Msh2 protein

Overview
NameMsh2 protein
Smed IDSMED30026019
Length (bp)949
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Msh2 protein (SMED30026019) t-SNE clustered cells

Violin plots show distribution of expression levels for Msh2 protein (SMED30026019) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Msh2 protein (SMED30026019) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Msh2 protein (SMED30026019) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026019

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30026019SMESG000002984.1 SmedASXL_016327SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30026019SMESG000002984.1 dd_Smed_v4_16524_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026019SMESG000002984.1 dd_Smed_v4_16524_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30026019SMESG000002984.1 dd_Smed_v4_16524_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30026019SMESG000002984.1 dd_Smed_v4_16524_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Msh2 protein vs. Ensembl Human
Match: MSX1 (msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391])

HSP 1 Score: 137.502 bits (345), Expect = 1.073e-37
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLS 666
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A   LS
Sbjct:  164 CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLS 254          
BLAST of Msh2 protein vs. Ensembl Human
Match: MSX2 (msh homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7392])

HSP 1 Score: 134.035 bits (336), Expect = 7.919e-37
Identity = 63/86 (73.26%), Postives = 71/86 (82.56%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  +
Sbjct:  134 CTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSS 219          
BLAST of Msh2 protein vs. Ensembl Human
Match: MNX1 (motor neuron and pancreas homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4979])

HSP 1 Score: 76.2554 bits (186), Expect = 5.138e-16
Identity = 37/57 (64.91%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKR 591
            R+PRT FT+QQL+ELE++F   +YLS  +R E +T+L LTETQVKIWFQNRR K KR
Sbjct:   30 RRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 86          
BLAST of Msh2 protein vs. Ensembl Human
Match: MNX1 (motor neuron and pancreas homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4979])

HSP 1 Score: 72.4034 bits (176), Expect = 1.007e-15
Identity = 34/52 (65.38%), Postives = 43/52 (82.69%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRR 576
            R+PRT FT+QQL+ELE++F   +YLS  +R E +T+L LTETQVKIWFQNRR
Sbjct:   30 RRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRR 81          
BLAST of Msh2 protein vs. Ensembl Human
Match: DLX3 (distal-less homeobox 3 [Source:HGNC Symbol;Acc:HGNC:2916])

HSP 1 Score: 75.0998 bits (183), Expect = 1.015e-15
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL---EETELE 612
            RKPRT +++ QL  L+ +F   QYL++ ERAE +  L LT+TQVKIWFQNRR+K K+L    E  LE
Sbjct:   10 RKPRTIYSSYQLAALQRRFQKAQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLE 76          
BLAST of Msh2 protein vs. Ensembl Celegans
Match: vab-15 (Homeobox protein vab-15 [Source:UniProtKB/Swiss-Prot;Acc:Q09604])

HSP 1 Score: 128.257 bits (321), Expect = 1.733e-35
Identity = 60/78 (76.92%), Postives = 69/78 (88.46%), Query Frame = 1
Query:  391 KCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRF 624
            KC LRKHK NRKPRTPF+TQQL+ LE KF +KQYLSI+ERAEFS +L LTETQVKIWFQNRRAK+KRL+E E+EK +F
Sbjct:  120 KCMLRKHKNNRKPRTPFSTQQLISLERKFQSKQYLSIAERAEFSASLQLTETQVKIWFQNRRAKSKRLQEAEVEKVKF 197          
BLAST of Msh2 protein vs. Ensembl Celegans
Match: ceh-9 (Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Prot;Acc:P56407])

HSP 1 Score: 76.6406 bits (187), Expect = 7.214e-17
Identity = 39/75 (52.00%), Postives = 53/75 (70.67%), Query Frame = 1
Query:  373 KNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLE 597
            K +P +KC   K K   K RT F+ +Q+ ELE +F  K+YLS S+R+E +  L++TETQVKIWFQNRR K K++E
Sbjct:   58 KESPIEKCQKTKRK---KARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKKIE 129          
BLAST of Msh2 protein vs. Ensembl Celegans
Match: ceh-28 (C. Elegans Homeobox; NK-2 family homeodomain protein CEH-28 [Source:UniProtKB/TrEMBL;Acc:G5EE18])

HSP 1 Score: 73.1738 bits (178), Expect = 3.116e-15
Identity = 36/68 (52.94%), Postives = 46/68 (67.65%), Query Frame = 1
Query:  397 NLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEE 600
            NLR  +  RKPR  FT  Q+ ELE +F  ++Y++ +ER E +  L LT TQVKIWFQNRR K KRL +
Sbjct:   97 NLRSQQQKRKPRVLFTQHQVNELEERFKKQRYVTATEREELAQCLGLTATQVKIWFQNRRYKCKRLAQ 164          
BLAST of Msh2 protein vs. Ensembl Celegans
Match: tab-1 (pep chromosome:WBcel235:II:6803758:6804863:1 gene:WBGene00006380.1 transcript:F31E8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tab-1)

