SMED30026028

Overview
NameSMED30026028
Smed IDSMED30026028
Length (bp)1535
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30026028 (SMED30026028) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30026028 (SMED30026028) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30026028 (SMED30026028) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30026028 (SMED30026028) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026028

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026028SMESG000018611.1 SmedASXL_001083SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026028SMESG000018611.1 SmedASXL_005492SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026028SMESG000018611.1 dd_Smed_v6_33317_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30026028 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.014137:3322..17422 -7290
Homology
BLAST of SMED30026028 vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 122.094 bits (305), Expect = 1.186e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  460 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 852          
BLAST of SMED30026028 vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 122.094 bits (305), Expect = 1.222e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  445 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 122.094 bits (305), Expect = 1.300e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  445 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 122.094 bits (305), Expect = 1.340e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  460 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 852          
BLAST of SMED30026028 vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 121.709 bits (304), Expect = 1.486e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  445 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 111.694 bits (278), Expect = 1.126e-25
Identity = 94/387 (24.29%), Postives = 183/387 (47.29%), Query Frame = -2
Query:   92 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFR-PFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNL---NLNFAIVD-EIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLDALLIESTNPTYQAL-----NSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1219
            G   D+L  ++  L F   I +  D  +G++  N   ++G VGEL    A  A  + T +  R E +D++ P M      + +KP+ +   W  F  P +  VW+++ A+ F++S   ++ +K +P   +     N  +  VD +  ++   W  +   + QG +  P   S R++  IWW F LI+ S+YTA+L + LT     + + + D LAA+T +K   + +G+ + +   ES   TY+ +     +S  +++ +     + +  + S+D   + ++S++ Y V + C ++  +    +    G   PK +P+++ I   I  L E   ++   E +WK     S  CE        D  D + + G +I+  + ++L  V+
Sbjct:  424 GYCIDLLHKIANILKFTYTIQKVRDNAYGSKESN-GKWSGMVGELQRGDADLAVASLTISYGRSEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTKIKYGTLGRGSTM-SFFNESKIETYERMWQLMSSSPGLFVQS---SKEGIARVKSSDYAYLMESSMLEYAVERDCELM-QIGGLIDQKGYGIGLPKGSPYRELISTAILRLQEKTELTELKEKWWKDK---SVVCE---QPKRKDQDDGESIGGIFIILVVGLVLTAVL 798          
BLAST of SMED30026028 vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 110.153 bits (274), Expect = 4.112e-25
Identity = 105/416 (25.24%), Postives = 190/416 (45.67%), Query Frame = -2
Query:   98 GNDKYYRIEETFGLVSDILKILSKKL-NFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQT-KMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNF-----AIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQAL-------NSRKIYID--TIDNCPKKMLELSS-TDLVCITDTSVVVY------TVNKY------CSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAG-SNNNSADPIDLDGVLGAYIVTWIFMILAF 1255
            GND++       G   D+L +L+K +  F   ++ +   ++G+R  + S + G +G LLN+ A  A    T T +R+  VD+S P M      +++KP+ Q   ++    P   ++W+ ++++ F +S   ++ S ++P   Y   + F      + +E  +   LW  +  F+ QG D  P  VS RI  + WW F LII S+YTA+L +FLT+      + S++ LA +  +   + +G +  A   +S  P Y+ +         ++I ++  +I N     + +SS  D +    TS   Y      T N Y      C  +  V +  NT   G  T    P +  ++  I  L E G + +    +W     D   C+ G S+  ++  ++L  V G + +    M+L+ 
Sbjct:  445 GNDRFE------GYCIDLLNLLAKNITGFEYDVFISDGNKYGSRQADGS-WDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSP---YEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTM-KVGQNLNTLGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWW----YDRGQCDTGTSDGGTSSSLNLSKVAGIFYILLAGMVLSM 845          
BLAST of SMED30026028 vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 109.768 bits (273), Expect = 5.595e-25
Identity = 105/415 (25.30%), Postives = 190/415 (45.78%), Query Frame = -2
Query:  101 GNDKYYRIEETFGLVSDILKILSKKL-NFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQT-KMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNF-----AIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQAL-------NSRKIYID--TIDNCPKKMLELSS-TDLVCITDTSVVVY------TVNKY------CSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAG-SNNNSADPIDLDGVLGAYIVTWIFMILA 1255
            GND++       G   D+L +L+K +  F   ++ +   ++G+R  + S + G +G LLN+ A  A    T T +R+  VD+S P M      +++KP+ Q   ++    P   ++W+ ++++ F +S   ++ S ++P   Y   + F      + +E  +   LW  +  F+ QG D  P  VS RI  + WW F LII S+YTA+L +FLT+      + S++ LA +  +   + +G +  A   +S  P Y+ +         ++I ++  +I N     + +SS  D +    TS   Y      T N Y      C  +  V +  NT   G  T    P +  ++  I  L E G + +    +W     D   C+ G S+  ++  ++L  V G + +    M+L+
Sbjct:  514 GNDRFE------GYCIDLLNLLAKNITGFEYDVFISDGNKYGSRQADGS-WDGMIGYLLNETADVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSP---YEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQSITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLEETTNNYESGRRPCDTM-KVGQNLNTLGYGIATKIGNPLRVSLNLAILYLSEKGELKKLENKWW----YDRGQCDTGTSDGGTSSSLNLSKVAGIFYILLAGMVLS 913          
BLAST of SMED30026028 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 106.686 bits (265), Expect = 4.573e-24
Identity = 95/428 (22.20%), Postives = 194/428 (45.33%), Query Frame = -2
Query:   92 LH*RIT-----PAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQT---KMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNL----NFAIV----DEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLDALLIESTNPTYQAL------NSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNC-----EAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1291
            LH R+      P +I  G ++Y       G   D+L  +++ L F   I E  D  +G     +  + G +G L   +A  +  A T T  R E VD++ P M      +L +   +T    +W    P + +VW+  + +  ++SY  ++ +K++P   YNL      +F  +    ++  +    W  +G  + QG D  P   + R++  +WW+F  II S+YTA L +FLTV   ++ + S   LA +  ++  V+  G+ +D    ES  P Y+ +      +S  +++++     + +  + S     + ++S++ Y + + C  + ++    ++   G   PK +P +  + + +  L E  I+      +W+ ++ +  +C     E  +N+   +      + G + V    +I+AF++
Sbjct:  408 LHLRVVVYLEEPFVIKTGENQYE------GFCIDLLNEMTQVLKFNYTIIEVQDGTYGIE-DESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMD-FFRESKIPMYERMWSVMESSSPGVFVNS---SREGIARVKSGGYAYMMESSMLEYYLERDCE-LQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWR-DRREGPSCGPPPSEKATNSKPQN------IFGIFYVLLTGLIVAFLL 816          
BLAST of SMED30026028 vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 106.301 bits (264), Expect = 7.224e-24
Identity = 95/428 (22.20%), Postives = 194/428 (45.33%), Query Frame = -2
Query:   92 LH*RIT-----PAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQT---KMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNL----NFAIV----DEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLDALLIESTNPTYQAL------NSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNC-----EAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1291
            LH R+      P +I  G ++Y       G   D+L  +++ L F   I E  D  +G     +  + G +G L   +A  +  A T T  R E VD++ P M      +L +   +T    +W    P + +VW+  + +  ++SY  ++ +K++P   YNL      +F  +    ++  +    W  +G  + QG D  P   + R++  +WW+F  II S+YTA L +FLTV   ++ + S   LA +  ++  V+  G+ +D    ES  P Y+ +      +S  +++++     + +  + S     + ++S++ Y + + C  + ++    ++   G   PK +P +  + + +  L E  I+      +W+ ++ +  +C     E  +N+   +      + G + V    +I+AF++
Sbjct:  408 LHLRVVVYLEEPFVIKTGENQYE------GFCIDLLNEMTQVLKFNYTIIEVQDGTYGIE-DESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMD-FFRESKIPMYERMWSVMESSSPGVFVNS---SREGIARVKSGGYAYMMESSMLEYYLERDCE-LQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWR-DRREGPSCGPPPSEKATNSKPQN------IFGIFYVLLTGLIVAFLL 816          
BLAST of SMED30026028 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 140.584 bits (353), Expect = 4.951e-35
Identity = 106/387 (27.39%), Postives = 191/387 (49.35%), Query Frame = -2
Query:   92 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQ-TKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVD----EIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1219
            G   D+LK ++ ++ F+  I   PD  +G  I  T+++ G V EL+ ++A  A  + T    R+  +D++ P M      + + P +Q T+++    P    +WL  +A   L+S+  +V ++++P    N +  +   D    +  I    W   G F+ QG    P   S RIV   W+ FCLII S+YTA+L +FLTV    S + S   LA +T++     +G +      +S    YQ     + +RK  +++ T ++  K+++E S   L+   +++++ Y V + C++   +    ++   G  TPK +P++ KI   I  L E GII    + +WK N  D  N +  S  + A+ + ++ + G ++V    + LA VV
Sbjct:  454 GFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLM---ESTMLDYAVQRDCNLT-QIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWK-NTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVV 835          
BLAST of SMED30026028 vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 140.584 bits (353), Expect = 4.951e-35
Identity = 106/387 (27.39%), Postives = 191/387 (49.35%), Query Frame = -2
Query:   92 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQ-TKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVD----EIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1219
            G   D+LK ++ ++ F+  I   PD  +G  I  T+++ G V EL+ ++A  A  + T    R+  +D++ P M      + + P +Q T+++    P    +WL  +A   L+S+  +V ++++P    N +  +   D    +  I    W   G F+ QG    P   S RIV   W+ FCLII S+YTA+L +FLTV    S + S   LA +T++     +G +      +S    YQ     + +RK  +++ T ++  K+++E S   L+   +++++ Y V + C++   +    ++   G  TPK +P++ KI   I  L E GII    + +WK N  D  N +  S  + A+ + ++ + G ++V    + LA VV
Sbjct:  454 GFCIDLLKAIATQVGFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIGILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLM---ESTMLDYAVQRDCNLT-QIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGIIQILYDKWWK-NTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVV 835          
BLAST of SMED30026028 vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 135.961 bits (341), Expect = 1.493e-33
Identity = 109/412 (26.46%), Postives = 188/412 (45.63%), Query Frame = -2
Query:   92 SRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKP-KTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLS--AYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPK-KMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQ-NCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1300
            S P   R   A+   GND++       G   D++  +SK L F   I   PD  +G+    T  + G + ELL ++A  A    T T +R++ VD++ P M      + +KP K    ++    P +  VW+        +S   ++ +K+ P    AY       +  +  +   +W AIG  + QG DF P  +S R+V  IWW F LI+ S+YTA+L +FLTV   +S + S + LA +T +K    KG +  A   +S   TYQ     + S +  + T  N    + +         + +++ + Y   + C +   V    +T   G  TP ++P++  I+ +I  L E G +      +WK  +   +   E   ++++A+ + L  V G ++V    M +A V+
Sbjct:  425 SNPYCMRKESAIPLSGNDQFE------GYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELT-QVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVI 829          
BLAST of SMED30026028 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 135.191 bits (339), Expect = 3.067e-33
Identity = 101/401 (25.19%), Postives = 206/401 (51.37%), Query Frame = -2
Query:   92 FPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQ-TKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNL----NFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLDAL---LIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1261
            F GN+++Y      G   DIL+ +S+++ F  ++   PD+++GA+   T  + G V +L+  KA  A G+ T T  R+  +D++ P M      + + P ++ T+++    P    +W+  +   FL+S   Y+  K +P+    +N     N +I ++  + +  W  IG F+ Q  D YP  +S RI+ + W  F LII ++YTA+L +FLT     + + + + LA++T++    +  G+ +      +IE+    +++++++K   +  T ++  K+   ++  +   + +++++ Y V + C++   +    +T   G  TPK +P++ KI   I  L E G I    + +WK N  ++   +  S  + A+ + L+ + G ++V    +I+A VV
Sbjct:  424 FTGNERFY------GFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKR---VNQGNYAFLMESTMLDYIVQRDCNLT-QIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWK-NTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVV 813          
BLAST of SMED30026028 vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 130.568 bits (327), Expect = 9.862e-32
Identity = 101/401 (25.19%), Postives = 206/401 (51.37%), Query Frame = -2
Query:   92 FPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQ-TKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNL----NFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLDAL---LIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1261
            F GN+++Y      G   DIL+ +S+++ F  ++   PD+++GA+   T  + G V +L+ K A  A G+ T T  R+  +D++ P M      + + P ++ T+++    P    +W+  +   FL+S   Y+  K +P+    +N     N +I ++  + +  W  IG F+ Q  D YP  +S RI+ + W  F LII ++YTA+L +FLT     + + + + LA++T++    +  G+ +      +IE+    +++++++K   +  T ++  K+   ++  +   + +++++ Y V + C++   +    +T   G  TPK +P++ KI   I  L E G I    + +WK N  ++   +  S  + A+ + L+ + G ++V    +I+A VV
Sbjct:  424 FTGNERFY------GFCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLM-KYADLAVGSMTITYARESVIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKR---VNQGNYAFLMESTMLDYIVQRDCNLT-QIGGLLDTKGYGIATPKGSPWRDKISLAILELQERGDIQMLYDKWWK-NTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVV 812          
BLAST of SMED30026028 vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 118.242 bits (295), Expect = 1.499e-27
Identity = 99/406 (24.38%), Postives = 194/406 (47.78%), Query Frame = -2
Query:   92 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1273
            P ++F  +DK     + F G   D+L+ L+  L F   +    D ++GA+  ++  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +I+   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +       N  A  + +  + G +IV    ++L+  V
Sbjct:  442 PYVMFKKSDKPLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------ENKEASALGVQNIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Zebrafish
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:556013])

