
ENSPMAT00000006996.11.846e-4126.59pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000004043.13.379e-3927.85pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
ENSPMAT00000004042.13.596e-3927.85pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.044e-5329.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404702.053e-5228.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO333598.397e-4926.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348151.003e-4829.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482376.577e-4826.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin alpha-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a9.064e-6027.53protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a2.118e-5927.53protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh98.158e-5927.40protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh91.579e-5827.40protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1b1.921e-5826.02protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
back to top
BLAST of Protocadherin alpha-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059102.10.000e+099.82SMESG000059102.1[more]
SMESG000059102.10.000e+099.81SMESG000059102.1[more]
SMESG000016762.13.460e-15733.70SMESG000016762.1[more]
SMESG000016762.11.140e-15534.15SMESG000016762.1[more]
SMESG000016762.13.933e-15534.09SMESG000016762.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026029 ID=SMED30026029|Name=Protocadherin alpha-2|organism=Schmidtea mediterranea sexual|type=transcript|length=3576bp
TCTTCCGATCTTCTATGACCAATTGTTTTAATTTGCTTTCAATACTAGCT
TTATTGAAATAGGATTTGCATTAGCCAATCATATCGGCAGCACTTGTTAA
ACTCTATAATAAACAAATTATTACTGATTTGCTTATCAACCAATGAGAAC
CATCGAATACACATTCGTAACTGTTTCATATAATTATAAACTGATTTTTC
AACAAAGTGGAAAAATGGATATTTTGAAAACTTTATTTCTATTTCTTACT
GCAGTTCGGTGCTCTGAAACTGGAATTAAGGAATGCGTTTTGAAATATCT
TATTCAGGAAAACGAGCCAATCGACAGAATGGTTGGAACAATTGCCACAG
ACATCGAAGGATTGGGAATCAATTTAGAGTTTCACGGATCATTAATTTAC
AAACTCAGTGGACCTAATTGCTGCTTCAGCATCGATCAAAAGAGCAGTGT
TTTAACAATAGCGAAAAATATCGATTTAGAGTCTATTTGTATAAATCGAG
AACTGTCATCCGATTGTTCGTCGGGCCAAGGACATCTTGAATTGATTGTA
AACTTATGGAGTAATGTCCAGTTATTGGCTGTTGTTCGAGTAAGGATATC
TGTATTGGATGTCAATGATAATATTCCTCAATTTTCAAAACAACGAATCG
AAAGACATGTAAGTGAAGCAAGTCATAAAGCTGGTAGTCATATCTTTTTG
GAAACGGCTACGGATACTGATATAGCCCCAGAAAATGCTCAAATAGAATA
CGGACTTGCCGAACATCACAAATCGTTCCAGTTGTGTCTAGATCAACAGC
GTCAGCCCTATTTGTTTCTCCTAAATGATCTTGATGCGGAAAATCAAACT
CATTATCTGATCAAAATTCGAGCTTGGAATGCTCAAGATAATAAACAGTG
GAACGAATTAAATGTTGATTTATATGTTGACGACTTCAACGATAATCCTC
CTAGATTCAATTCTAGCCTTTTTTCAGTGTTGGTTAAAGAAAACACACCA
GCAAGATCAATGATATTTCAGTTAATCGCTAATGATCCAGATTCCACTTC
GGTTTTGCGATTCGATCTATATCAAACGGCAAATAATGAGCTGCGGAAAT
TGTTCTCAGTTTTACAGAATGGTACTGTTATTCTCATAAGTAGCTGGCTT
GATTATGAGCGGCATCAGAGATATAAAGTGCCTGTTTTCGTTACAGACGG
TTTGTACGAAGCAAGATCAGTACTAGAAGTCCTAGTTGAGGATGAGAATG
ATGAGAGTCCGCAACTGATCCAGAATCCATCGGTTATCGAGGTCATGGAA
AACAGCGGCAAAGGATTAGTCATTGGCCAGGTCATAGTAACTGACAAAGA
CGATTCTCAGACGAATGGAAAAATGATATGTGAACACGAAACCACAGAAC
CACGATTAGAGTTTTCTTTGAGTTCCGGAAAAAATAAAAAGATTCTCACA
TATGATATTCGTACCAAGACTGCTTTTGATCGAGAAAAATCGTCTCAAAT
TTCAGTAGTCCTTATCTGTTCTGACGGTTGGAATACATCTGCGAACATTC
ATTTGACGAGCAGCTTCACAATAAATGTTCAAATACTCGACTTCAATGAC
AACCCACCAAAGTTCAGACAATCTCAATATTTTGCCCATGTAGCGGAGAA
TGGTCCGATCGGAACTGTCATTCTTAAAGTAAACGCATATGATCTCGATG
ACGGGCTCAATGGAAAAATTCACTACTCTCTAGAACATGACTTCTCTCTG
TTTCAAATAGATTCTACCACTGGTGTTATCACCGTTCAAGGTCCGGTAGA