HSP 1 Score: 118.242 bits (295), Expect = 1.499e-27
Identity = 99/406 (24.38%), Postives = 194/406 (47.78%), Query Frame = -2
Query:   92 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1273
            P ++F  +DK     + F G   D+L+ L+  L F   +    D ++GA+  ++  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +I+   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +       N  A  + +  + G +IV    ++L+  V
Sbjct:  442 PYVMFKKSDKPLYGNDRFEGYCVDLLRELAAILGFGYELRLVEDGRYGAQDESSGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSIEEGIERVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------ENKEASALGVQNIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 117.472 bits (293), Expect = 2.841e-27
Identity = 99/406 (24.38%), Postives = 184/406 (45.32%), Query Frame = -2
Query:   92 IFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKP-KTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAI--------VDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNS------RKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1264
            ++ GN++Y       G   D+   ++K + F+  I   PD ++GAR   T  + G VGEL+  KA  A    T T  R+E +D+S P M      +++KP K++  ++    P  + +W+  +     +S   ++ S+++P   +                 +E  I   LW ++G F+ QG D  P ++S RIV  +WW F LII S+YTA+L +FLTV    S + S + LA +TD+        +       S    Y+ + S        ++  T      ++ + S      + ++++  YT  +       V    ++   G  TPK +  +  ++  +  L E+GI+ +    +W  ++ +    ++GS + S+  + L  V G + +    + LA +V
Sbjct:  436 MYEGNEQYE------GYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRK-SKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRTPVNLAVLKLSESGILDKLKNKWW-YDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLV 833          
BLAST of SMED30026028 vs. Ensembl Zebrafish
Match: grid2 (glutamate receptor, ionotropic, delta 2 [Source:NCBI gene;Acc:448841])

HSP 1 Score: 115.546 bits (288), Expect = 1.035e-26
Identity = 98/391 (25.06%), Postives = 176/391 (45.01%), Query Frame = -2
Query:   92 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIEST----------NPTY----QALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVY-TVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1219
            G   D+L  L+  L F+  IY APD ++G++  + + + G +GEL+ K+A     A T T +R+  VD++   M+ S   +L+K +    M+    PF+ S+W     T+ L+    Y+ +  NP       L    V    +   +W   G FV QG +    T++ R+++ +WWLF LI+ S+YTA+L +FLT+S   + + SL  LA +TDL    P GT LD+ + +            +P Y    + +N      + ++   + + ++       + D +V+ Y  +N     +YTV         G      +P++    Q I  L + G +   ++  W    S            S   +D+    G + V    ++L+ ++
Sbjct:  469 GFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGT-WNGLIGELVFKRADVGLSALTITPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPP-----RLPMGSVSSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDLAKQTDL----PYGTVLDSAVYDQVRSKGMNPFERDPMYSQMWRMINRTGGAENNVEESKEGIRKVKYGRFAFVWDAAVLEYVAINDEDCSLYTVSNNVADRGYGMAMQHGSPYRDIFSQRILELQQNGDMD-ILKLKWWPRDSPCDLYSPVGTRKSGSALDIHSFAGVFFVLAAGVVLSCLI 848          
BLAST of SMED30026028 vs. Ensembl Zebrafish
Match: grid2 (glutamate receptor, ionotropic, delta 2 [Source:NCBI gene;Acc:448841])

HSP 1 Score: 115.546 bits (288), Expect = 1.055e-26
Identity = 98/391 (25.06%), Postives = 176/391 (45.01%), Query Frame = -2
Query:   92 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIEST----------NPTY----QALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVY-TVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1219
            G   D+L  L+  L F+  IY APD ++G++  + + + G +GEL+ K+A     A T T +R+  VD++   M+ S   +L+K +    M+    PF+ S+W     T+ L+    Y+ +  NP       L    V    +   +W   G FV QG +    T++ R+++ +WWLF LI+ S+YTA+L +FLT+S   + + SL  LA +TDL    P GT LD+ + +            +P Y    + +N      + ++   + + ++       + D +V+ Y  +N     +YTV         G      +P++    Q I  L + G +   ++  W    S            S   +D+    G + V    ++L+ ++
Sbjct:  388 GFSIDVLDALANYLGFKYEIYVAPDHKYGSQQADGT-WNGLIGELVFKRADVGLSALTITPERESVVDFTTRYMDYSVGVLLRKAERTVDMFACLAPFDLSLWACIAGTVLLVGTLVYLLNWLNPP-----RLPMGSVSSTTLYNSMWFVYGSFVQQGGEVPYTTLATRMMMGVWWLFALIVISSYTANLAAFLTISRIENSIQSLQDLAKQTDL----PYGTVLDSAVYDQVRSKGMNPFERDPMYSQMWRMINRTGGAENNVEESKEGIRKVKYGRFAFVWDAAVLEYVAINDEDCSLYTVSNNVADRGYGMAMQHGSPYRDIFSQRILELQQNGDMD-ILKLKWWPRDSPCDLYSPVGTRKSGSALDIHSFAGVFFVLAAGVVLSCLI 767          
BLAST of SMED30026028 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 124.02 bits (310), Expect = 2.304e-29
Identity = 102/401 (25.44%), Postives = 185/401 (46.13%), Query Frame = -2
Query:  101 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1273
            P ++F  +DK    +  F G   D+L+ LSK L F   +    D ++GA+   T  + G V EL++ KA  A      T  R++ +D++ P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +         +S  PTY+     +NSR   +  + N  + +  + ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G++    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  382 PYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSV-LVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 768          
BLAST of SMED30026028 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 124.02 bits (310), Expect = 2.363e-29
Identity = 102/401 (25.44%), Postives = 185/401 (46.13%), Query Frame = -2
Query:  101 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1273
            P ++F  +DK    +  F G   D+L+ LSK L F   +    D ++GA+   T  + G V EL++ KA  A      T  R++ +D++ P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +         +S  PTY+     +NSR   +  + N  + +  + ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G++    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  420 PYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSV-LVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 806          
BLAST of SMED30026028 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 124.02 bits (310), Expect = 2.573e-29
Identity = 102/401 (25.44%), Postives = 185/401 (46.13%), Query Frame = -2
Query:  101 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1273
            P ++F  +DK    +  F G   D+L+ LSK L F   +    D ++GA+   T  + G V EL++ KA  A      T  R++ +D++ P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +         +S  PTY+     +NSR   +  + N  + +  + ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G++    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  404 PYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSV-LVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 790          
BLAST of SMED30026028 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 124.02 bits (310), Expect = 2.659e-29
Identity = 102/401 (25.44%), Postives = 185/401 (46.13%), Query Frame = -2
Query:  101 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1273
            P ++F  +DK    +  F G   D+L+ LSK L F   +    D ++GA+   T  + G V EL++ KA  A      T  R++ +D++ P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +         +S  PTY+     +NSR   +  + N  + +  + ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G++    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  442 PYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSV-LVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 828          
BLAST of SMED30026028 vs. Ensembl Xenopus
Match: GRIK2 (glutamate receptor, ionotropic, kainate 2 [Source:NCBI gene;Acc:100495093])

HSP 1 Score: 123.635 bits (309), Expect = 3.024e-29
Identity = 102/401 (25.44%), Postives = 185/401 (46.13%), Query Frame = -2
Query:  101 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1273
            P ++F  +DK    +  F G   D+L+ LSK L F   +    D ++GA+   T  + G V EL++ KA  A      T  R++ +D++ P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +         +S  PTY+     +NSR   +  + N  + +  + ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G++    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  420 PYVMFKKSDKPLYGKARFEGYCIDLLEKLSKILGFEYEVRLVEDGKYGAKDDTTQQWNGMVRELMDHKADLAVAPLAITYVREQVIDFTKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVQDGATMTFFKKSRIPTYEKMWAFMNSRSQSV-LVKNNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGVLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 806          
BLAST of SMED30026028 vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 120.168 bits (300), Expect = 3.031e-28
Identity = 104/417 (24.94%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    ++ +       A  + ++ + G +IV    ++L+  V
Sbjct:  374 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFLYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSK------EASALGVENIGGIFIVLAAGLVLSVFV 766          
BLAST of SMED30026028 vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 120.168 bits (300), Expect = 3.237e-28
Identity = 104/417 (24.94%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    ++ +       A  + ++ + G +IV    ++L+  V
Sbjct:  460 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFLYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSK------EASALGVENIGGIFIVLAAGLVLSVFV 852          
BLAST of SMED30026028 vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 120.168 bits (300), Expect = 3.585e-28
Identity = 104/417 (24.94%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    ++ +       A  + ++ + G +IV    ++L+  V
Sbjct:  445 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFLYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSK------EASALGVENIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 120.168 bits (300), Expect = 3.644e-28
Identity = 104/417 (24.94%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    ++ +       A  + ++ + G +IV    ++L+  V
Sbjct:  445 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFLYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSK------EASALGVENIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 120.168 bits (300), Expect = 4.015e-28
Identity = 104/417 (24.94%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    ++ +       A  + ++ + G +IV    ++L+  V
Sbjct:  445 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFLYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEDSK------EASALGVENIGGIFIVLAAGLVLSVFV 837          
BLAST of SMED30026028 vs. UniProt/SwissProt
Match: sp|P39086|GRIK1_HUMAN (Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 6.435e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  460 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 852          
BLAST of SMED30026028 vs. UniProt/SwissProt
Match: sp|Q38PU4|GRIK1_MACFA (Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis OX=9541 GN=GRIK1 PE=2 SV=1)

HSP 1 Score: 121.709 bits (304), Expect = 7.047e-28
Identity = 105/417 (25.18%), Postives = 190/417 (45.56%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQ---ALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+  +PL+          GND++       G   D+LK LS  L F   +   PD ++GA+  +   + G V EL++ +A  A    T T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V +++ P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++    +  +      +S   TY+   A  S +     + N  + +  + +TD   + +++ + Y   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +      +N  A  + ++ + G +IV    ++L+  V
Sbjct:  460 VMYRKSDKPLY----------GNDRFE------GYCLDLLKELSNILGFIYDVKLVPDGKYGAQ-NDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLT-QIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DNKEASALGVENIGGIFIVLAAGLVLSVFV 852          
BLAST of SMED30026028 vs. UniProt/SwissProt
Match: sp|Q62640|GRID1_RAT (Glutamate receptor ionotropic, delta-1 OS=Rattus norvegicus OX=10116 GN=Grid1 PE=1 SV=1)

HSP 1 Score: 120.553 bits (301), Expect = 2.355e-27
Identity = 99/360 (27.50%), Postives = 176/360 (48.89%), Query Frame = -2
Query:  224 GNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIE-----STNPTYQALNSRKIYI-----DTIDNC----PKKMLELSSTDLVCITDTSVVVYTV--NKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYW 1255
            G  K Y+     G   D+L  L+K L F+  IY+APD ++G ++ NTS + G +GEL++K+A  A  A T T +R+  VD+S   M+ S   +++KP+ +  ++ +F PF+++VW    A I ++    +V ++   + + +            +   +W   G FV QG +    +V+ RIV+  WWLF LI+ S+YTA+L +FLTVS  +S + +   L+ + ++      GT  D+ + E      TNP  Q     +++         DNC     + + +    +   + D +VV Y    +  CSV   +  + ++   G      +P++    Q I  L +TG +    + +W
Sbjct:  458 GQPKRYK-----GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS-WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDSPVRTFQDLSKQLEMSY----GTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVT-VIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of SMED30026028 vs. UniProt/SwissProt
Match: sp|Q9ULK0|GRID1_HUMAN (Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1 PE=2 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 2.650e-27
Identity = 98/360 (27.22%), Postives = 176/360 (48.89%), Query Frame = -2
Query:  224 GNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIE-----STNPTYQALNSRKIYI-----DTIDNC----PKKMLELSSTDLVCITDTSVVVYTV--NKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYW 1255
            G  K Y+     G   D+L  L+K L F+  IY+APD ++G ++ NTS + G +GEL++K+A  A  A T T +R+  VD+S   M+ S   +++KP+ +  ++ +F PF+++VW    A I ++    +V ++   + A +            +   +W   G FV QG +    +++ RIV+  WWLF LI+ S+YTA+L +FLTVS  ++ + +   L+ + ++      GT  D+ + E      TNP  Q     +++         DNC     + + +    +   + D +VV Y    +  CSV   +  + ++   G      +P++    Q I  L +TG +    + +W
Sbjct:  458 GQPKRYK-----GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS-WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRAQSAAQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQVEMSY----GTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSSPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVT-VIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of SMED30026028 vs. UniProt/SwissProt
Match: sp|Q61627|GRID1_MOUSE (Glutamate receptor ionotropic, delta-1 OS=Mus musculus OX=10090 GN=Grid1 PE=1 SV=2)