TCGAGAGTTGAAAGAGCACTACAAATTGCATATACATGCAGTTGATAGTG
GTAGTATTCCACTCAACAGTTCAGTGGGACTAAATATAACTGTGGACGAT
GTGAATGATAATAGCCCATGCCTACTGACCCCATTTGAATTTTCTGTGAG
AGAAAATTTGGCTCCCGCTACAATAGGGCAATTACAATATGAGGACAGCG
ATATTGGCAGGAATGCCGATGTTGTATTCAGCAAGACTTGGCCGAATGAT
GACACAGTAATGATTACAGTCAATGGAACTTTATATATCACAAAACCTCT
TGACAGAGAAACTAAAGACCGACACTGCCTACGAGTGAGACTGCGGGATA
ACGGACTGAATGGGCGCCGACAGAGCAGCGGAGAAGTGTGCATTAGAGTG
ATCGACGTTAATGATAACAAACCGAGACTAATAAATCCACGAGGATTGAG
AGAAATTGATGACGCCACATCACCCGCAGCCTCTCAGTCGATATCAATTT
CAGTTTACCAATCTCCCGGATATGTGATAACTCAATTGATAGCAGTTGAT
GACGATGACGCAACAAATACAAAATTAACCTATCACATTCTATTGCCCAA
TACTCTTCCTTCTCAAATATTTTCCTTCAATTCCACAACGGGCTATCTTT
CTTTAGACAAACCGCTTTCTCATCATTATATCGGCCATTATCCAATCAAA
GTTTCAGTCAAAGATTCTGGATCTCCACCGTTGATCGATGAAAAAATGTT
TTACTTGTTTATCACAAATAAGCCTGCTAAATATGATGATAAATTGCAAT
CTAACAACGGAGGGTCATGGGTGGACAAAAACAGTCTTCTTGTTGTGATC
ATTCTTTCGTGCATCAGTCTATCCTTCATCGCAATGCTCGTGACCGCCAT
CATCTGTATGCTAAAGCCATGCTATCAAAGAAATAATAATCGCTATGATA
AAAATTGGATCAAAAAGATTTCATCTGGAAGAACAGAGTCTATGAAAAAC
GCAGGAACCATCGATAGTAATTCTGGAGCACTACAGGAAAATCTATTAGT
AAACGGCAATTCAGATATATCCAGTAGCTTTTTAAATTCTTGCATCGAAA
CCAGCATCGACAACAAACCATTTGGGAATATTGAAACCGCCATATACTCA
GATGATCACCTCGGATATATATCCAATTCCTCAGTGCCCAGATGTCATGG
CAACCGAATGCTGACCGGTAGAAACACGATATCCAGATTGGATTACGGAG
TTTGTTCTCAATGTCCTATCATGAGCAATTATGGGTCTCCTGGATATGCA
ACGTTCGGCCATTATATTGACACTAGCAATGATGAAGAAATAAAAGAAGA
TTTCCAATCAGATAGTGGGAGAGGAGCAAGTGAAGATGATACTAGTCGAA
CAAATGGGATTCGCTTGAAAGTAGTAGGACAAGTATCTTCATTCAAAGAA
AACTCAGCTGAAAAAGAAAACGCAAATATTCCAATGGTAACACTCAGTGG
AAGAATAGATTCTGGTAACAACAGTATCAGCCAGAAAATTTCCCCCACGA
ACAACTACTTACAATCAGGTGTTCTGTGTGATGAGATAAATCAGTTATTC
TTCCATAATTTGATCAAACCATGAGCCTCTTGGTATGGTACATCCTGTAC
ATGTTGAAATCGCCGCCGGCGACAGTTGCAGCTGCCATAGCAAAGCTAAC
GATGAATGTGATAAATATCTATATCTACACATCCATTATCTATCATTGTA
GCTATCACTATTGTTATTGTCGTTAC
back to top

protein sequence of SMED30026029-orf-1

>SMED30026029-orf-1 ID=SMED30026029-orf-1|Name=SMED30026029-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1094bp
MRTIEYTFVTVSYNYKLIFQQSGKMDILKTLFLFLTAVRCSETGIKECVL
KYLIQENEPIDRMVGTIATDIEGLGINLEFHGSLIYKLSGPNCCFSIDQK
SSVLTIAKNIDLESICINRELSSDCSSGQGHLELIVNLWSNVQLLAVVRV
RISVLDVNDNIPQFSKQRIERHVSEASHKAGSHIFLETATDTDIAPENAQ
IEYGLAEHHKSFQLCLDQQRQPYLFLLNDLDAENQTHYLIKIRAWNAQDN
KQWNELNVDLYVDDFNDNPPRFNSSLFSVLVKENTPARSMIFQLIANDPD
STSVLRFDLYQTANNELRKLFSVLQNGTVILISSWLDYERHQRYKVPVFV
TDGLYEARSVLEVLVEDENDESPQLIQNPSVIEVMENSGKGLVIGQVIVT
DKDDSQTNGKMICEHETTEPRLEFSLSSGKNKKILTYDIRTKTAFDREKS
SQISVVLICSDGWNTSANIHLTSSFTINVQILDFNDNPPKFRQSQYFAHV
AENGPIGTVILKVNAYDLDDGLNGKIHYSLEHDFSLFQIDSTTGVITVQG
PVDRELKEHYKLHIHAVDSGSIPLNSSVGLNITVDDVNDNSPCLLTPFEF
SVRENLAPATIGQLQYEDSDIGRNADVVFSKTWPNDDTVMITVNGTLYIT
KPLDRETKDRHCLRVRLRDNGLNGRRQSSGEVCIRVIDVNDNKPRLINPR
GLREIDDATSPAASQSISISVYQSPGYVITQLIAVDDDDATNTKLTYHIL
LPNTLPSQIFSFNSTTGYLSLDKPLSHHYIGHYPIKVSVKDSGSPPLIDE
KMFYLFITNKPAKYDDKLQSNNGGSWVDKNSLLVVIILSCISLSFIAMLV
TAIICMLKPCYQRNNNRYDKNWIKKISSGRTESMKNAGTIDSNSGALQEN
LLVNGNSDISSSFLNSCIETSIDNKPFGNIETAIYSDDHLGYISNSSVPR
CHGNRMLTGRNTISRLDYGVCSQCPIMSNYGSPGYATFGHYIDTSNDEEI
KEDFQSDSGRGASEDDTSRTNGIRLKVVGQVSSFKENSAEKENANIPMVT
LSGRIDSGNNSISQKISPTNNYLQSGVLCDEINQLFFHNLIKP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
GO:0030900forebrain development
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030426growth cone
GO:0044291cell-cell contact zone
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 491..520
score: 41.3
coord: 93..112
score: 22.54
coord: 559..571