HSP 1 Score: 119.783 bits (299), Expect = 3.446e-27
Identity = 98/360 (27.22%), Postives = 176/360 (48.89%), Query Frame = -2
Query:  224 GNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIE-----STNPTYQALNSRKIYI-----DTIDNC----PKKMLELSSTDLVCITDTSVVVYTV--NKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYW 1255
            G  K Y+     G   D+L  L+K L F+  IY+APD ++G ++ NTS + G +GEL++K+A  A  A T T +R+  VD+S   M+ S   +++KP+ +  ++ +F PF+++VW    A I ++    +V ++   + + +            +   +W   G FV QG +    +V+ RIV+  WWLF LI+ S+YTA+L +FLTVS  ++ + +   L+ + ++      GT  D+ + E      TNP  Q     +++         DNC     + + +    +   + D +VV Y    +  CSV   +  + ++   G      +P++    Q I  L +TG +    + +W
Sbjct:  458 GQPKRYK-----GFSIDVLDALAKALGFKYEIYQAPDGRYGHQLHNTS-WNGMIGELISKRADLAISAITITPERESVVDFSKRYMDYSVGILIKKPEEKISIFSLFAPFDFAVWACIAAAIPVVGVLIFVLNRIQAVRSQSATQPRPSASAT-LHSAIWIVYGAFVQQGGESSVNSVAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMDNPIRTFQDLSKQLEMSY----GTVRDSAVYEYFRAKGTNPLEQDSTFAELWRTISKNGGADNCVSNPSEGIRKAKKGNYAFLWDVAVVEYAALTDDDCSVT-VIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWW 805          
BLAST of SMED30026028 vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 9.530e-79
Identity = 138/369 (37.40%), Postives = 221/369 (59.89%), Query Frame = -2
Query:  113 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIF 1219
            G++ D+L IL+ +L+FR  +    D Q+G      S F+GCVGE+     +     FT T+ R   VD+S P+ +E+N  ++ +P  ++K+W+++ PF + VW+L I  IF+ +   +V + ++P SAYNL L FAI DEI+++E++W+ +G F+ QGQDFYP+ +S R VLA WW+F +II+  YT DLT+ LT+S  +  + +L  L A++ +K ++P+GTNLD LL  ST   Y+ +  + +  DT+  C ++  +       C+TD + ++Y     CS +Y   E FNTA + F+ P+DA F   ID   Q + ETGI+ +    YW ++      C +GS+   AD I+L+G  G +IV   F
Sbjct:  183 GMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQGKE---ACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYWSSDAV----CSSGSSTE-ADSINLEGSGGCFIVALAF 543          
BLAST of SMED30026028 vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 265.774 bits (678), Expect = 1.464e-76
Identity = 137/369 (37.13%), Postives = 221/369 (59.89%), Query Frame = -2
Query:  113 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIF 1219
            G++ D+L IL+ +L+FR  +    D Q+G      S F+GCVGE+     +     FT T+ R   VD+S P+ +E+N  ++ +P  ++K+W+++ PF + VW+L I  IF+ +   +V + ++P +AYNL L FAI DEI+++E++W+ +G F+ QGQDFYP+ +S R VLA WW+F +II+  YT DLT+ LT+S  +  + +L  L A++ +K ++P+GTNLD LL  ST   Y+ +  + +  DT+  C ++  +       C+TD + ++Y     CS +Y   E FNTA + F+ P+DA F   ID   Q + ETGI+ +    YW ++      C +GS+   AD I+L+G  G +IV   F
Sbjct:  381 GMLKDVLDILAARLDFRYSVKVPDDGQWGGPQAGKSYFSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFTAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQGKE---ACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYWSSDAV----CSSGSSTE-ADSINLEGSGGCFIVALAF 741          
BLAST of SMED30026028 vs. TrEMBL
Match: A0A1I8J047 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 8.434e-76
Identity = 137/366 (37.43%), Postives = 216/366 (59.02%), Query Frame = -2
Query:  122 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVT 1219
            G+  D+L IL+ KL FR    ++ D  +GA + N   F GCVGEL     T AAG FT T+ R   +DYS P+ +ESN  +L +P   +KMW+++ PFN+ VW+  I  +F+ S+  ++ + ++P +AYNL   +AI DE++ +E++W+ +G F+ QGQDFYP+ +S R +LA WW+F +II+ AYT DLT+ LTV+  +  + +L  L ++T +K  +P GTNL  L  ES +  Y+ +    + +   D CP  ++     +  C+ D + ++    K C+  Y   ETFNTA + F+ P DA F +  D  +Q L+ETG++ R  + YW ++      C  G  +  A+ I+  GV G +IVT
Sbjct:   34 GMTFDLLNILASKLEFRFYTKDSDDGNWGAPVPNQPYFNGCVGELQRGLVTIAAGPFTRTTTRDSVIDYSTPLFQESNGILLPRPPPASKMWNVYLPFNYDVWISVIVLLFICSFITWILAYFSPFTAYNLKEEYAIADEVWFQEYVWSVVGSFLQQGQDFYPFAMSPRTILAFWWMFTVIIYGAYTGDLTAHLTVTITDYPIKTLSDLVSQTAIKPYVPAGTNLYTLFKESNSGVYKQVADVMVDLGPYDYCPDSVVR---QERACLNDYTYLLAIAMKNCTQYYLAEETFNTATVAFMYPDDAYFAEYFDFYMQKLLETGLMQRLFKIYWSSDIV----CTVG-KSTEANSINFKGVEGCFIVT 391          
BLAST of SMED30026028 vs. TrEMBL
Match: A0A1I8J1L9 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 251.521 bits (641), Expect = 4.399e-75
Identity = 133/364 (36.54%), Postives = 218/364 (59.89%), Query Frame = -2
Query:  113 ILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIF 1204
            IL+  S +L+FR L  ++ D  +G+   N++ F GCVGEL   + + AAG FT T+ R E +D+S P+ EESN  +L +P  ++K+W +F PF  SVWL  +A +F+ ++  +V + ++P +AYNLNL FAI DE++++E+LW+AIG F+ QGQDFYP+ +S+R  +A WWL  +II  A+  DLT+ LTV+  +  + +LD L  +T+++  +  GT+L  LL+ + +  Y+ +    + +   D+CP    +  + +  C+TD + ++    K C+  Y   E F TAP+  + P DA + +  +  +Q L ETG + RW + YW ++      C  GS+  + D I L+   G +I T  F
Sbjct:    5 ILEYFSTQLDFRFLTKDSTDGNWGSPEVNSTYFNGCVGELQRGEVSVAAGPFTITAARDEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPT---DPPNPNQACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFYAELFNFHMQKLHETGQLQRWFQLYWSSDSV----CSVGSSAET-DAISLESAGGCFIATLCF 360          
BLAST of SMED30026028 vs. TrEMBL
Match: A0A1I8HJW1 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 4.922e-72
Identity = 137/366 (37.43%), Postives = 216/366 (59.02%), Query Frame = -2
Query:  122 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVT 1219
            G+  D+L IL+ KL FR    ++ D  +GA + N   F GCVGEL     T AAG FT T+ R   +DYS P+ +ESN  +L +P   +KMW+++ PFN+ VW+  I  +F+ S+  ++ + ++P +AYNL   +AI DE++ +E++W+ +G F+ QGQDFYP+ +S R +LA WW+F +II+ AYT DLT+ LTV+  +  + +L  L ++T +K  +P GTNL  L  ES +  Y+ +    + +   D CP  ++     +  C+ D + ++    K C+  Y   ETFNTA + F+ P DA F +  D  +Q L+ETG++ R  + YW ++      C  G  +  A+ I+  GV G +IVT
Sbjct:  428 GMTFDLLNILASKLEFRFYTKDSDDGNWGAPVPNQPYFNGCVGELQRGLVTIAAGPFTRTTTRDSVIDYSTPLFQESNGILLPRPPPASKMWNVYLPFNYDVWISVIVLLFICSFITWILAYFSPFTAYNLKEEYAIADEVWFQEYVWSVVGSFLQQGQDFYPFAMSPRTILAFWWMFTVIIYGAYTGDLTAHLTVTITDYPIKTLSDLVSQTAIKPYVPAGTNLYTLFKESNSGVYKQVADVMVDLGPYDYCPDSVVR---QERACLNDYTYLLAIAMKNCTQYYLAEETFNTATVAFMYPDDAYFAEYFDFYMQKLLETGLMQRLFKIYWSSDIV----CTVG-KSTEANSINFKGVEGCFIVT 785          
BLAST of SMED30026028 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 121.324 bits (303), Expect = 1.180e-28
Identity = 101/417 (24.22%), Postives = 194/417 (46.52%), Query Frame = -2
Query:  101 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1318
            V  ++  +PLH          GND++       G   D+L+ L+  L F   +    D ++GA+  +T  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +++   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  445 VMFKKSDKPLH----------GNDRFE------GFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 829          
BLAST of SMED30026028 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 121.324 bits (303), Expect = 1.214e-28
Identity = 101/417 (24.22%), Postives = 194/417 (46.52%), Query Frame = -2
Query:  101 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1318
            V  ++  +PLH          GND++       G   D+L+ L+  L F   +    D ++GA+  +T  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +++   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  413 VMFKKSDKPLH----------GNDRFE------GFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 797          
BLAST of SMED30026028 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 121.324 bits (303), Expect = 1.321e-28
Identity = 101/417 (24.22%), Postives = 194/417 (46.52%), Query Frame = -2
Query:  101 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1318
            V  ++  +PLH          GND++       G   D+L+ L+  L F   +    D ++GA+  +T  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +++   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  445 VMFKKSDKPLH----------GNDRFE------GFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 829          
BLAST of SMED30026028 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 120.939 bits (302), Expect = 1.404e-28
Identity = 101/417 (24.22%), Postives = 194/417 (46.52%), Query Frame = -2
Query:  101 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1318
            V  ++  +PLH          GND++       G   D+L+ L+  L F   +    D ++GA+  +T  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +++   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  445 VMFKKSDKPLH----------GNDRFE------GFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 829          
BLAST of SMED30026028 vs. Ensembl Cavefish
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:103047375])

HSP 1 Score: 120.939 bits (302), Expect = 1.463e-28
Identity = 101/417 (24.22%), Postives = 194/417 (46.52%), Query Frame = -2
Query:  101 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILA 1318
            V  ++  +PLH          GND++       G   D+L+ L+  L F   +    D ++GA+  +T  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + +++   +++L   ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +  S             LG   +  IF++LA
Sbjct:  445 VMFKKSDKPLH----------GNDRFE------GFCIDLLRELASILGFVYEVRLVEDGKYGAQEESTGQWNGLVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGVVEDGSTMTFFKKTKISTYDKMWEFMSSRRHSVMVKSVEEGIQRVL---TSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEAS------------ALGVQNIGGIFIVLA 829          
BLAST of SMED30026028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 8.364e-23
Identity = 78/312 (25.00%), Postives = 147/312 (47.12%), Query Frame = -2
Query:  125 RQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQA----LNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIV 1033
            R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S +SS D LA +T ++    +  +      +S   TY+     ++SR+  +  I N  + +  + +TD   + +++ + Y   + C++   +    +    G  TP  +P++ KI   I  L E G +    E +W+ N    +      ++N A  + +  + G +IV
Sbjct:   23 REKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTAL--IKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLT-QIGGLIDNKGYGIGTPLGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------DSNEASALGVQNIGGIFIV 325          
BLAST of SMED30026028 vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 94.3597 bits (233), Expect = 7.068e-21
Identity = 97/429 (22.61%), Postives = 174/429 (40.56%), Query Frame = -2
Query:   92 FPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKP-KTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLS------------------------------AYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQAL------NSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNN--NSADPIDLDGVLGAYIVTWIFMILAFVV 1261
            F GNDKY       G   D+ + ++    F       PD  +GAR  +T  + G VGEL+  +A  A    T +  R+E +D+S P M      +++KP K++  +     P  + +W+  I     +S   ++ S+++P                                           +E  I   LW ++G F+ QG +  P ++S RIV  +WW F LII S+YTA+L +FLTV    S + S D LA +T++        +       S    Y+ +         K+++ T  +   ++ + S      + +++   YT  +       V    ++   G  TPK +  +  ++  +  L E G++ +    +W     D   C +G  +  +    + L  V G + +    + LA +V
Sbjct:   53 FEGNDKYE------GYCVDLGQEIAIHEQFEYKWSVVPDGAYGARNPDTKVWNGMVGELVYGRADIAIAPLTISLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYEWQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEIAYGTLDSGSTKEFFQRSKIGVYEKMWLFMKDAEPKVFVRTNADGVSRVRK-SKGKYAYLLESTTNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSALRDAVNLAVLKLNEQGLLDKLKNKWW----YDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLV 470          
BLAST of SMED30026028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000621.1 (pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 gene:ENSPMAG00000000562.1 transcript:ENSPMAT00000000621.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 4.817e-17
Identity = 58/202 (28.71%), Postives = 94/202 (46.53%), Query Frame = -2
Query:  626 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVW----LLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSE 1219
            G   D++  LSK L F   I+   D  +G    +   ++G +GELLNK+A  A  A T T +R+  VD++   M+ S     ++P     ++ +  P   + W    L       L+     V  +  P  + +L               LW   G F+ QG +    ++SAR+V+ +WWLF  I+ S+YTA LT+ LT++ 
Sbjct:   22 GFSVDVMDALSKSLGFSYEIFMPADLSYGLPQAD-GTWSGMIGELLNKRADVAISALTITPERESVVDFTKRYMDYSVGVAARRPADSAGLFALLSPLEPATWACLGLAVGLVGLLVYLLNRVTPRREPRHSPSL------------PASLWLVYGSFMQQGPELSSSSLSARLVMGVWWLFAFIVVSSYTASLTALLTINR 210          
BLAST of SMED30026028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007790.1 (pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-1 gene:ENSPMAG00000007047.1 transcript:ENSPMAT00000007790.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 3.630e-15
Identity = 71/302 (23.51%), Postives = 126/302 (41.72%), Query Frame = -2
Query:  140 EFVDYSYPIMEES-NVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDE----IYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSS-TDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVL 1027
            E +  S PI+E   ++ +  K   + +++    P N  +W+  ++    IS   +V S  +P   Y+L     +  E      +    W      V QG D  P +++ +I++  WW F L++ S YTA+L +FLT +EG + + SL  L  + D +     G  +   L  S    Y  +        T+   PKK LE +     + I + S V      +C +I +    F    L    P  +    ++ + +  L ++G ++  +E  W     + Q C   SN +  +  D  GV 
Sbjct:    2 ERLALSPPILENGYHIIMKGKEVNEPRIFQFLEPLNTLLWISMLSACAGISVVLFVLSLLHPDEWYHLAKRKLVSREQGQSFNLVNSFWFVFSAMVKQGSDPLPLSMAGKIIVYTWWCFVLVVCSTYTANLAAFLT-AEGQTSIRSLKDLTRQMDARYGTYSGYRIVGFLNSSARDPYMTVWRHIRDNRTMVASPKKGLEQAEKAGYIFIGEASAVFTAKKDHCDLIISDRRFFRHR-LALPFPPGSRLAAEVSRAVTELEDSGQLAE-LERQWFAQ--EGQECVGLSNEHQIEMKDFKGVF 298          
BLAST of SMED30026028 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010716.1 (pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1 gene:ENSPMAG00000009705.1 transcript:ENSPMAT00000010716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 76.6406 bits (187), Expect = 4.497e-15
Identity = 89/395 (22.53%), Postives = 174/395 (44.05%), Query Frame = -2
Query:   89 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFC-YVFSKYNPLSAYNLNLN---------FAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIP--KGTNLDALLIESTNPTYQALNS--RKIYIDTIDNCPKKMLELSSTDL-VCITDTSVVVYTVNK--YCSVI-YTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVF 1219
            G   DILK LSK + F   +Y   + + G++I    N  G +GE++N +A  A G+ T   +R E VD+S P +E     ++ +            PF+  VW++      L+S    ++F  ++P+  YN  L+         F I   I++   LW  +    +  ++  P   +++ ++++W  F +I  ++YTA+L +F+   +    +S L     ++ L+   P   GT  +     +    Y  ++    K +  ++++    ++ L +  L   I D +V+ Y   K   C ++     + F     G    K + +K+ ID  +   +  G +   +E  W T       C    N+  +  +D+D + G + +  + M L+F+VF
Sbjct:  398 GFCIDILKKLSKTVKFTYDLYLVTNGKHGSKINGVWN--GMIGEVVNMRAHMAVGSLTINEERSEVVDFSVPFVETGISVMVPRSNGTVSPSAFLEPFSADVWVMMFILCLLVSGIAVFIFEYFSPV-GYNRQLSAGKEFGGPAFTIGKSIWL---LWAIVFNNSVPVEN--PRGTTSKFMVSVWAFFAVIFLASYTANLAAFMIQEDYIDQVSGLSDKKFQSPLEHSPPFRFGTVPNGSTERNIRNNYLQMHGYMSKFHQKSVEDA---LMSLKAGKLDAFIYDAAVLNYMAGKDEGCRLVTIGSGKVFVATGYGIALQKSSRWKRAIDLALLQFIGDGEMDE-LEMIWLTGI-----CHGERNDVMSSQLDIDNMAGVFYMLLVAMGLSFIVF 775          
BLAST of SMED30026028 vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 129.798 bits (325), Expect = 6.411e-32
Identity = 98/375 (26.13%), Postives = 179/375 (47.73%), Query Frame = -2
Query:  140 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEES-NVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLN--FAIVDEIYIKEH--------LWNAIGGFVLQGQD-FYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDT-IDNCPKKMLELSSTDLVCITDTSVVVYTVNKY--CSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVL 1219
            G   ++L+ LS+ L F+  +Y  PD  FGA+   T  + G V E+LN +A  A  + T + +RQ+ +D++ P M+    V +   P  +   + I RPF + +W+    T+ ++ +F ++FS ++P   Y   +      ++  Y+K H        LW+ +  +V Q  D  +P + S RI +A++W   LI+ S YTA+L +FLT+    S +SS+D LA + D+       +   A    ++ P++  +     Y  T ++N  + + ++ + +   I D++V+ +  +    C  + T    F     GF   KD+P+ K++   I  L   G +      + K N   ++  E   + N     DL GV 
Sbjct:  475 GYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLARQKDISYGTVLNSQPQAFFESASVPSFVTMWQYMRYHHTFVNNSAEGIEKVMNENYAFIWDSAVLEFVAHNQISCGTLITSGSVFGRIGYGFGLAKDSPYTKQLSNAILQLRHAGYMEFLDRKWLKANDKCAEAAEKAKSENQLTFEDLSGVF 849          
BLAST of SMED30026028 vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 122.479 bits (306), Expect = 1.750e-30
Identity = 101/393 (25.70%), Postives = 190/393 (48.35%), Query Frame = -2
Query:  125 AMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKP-KTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNL---NFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEG-NXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTY----QALNSRKIYIDTIDNCPKKMLELSSTDLVCITDT-SVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAG-SNNNSADPIDLDGVLGAYIV 1270
            A +  GND+Y       G   D++++LS+KLNFR  I  + +  +G+++     + G +GEL+ ++A  A G  T T++R+E +D+S P ++     +LQ+P   +  ++    PF+  +WL ++  + L+S   +   +++P   Y            DE  +   LW A+   + QG D  P + S R++ A +WLF LI+ S YTA+L ++ T   G  S ++SL+ L +++ +K  + +G +L     ES    Y    Q + S++ +   ++     +L+  +     +TD  S+  Y + K C+ +  V    +         +++ +   I   I  L E G I +    +W     DS  C  G S ++S   ++L  + G +I+
Sbjct:   18 ASLLKGNDRYR------GFSKDLMELLSRKLNFRYEICISKESSYGSKV--EGQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSP-QGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSESKVDIYATMFQQMKSQETF---VNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTML-VKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWW----DDSSECPTGPSTDSSPQRLELHSLAGVFII 393          
BLAST of SMED30026028 vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 98.9821 bits (245), Expect = 6.807e-22
Identity = 95/403 (23.57%), Postives = 177/403 (43.92%), Query Frame = -2
Query:   92 GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNF--AIVDEIYIKEH--------LWNAIGGFVLQGQDF-YPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQAL-----NSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNK-YCSVIYTV----PETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQS------DSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1219
            G V D+L  LS+ L+F   IY +PD + G     T N+ G + EL+ ++A  A G  T TS R + +D++ P M      V+    +    +    PF   +W+     +  +    ++FS  +P   Y   +      V + Y+K+         +W++   ++ QG D  +P + S R  +A+WW    I+ + YTA++ +FLT +   + +  ++ L+++T++     + +        S+   YQ +       R +  DT     + +          I D  ++ Y   K YC  I  +      TF  A  GF  PK +P+   +   I  LV++GI    IE  W   ++      +++  +A S++ S   + ++ +LG +    IFM+    +
Sbjct:  408 GAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEIAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYTAIERTL----KGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPYTNLLSVEILKLVQSGIAKTMIE-EWMIERTPCAPLDEAEEQDAKSSDTSK--MGINNMLGVF----IFMVAGIAI 799          
BLAST of SMED30026028 vs. Ensembl Nematostella
Match: EDO35545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL56])