score: 37.67
coord: 573..592
score: 43.02
coord: 643..669
score: 30.35
coord: 678..695
score: 42.57
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 732..811
e-value: 1.5E-5
score: 34.5
coord: 397..489
e-value: 1.9E-6
score: 37.4
coord: 294..373
e-value: 3.2E-6
score: 36.7
coord: 513..592
e-value: 1.5E-23
score: 94.2
coord: 66..162
e-value: 0.011
score: 23.7
coord: 614..694
e-value: 6.0E-12
score: 55.7
coord: 187..270
e-value: 0.0053
score: 26.0
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 721..797
e-value: 3.6E-9
score: 37.0
coord: 381..481
e-value: 8.2E-7
score: 29.4
coord: 598..686
e-value: 5.1E-10
score: 39.7
coord: 496..584
e-value: 2.9E-19
score: 69.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 592..692
e-value: 2.5E-17
score: 65.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 693..808
e-value: 3.3E-13
score: 52.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 43..162
e-value: 8.8E-10
score: 40.9
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 372..486
e-value: 4.6E-17
score: 64.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 163..267
e-value: 2.0E-14
score: 56.0
coord: 487..591
e-value: 5.2E-35
score: 122.4
coord: 268..371
e-value: 2.6E-17
score: 65.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1001..1021
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 35..596
coord: 550..920
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 594..696
score: 18.793
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 54..164
score: 13.246
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 188..272
score: 14.649
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 376..491
score: 17.083
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 273..375
score: 18.091
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 492..594
score: 27.978
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 711..797
score: 12.611
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 597..692
e-value: 7.28049E-18
score: 77.7389
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 714..808
e-value: 4.7993E-13
score: 63.8717
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 381..487
e-value: 1.56624E-13
score: 65.4125
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 172..268
e-value: 1.21131E-6
score: 45.7674
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 277..370
e-value: 1.81489E-11
score: 59.6345
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 54..160
e-value: 1.28174E-9
score: 54.2418
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 495..590
e-value: 3.14787E-33
score: 121.652
NoneNo IPR availableTMHMMTMhelixcoord: 835..857
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 684..694
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 582..592
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 260..270
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 152..162
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 479..489
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 152..258
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 369..483
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 67..164
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 266..375
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 689..808
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 479..600
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 582..700