HSP 1 Score: 95.5153 bits (236), Expect = 9.846e-21
Identity = 87/376 (23.14%), Postives = 176/376 (46.81%), Query Frame = -2
Query:  125 GLVSDILKILSKKLNFRMLIYEAPDKQFGA--RI--GNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQG-QDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVI---PKGTNLDALLIESTNPTYQALNSRKIYID--TIDNCPKKMLELSSTDLVC-ITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIV 1219
            G   D+L  L +K+NF   +  + D  +G+  R+   +T  + G VGE++  KA     A T  ++R E++++S P   +    +++K +    +    RPF   +WLL + ++ +++   Y+  +++P   + L         + +   +W + G  +  G  +  P + SAR++  +W  F +II ++YTA+L +FL +    +++S +D    R   K  I      +++DA            L+S   +++   +    + + ++ + +L   I D+ V+ Y  +K C+ + T  E F  +  G   PK +P+   I   I +  E+G++   +E  W     D+  C   + N S   + L  +LG +I+
Sbjct:  441 GFCMDLLIRLGEKVNFTYSVSLSEDGSYGSLRRVNGSDTKQWNGMVGEVIQGKADLIVAALTINNERAEWIEFSKPFKYQGLTILVKKNEQSNSLDSFLRPFQIHLWLLVLLSVHIVAVILYLLDRFSPFGRFKLARKEKEETALNLSSAMWFSWGVLLNSGIGEGTPRSFSARVLGMVWAGFAMIIVASYTANLAAFLVLDRPKAVVSGIDDPNLRNPSKQFIYATVANSSVDAYFRRQVE-----LSSMYTFMEGYNVKTAKEGIEKVKNGELKAFIWDSPVLYYEASKDCT-LTTAGELFGRSGYGIGMPKGSPWSNAISLAILNFHESGVMEE-LETTWI----DASKCN--TENTSPATLGLQHMLGVFIM 803          
BLAST of SMED30026028 vs. Ensembl Nematostella
Match: EDO32623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUK5])

HSP 1 Score: 77.411 bits (189), Expect = 3.104e-16
Identity = 55/197 (27.92%), Postives = 90/197 (45.69%), Query Frame = -2
Query:  620 DILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKT-QTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGN 1207
            D+L IL+    F+  IYE+ +      +     + G  G++ ++KA       T  S R +++D+S P M  S   V +KP+  Q  +     P+   VWL+++A    ++    + + Y+P   + L       DE      LW  +   + QG D  P  +S RIV    W   L+  S YTA+L +FLT S  +
Sbjct:   22 DLLDILAGMNGFQYEIYESAEL---GGVKEDGTYYGLFGDIQSEKADLTTLPLTINSARLQYLDFSEPFMHVSMDLVTRKPEEKQIDITGFMTPYTIPVWLMTMACWIFVTGCLSLVNYYSPY-GHRLRDTEGDGDEFSFFNSLWFCLASMLQQGGDATPKMLSGRIVTGTLWFVILVWVSTYTANLAAFLTTSSSD 214          
BLAST of SMED30026028 vs. Ensembl Medaka
Match: GRIK2 (glutamate receptor ionotropic, kainate 2 [Source:NCBI gene;Acc:101173029])

HSP 1 Score: 121.324 bits (303), Expect = 1.065e-28
Identity = 102/405 (25.19%), Postives = 191/405 (47.16%), Query Frame = -2
Query:   89 PAMIFPGNDKYYRIEETF-GLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNL---DALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVF 1273
            P ++F  +DK     + F G   D+L+ LS  L FR  +    D ++GA   +T  + G V EL++ KA  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T +   V+  G  +       I + +  ++ +NSR+  +  + N  + +  + ++D   + +++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +  S     +   +  VL A +V  +F+ +  V++
Sbjct:  445 PYVMFKKSDKPLYGNDRFEGYCIDLLRELSGILGFRYELRLVEDGKYGALDESTGQWNGMVRELMDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYILLACLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIPYGVVEDGATMTFFKKTKISTYDKMWEFMNSRRQSV-MVKNVEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLT-QIGGLIDSRAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESKEASALGVQNIGGIFIVLAAGLVLSVFVAVGEVLY 847          
BLAST of SMED30026028 vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 118.627 bits (296), Expect = 8.263e-28
Identity = 99/420 (23.57%), Postives = 197/420 (46.90%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLD---ALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+   PL+          GND++       G   D+L+ L+  L F   +    D ++G +  N+  + G V EL++ +A  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + ++++   ++L   ++D   +T+++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +       +  A+ + +  + G +IV    ++L+  V
Sbjct:  431 VMFRKSDTPLY----------GNDRFE------GYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVL---TSDYAFLTESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEE------ESKEANALGVQNIGGIFIVLAAGLVLSVFV 824          
BLAST of SMED30026028 vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 118.242 bits (295), Expect = 1.169e-27
Identity = 99/420 (23.57%), Postives = 197/420 (46.90%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLD---ALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+   PL+          GND++       G   D+L+ L+  L F   +    D ++G +  N+  + G V EL++ +A  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + ++++   ++L   ++D   +T+++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +       A+ + +  + G +IV    ++L+  V
Sbjct:  443 VMFRKSDTPLY----------GNDRFE------GYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVL---TSDYAFLTESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESK------EANALGVQNIGGIFIVLAAGLVLSVFV 836          
BLAST of SMED30026028 vs. Ensembl Medaka
Match: GRIK2 (glutamate ionotropic receptor kainate type subunit 2 [Source:NCBI gene;Acc:101172189])

HSP 1 Score: 118.242 bits (295), Expect = 1.217e-27
Identity = 99/420 (23.57%), Postives = 197/420 (46.90%), Query Frame = -2
Query:   92 VKIRRKSRPLH*RITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPK-TQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYN---LNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKI-VIPKGTNLD---ALLIESTNPTYQALNSRK--IYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1318
            V  R+   PL+          GND++       G   D+L+ L+  L F   +    D ++G +  N+  + G V EL++ +A  A      T  R++ +D+S P M      + +KP  T   ++    P +  +W+  +     +S   +V ++++P   YN    N +  +V+  + +    W  +G  + QG +  P  +S RIV  IWW F LII S+YTA+L +FLTV    S + S D LA +T ++  V+  G+ +       I + +  ++ ++SR+  + + ++++   ++L   ++D   +T+++ + +   + C++   +    ++   G  TP  +P++ KI   I  L E G +    E +W+ N    +  +       A+ + +  + G +IV    ++L+  V
Sbjct:  443 VMFRKSDTPLY----------GNDRFE------GYCIDLLRELASILGFTYEVRLVEDGKYGVQDENSGQWNGMVRELMDHRADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKPNGTNPGVFSFLSPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPYPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKVEYGVVEDGSTMSFFKKTKISTYDKMWEFMSSRRHSVMVGSVEDGIHRVL---TSDYAFLTESTTIEFVTQRNCNLT-QIGGLIDSKAYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRGNGCPEEESK------EANALGVQNIGGIFIVLAAGLVLSVFV 836          
BLAST of SMED30026028 vs. Ensembl Medaka
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:NCBI gene;Acc:101170790])

HSP 1 Score: 117.087 bits (292), Expect = 2.948e-27
Identity = 98/400 (24.50%), Postives = 188/400 (47.00%), Query Frame = -2
Query:   92 GNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKP-KTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLS---AYNLNLNFAIVDEIY-IKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQAL------NSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQS-DSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVV 1255
            GND++       G   D+LK L+  L F   I   PD ++G++  +   + G + EL+  +A  A    T T  R++F+D+S P M      + +KP  T +  +    P    +W+  +     +S   +V ++++P     A+  N    +V+  + +    W  +   + QG +  P  +S RI+  IWW F LII S+YTA+L +FLTV   ++ + S D +A +T ++  + K     +   +S   T++ +        R   + +I++  +++L+   +D   IT+++ + Y   + C++   V    ++   G  TP  +P++ KI   I S++E G +    E +W  +   D +  E G       P+ +  + G +IV    ++L+  V
Sbjct:  456 GNDRFE------GFCIDLLKELAGLLGFTYEIRLVPDGKYGSQ-DDKGQWNGMIRELIEHRADLAVAPLTITYTREKFIDFSKPFMSMGISILYRKPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPGSDVVENNFTLLNSFWFGVSSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDTPVDSADDIAKQTKIEYGVIKDGATMSFFKKSRVSTFEKMWAFMSSRPRTSLVKSIEDGIQRVLK---SDYALITESTTIDYITRRNCNLT-QVGGIIDSKGYGIGTPIGSPYRDKITIAILSILEDGRLHMLKEKWWSGSSCLDEERRETG-------PMGIQNLGGLFIVLASGLVLSVFV 837          
BLAST of SMED30026028 vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 771.155 bits (1990), Expect = 0.000e+0
Identity = 416/422 (98.58%), Postives = 418/422 (99.05%), Query Frame = -2
Query:   14 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVFXXXXXXXXXXXXXLHC**YFLNLRN 1279
            ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVFLLELLYKKLKLNILHC  Y ++L N
Sbjct:  548 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVFLLELLYKKLKLNILHC--YRVDLEN 967          

HSP 2 Score: 429.483 bits (1103), Expect = 1.367e-135
Identity = 208/370 (56.22%), Postives = 277/370 (74.86%), Query Frame = -2
Query:  125 IEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIV 1234
            + ET GLV  IL+ L K L+F+ LIYEAPDKQFG +IGN+S FTGC+GE+L KK  F+AG +T TSQR EFVD+S P MEESNVP+L+KP   +K+WH+ RP  +SVW+L + ++  +S  C+ FSK++PLSA+NLNLNFAI+DE+ +KE+ WN IG   +QGQDFYP+ +S+RIVLAIWW+  LIIFSAY+ADLTSFLTV E N+ +S ++ LA R DL I++PKGTN+D+ L ES N  YQ LN RKI ID +D+CPKK+L  SST+LVCI+D S + Y  N  C  +Y VPE FN A LGF+  KD+P+K  ID  IQ LVE G+I++W+  YW+ ++  S+NC+    +NSA+PID +G+ G  ++
Sbjct:    4 VNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSSKFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICVI 373          
BLAST of SMED30026028 vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 367/372 (98.66%), Postives = 368/372 (98.92%), Query Frame = -2
Query:  164 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSAD 1279
            ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEA + N  AD
Sbjct:  548 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAENPNEEAD 919          

HSP 2 Score: 429.483 bits (1103), Expect = 7.844e-136
Identity = 208/370 (56.22%), Postives = 277/370 (74.86%), Query Frame = -2
Query:  125 IEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIV 1234
            + ET GLV  IL+ L K L+F+ LIYEAPDKQFG +IGN+S FTGC+GE+L KK  F+AG +T TSQR EFVD+S P MEESNVP+L+KP   +K+WH+ RP  +SVW+L + ++  +S  C+ FSK++PLSA+NLNLNFAI+DE+ +KE+ WN IG   +QGQDFYP+ +S+RIVLAIWW+  LIIFSAY+ADLTSFLTV E N+ +S ++ LA R DL I++PKGTN+D+ L ES N  YQ LN RKI ID +D+CPKK+L  SST+LVCI+D S + Y  N  C  +Y VPE FN A LGF+  KD+P+K  ID  IQ LVE G+I++W+  YW+ ++  S+NC+    +NSA+PID +G+ G  ++
Sbjct:    4 VNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSSKFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICVI 373          
BLAST of SMED30026028 vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 431.024 bits (1107), Expect = 2.350e-148
Identity = 211/382 (55.24%), Postives = 281/382 (73.56%), Query Frame = -2
Query:   89 IEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKTNQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVF 1234
            + ET GLV  IL+ L K L+F+ LIYEAPDKQFG +IGN+S FTGC+GE+L KK  F+AG +T TSQR EFVD+S P MEESNVP+L+KP   +K+WH+ RP  +SVW+L + ++  +S  C+ FSK++PLSA+NLNLNFAI+DE+ +KE+ WN IG   +QGQDFYP+ +S+RIVLAIWW+  LIIFSAY+ADLTSFLTV E N+ +S ++ LA R DL I++PKGTN+D+ L ES N  YQ LN RKI ID +D+CPKK+L  SST+LVCI+D S + Y  N  C  +Y VPE FN A LGF+  KD+P+K  ID  IQ LVE G+I++W+  YW+ ++  S+NC+    +NSA+PID +G+ G  I+T    +   + F
Sbjct:    4 VNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSSKFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPSSTNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICILTCSLFVCGLLFF 385          
BLAST of SMED30026028 vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 321.627 bits (823), Expect = 2.507e-103
Identity = 160/332 (48.19%), Postives = 225/332 (67.77%), Query Frame = -2
Query:  284 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKID 1279
            I PA+ +   + +  +  T GL+ +IL ILS KLNF  L+YEA D Q+GAR  ++ NFTGC+G++ NKK  F A  FT  + R E VD++ P  EESN  +L+   + +K+W++FRP +WS WL+ + +    SY  Y+ S Y+PLSA+NL L+F ++DEI ++EH+WN +G F++QGQDFYPY++S+R VLAIWW+F ++IFS YTADLTSFLTV      + SL+ LA+R DLKI++  GT+    L  S    ++ L SR  YI  ID CPK ++E +ST LVCI DTS + Y + ++CS IY VPETF++  +GF    DAPFK  +D
Sbjct:  241 IFPALTYTRKNSFVELNGTTGLIFEILSILSAKLNFIPLLYEAADSQWGARKNDSFNFTGCIGDIFNKKTLFGASLFTINAMRNEGVDFTAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGTSTAIFLQNSNYTVFKELYSRIQYIRAIDECPKLIMEGNSTHLVCIADTSSLTYVIRQFCSQIYIVPETFDSGNIGFPVQNDAPFKPLMD 572          
BLAST of SMED30026028 vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 321.627 bits (823), Expect = 2.677e-103
Identity = 160/332 (48.19%), Postives = 225/332 (67.77%), Query Frame = -2
Query:  284 ITPAMIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKXXXXXXXXXXTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNXXXXXXXXXXARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKID 1279
            I PA+ +   + +  +  T GL+ +IL ILS KLNF  L+YEA D Q+GAR  ++ NFTGC+G++ NKK  F A  FT  + R E VD++ P  EESN  +L+   + +K+W++FRP +WS WL+ + +    SY  Y+ S Y+PLSA+NL L+F ++DEI ++EH+WN +G F++QGQDFYPY++S+R VLAIWW+F ++IFS YTADLTSFLTV      + SL+ LA+R DLKI++  GT+    L  S    ++ L SR  YI  ID CPK ++E +ST LVCI DTS + Y + ++CS IY VPETF++  +GF    DAPFK  +D
Sbjct:  243 IFPALTYTRKNSFVELNGTTGLIFEILSILSAKLNFIPLLYEAADSQWGARKNDSFNFTGCIGDIFNKKTLFGASLFTINAMRNEGVDFTAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGTSTAIFLQNSNYTVFKELYSRIQYIRAIDECPKLIMEGNSTHLVCIADTSSLTYVIRQFCSQIYIVPETFDSGNIGFPVQNDAPFKPLMD 574          
The following BLAST results are available for this feature:
BLAST of SMED30026028 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK11.186e-2825.18glutamate ionotropic receptor kainate type subunit... [more]
GRIK11.222e-2825.18glutamate ionotropic receptor kainate type subunit... [more]
GRIK11.300e-2825.18glutamate ionotropic receptor kainate type subunit... [more]
GRIK11.340e-2825.18glutamate ionotropic receptor kainate type subunit... [more]
GRIK11.486e-2825.18glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-31.126e-2524.29GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-24.112e-2525.24Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-25.595e-2525.30Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
glr-44.573e-2422.20GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-47.224e-2422.20GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG111554.951e-3527.39gene:FBgn0039927 transcript:FBtr0333701[more]
CG111554.951e-3527.39gene:FBgn0039927 transcript:FBtr0089195[more]
KaiR1D1.493e-3326.46gene:FBgn0038837 transcript:FBtr0083987[more]
Ekar3.067e-3325.19gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar9.862e-3225.19gene:FBgn0039916 transcript:FBtr0344874[more]
back to top
BLAST of SMED30026028 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.499e-2724.38glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK21.499e-2724.38glutamate receptor, ionotropic, kainate 2 [Source:... [more]
gria4b2.841e-2724.38glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
grid21.035e-2625.06glutamate receptor, ionotropic, delta 2 [Source:NC... [more]
grid21.055e-2625.06glutamate receptor, ionotropic, delta 2 [Source:NC... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK22.304e-2925.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK22.363e-2925.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK22.573e-2925.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK22.659e-2925.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
GRIK23.024e-2925.44glutamate receptor, ionotropic, kainate 2 [Source:... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik13.031e-2824.94glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik13.237e-2824.94glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik13.585e-2824.94glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik13.644e-2824.94glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik14.015e-2824.94glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of SMED30026028 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P39086|GRIK1_HUMAN6.435e-2825.18Glutamate receptor ionotropic, kainate 1 OS=Homo s... [more]
sp|Q38PU4|GRIK1_MACFA7.047e-2825.18Glutamate receptor ionotropic, kainate 1 OS=Macaca... [more]
sp|Q62640|GRID1_RAT2.355e-2727.50Glutamate receptor ionotropic, delta-1 OS=Rattus n... [more]
sp|Q9ULK0|GRID1_HUMAN2.650e-2727.22Glutamate receptor ionotropic, delta-1 OS=Homo sap... [more]
sp|Q61627|GRID1_MOUSE3.446e-2727.22Glutamate receptor ionotropic, delta-1 OS=Mus musc... [more]
back to top
BLAST of SMED30026028 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FSX59.530e-7937.40PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1341.464e-7637.13PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8J0478.434e-7637.43PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8J1L94.399e-7536.54PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HJW14.922e-7237.43PBPe domain-containing protein OS=Macrostomum lign... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.180e-2824.22glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.214e-2824.22glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.321e-2824.22glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.404e-2824.22glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK21.463e-2824.22glutamate receptor ionotropic, kainate 2 [Source:N... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005084.18.364e-2325.00pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
gria1b7.068e-2122.61glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
ENSPMAT00000000621.14.817e-1728.71pep scaffold:Pmarinus_7.0:GL479810:19620:30867:-1 ... [more]
ENSPMAT00000007790.13.630e-1523.51pep scaffold:Pmarinus_7.0:GL476616:796957:798868:-... [more]
ENSPMAT00000010716.14.497e-1522.53pep scaffold:Pmarinus_7.0:GL476465:413535:454465:1... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30026028 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO302036.411e-3226.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412911.750e-3025.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466336.807e-2223.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO355459.846e-2123.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO326233.104e-1627.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30026028 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK21.065e-2825.19glutamate receptor ionotropic, kainate 2 [Source:N... [more]
GRIK28.263e-2823.57glutamate ionotropic receptor kainate type subunit... [more]
GRIK21.169e-2723.57glutamate ionotropic receptor kainate type subunit... [more]
GRIK21.217e-2723.57glutamate ionotropic receptor kainate type subunit... [more]
GRIK32.948e-2724.50glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of SMED30026028 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018611.11.367e-13598.58SMESG000018611.1[more]
SMESG000018611.17.844e-13698.66SMESG000018611.1[more]
SMESG000018611.12.350e-14855.24SMESG000018611.1[more]
SMESG000069533.12.507e-10348.19SMESG000069533.1[more]
SMESG000069533.12.677e-10348.19SMESG000069533.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026028 ID=SMED30026028|Name=SMED30026028|organism=Schmidtea mediterranea sexual|type=transcript|length=1535bp
CTCTAGTATACAAATTCCTAAGATTTAAAAAATATCACTAGCAATGAAGT
ATATTAAGTTTTAATTTCTTGTATAGTAATTCCAAAAGAAACACCACAAA
AGCAAGAATCATGAAAATCCATGTCACTATATAGGCTCCAAGAACTCCGT
CTAGATCTATTGGATCGGCCGAATTGTTATTTGAACCTGCTTCACAATTT
TGAGAATCTGATTGGTTAGTTTTCCAGTAGAACTCGATCCATCTGGAAAT
GATTCCTGTTTCCACCAAAGATTGAATTATTTGATCTATCTTTTTTTTGA
AAGGTGCATCCTTTGGAGTTAGAAACCCCAATGGTGCAGTATTAAAAGTT
TCTGGAACTGTATAAATTACTGAACAATATTTATTAACAGTATATACTAC
GACCGATGTATCAGTAATGCAAACTAAATCTGTTGATGAAAGCTCCAGCA
TTTTTTTAGGACAATTGTCAATTGTATCTATGTATATTTTTCGAGAATTC
AACGCTTGATAAGTTGGATTAGTCGACTCAATTAATAATGCATCCAAATT
GGTTCCTTTAGGAATAACAATTTTAAGATCTGTTCGAGCCGCTAAGGCAT
CTAATGAGGATAATAAACTATTACCTTCGCTAACTGTCAGAAATGATGTC
AAATCAGCTGTATATGCGCTGAATATAATAAGACAAAATAACCACCATAT
TGCAAGTACGATTCTTGCGGAAACTGTATAAGGATAGAAGTCTTGACCTT
GCAACACGAATCCGCCAATTGCGTTCCACAAGTGTTCTTTAATATAAATT
TCATCTACAATTGCAAAATTCAGATTCAAATTGTATGCTGACAACGGATT
ATATTTGGAAAATACATAGCAAAAATAAGATATTAGAAAGATTGTTGCAA
TAGATAGAAGCCAAACCGACCAGTTGAATGGCCGAAAAATGTGCCACATT
TTTGTTTGCGTTTTAGGTTTTTGAAGTACTGGTACATTTGATTCTTCCAT
AATGGGGTAGGAATAATCGACAAATTCCTGTCTTTGGGAAGTGAACGTAA
AAGCTCCAGCAGCAAAGGTAGCTTTTTTATTTAAAAGCTCTCCAACACAT
CCAGTAAAGTTTGAAGTGTTTCCTATTCTAGCTCCAAACTGTTTATCAGG
AGCTTCATATATAAGCATTCTAAAATTTAATTTTTTTGATAAAATCTTTA
AAATGTCTGAAACAAGACCAAATGTTTCTTCAATTCTGTAATACTTATCA
TTTCCAGGAAATATCATAGCTGGTGTTATCCGTTAATGCAGTGGTCTGCT
TTTTCTTCTGATTTTAACCTAATGAAAAACCTGTGAGGTATTCTAGTGCA
ATTGGGTTTTGCAAACAATCGTCAGTTCGACAATATTCCCCAACTGAAAG
CAGCCATTTTGACAGCCTCGAATTGGATTAATCAAAATACCCTCCAATTT
CCTGTGAACAGTATGCCTGAAAAAATACTTTTACTCGTAATGAAGAAGGT
TTCATTAACTATTAAAAATATATTTTTTTAAAAGT
back to top

protein sequence of SMED30026028-orf-1

>SMED30026028-orf-1 ID=SMED30026028-orf-1|Name=SMED30026028-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=410bp
MIFPGNDKYYRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGN
TSNFTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQK
PKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLN
FAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFS
AYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTN
PTYQALNSRKIYIDTIDNCPKKMLELSSTDLVCITDTSVVVYTVNKYCSV
IYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYWKT
NQSDSQNCEAGSNNNSADPIDLDGVLGAYIVTWIFMILAFVVFLLELLYK
KLKLNILHC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: molecular function
TermDefinition
GO:0038023signaling receptor activity
GO:0015276ligand-gated ion channel activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: INTERPRO
TermDefinition
IPR001508Iono_rcpt_met
IPR001320Iontro_rcpt
IPR019594Glu/Gly-bd
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001508Ionotropic glutamate receptor, metazoaPRINTSPR00177NMDARECEPTORcoord: 118..143
score: 18.85
coord: 375..399
score: 12.4
coord: 186..213
score: 38.93
IPR001320Ionotropic glutamate receptorSMARTSM00079GluR_14coord: 15..350
e-value: 0.0086
score: -73.6
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 116..384
e-value: 2.1E-27
score: 95.8
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainSMARTSM00918Lig_chan_Glu_bd_2coord: 4..63
e-value: 7.7E-4
score: 28.8
IPR019594Ionotropic glutamate receptor, L-glutamate and glycine-binding domainPFAMPF10613Lig_chan-Glu_bdcoord: 14..101
e-value: 6.2E-17
score: 61.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 103..396
e-value: 1.1E-82
score: 279.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 93..313
e-value: 1.1E-82
score: 279.6
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 16..368
e-value: 1.1E-82
score: 279.6
NoneNo IPR availablePANTHERPTHR18966IONOTROPIC GLUTAMATE RECEPTORcoord: 17..399
NoneNo IPR availablePANTHERPTHR18966:SF354coord: 17..399
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 16..351
NoneNo IPR availableTMHMMTMhelixcoord: 375..397
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 181..203