HSP 1 Score: 71.633 bits (174), Expect = 1.020e-14
Identity = 42/96 (43.75%), Postives = 55/96 (57.29%), Query Frame = 1
Query:  307 VQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
             QR+  +P +    S A+     NA      LR     RK RT F+ QQL  LE +F +++YLS  ER E +  LNL+ETQVK WFQNRR K K++
Sbjct:   86 AQRNGVFPGF---WSTADQIRLSNATKAYRRLRLECSRRKARTVFSDQQLQGLERRFESQRYLSTPERIELANALNLSETQVKTWFQNRRMKHKKV 178          
BLAST of Msh2 protein vs. Ensembl Celegans
Match: ceh-1 (Homeobox protein ceh-1 [Source:UniProtKB/Swiss-Prot;Acc:P53547])

HSP 1 Score: 71.2478 bits (173), Expect = 1.114e-14
Identity = 34/57 (59.65%), Postives = 42/57 (73.68%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKR 591
            R+ RT FT +QL+ LENKF T +YLS+ ER   +  L L+ETQVKIWFQNRR K K+
Sbjct:   41 RRARTAFTYEQLVALENKFKTSRYLSVVERLNLAIQLQLSETQVKIWFQNRRTKWKK 97          
BLAST of Msh2 protein vs. Ensembl Fly
Match: Dr (gene:FBgn0000492 transcript:FBtr0085441)

HSP 1 Score: 140.198 bits (352), Expect = 1.741e-37
Identity = 64/81 (79.01%), Postives = 71/81 (87.65%), Query Frame = 1
Query:  382 PNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRF 624
            P  KCNLRKHKPNRKPRTPFTTQQL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E E+EK + 
Sbjct:  409 PRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAEIEKIKM 489          
BLAST of Msh2 protein vs. Ensembl Fly
Match: unpg (gene:FBgn0015561 transcript:FBtr0088586)

HSP 1 Score: 75.485 bits (184), Expect = 6.330e-15
Identity = 33/55 (60.00%), Postives = 47/55 (85.45%), Query Frame = 1
Query:  433 TPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLE 597
            T FT++QL+ELE +F  K+YLS++ER++ +T+L L+E QVKIWFQNRRAK KR++
Sbjct:  324 TAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVK 378          
BLAST of Msh2 protein vs. Ensembl Fly
Match: Dll (gene:FBgn0000157 transcript:FBtr0072378)

HSP 1 Score: 74.3294 bits (181), Expect = 8.462e-15
Identity = 32/58 (55.17%), Postives = 45/58 (77.59%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
            RKPRT +++ QL +L  +F   QYL++ ERAE + +L LT+TQVKIWFQNRR+K K++
Sbjct:  125 RKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM 182          
BLAST of Msh2 protein vs. Ensembl Fly
Match: Dll (gene:FBgn0000157 transcript:FBtr0072379)

HSP 1 Score: 74.3294 bits (181), Expect = 8.812e-15
Identity = 32/58 (55.17%), Postives = 45/58 (77.59%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
            RKPRT +++ QL +L  +F   QYL++ ERAE + +L LT+TQVKIWFQNRR+K K++
Sbjct:  125 RKPRTIYSSLQLQQLNRRFQRTQYLALPERAELAASLGLTQTQVKIWFQNRRSKYKKM 182          
BLAST of Msh2 protein vs. Ensembl Fly
Match: exex (gene:FBgn0041156 transcript:FBtr0076751)

HSP 1 Score: 75.0998 bits (183), Expect = 1.089e-14
Identity = 36/64 (56.25%), Postives = 48/64 (75.00%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELE 612
            R+PRT FT+QQL+ELE +F   +YLS  +R E ++ L L+ETQVKIWFQNRR K KR ++ + E
Sbjct:  440 RRPRTAFTSQQLLELEKQFKQNKYLSRPKRFEVASGLMLSETQVKIWFQNRRMKWKRSKKAQQE 503          
BLAST of Msh2 protein vs. Ensembl Zebrafish
Match: msx1a (muscle segment homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-312])

HSP 1 Score: 131.339 bits (329), Expect = 3.168e-37
Identity = 62/86 (72.09%), Postives = 71/86 (82.56%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPF+T QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A
Sbjct:   26 CPLRKHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPLLPPA 111          
BLAST of Msh2 protein vs. Ensembl Zebrafish
Match: msx2b (muscle segment homeobox 2b [Source:NCBI gene;Acc:30531])

HSP 1 Score: 132.109 bits (331), Expect = 1.405e-36
Identity = 63/96 (65.62%), Postives = 73/96 (76.04%), Query Frame = 1
Query:  358 NNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLE 645
            N+ + +      C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L 
Sbjct:   95 NSRYSQTRQESPCPLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLTLTETQVKIWFQNRRAKAKRLQEAELEKLKLTAKPALH 190          
BLAST of Msh2 protein vs. Ensembl Zebrafish
Match: msx1a (muscle segment homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-980526-312])

HSP 1 Score: 132.109 bits (331), Expect = 1.441e-36
Identity = 62/86 (72.09%), Postives = 71/86 (82.56%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPF+T QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A
Sbjct:  103 CPLRKHKTNRKPRTPFSTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPLLPPA 188          
BLAST of Msh2 protein vs. Ensembl Zebrafish
Match: msx2b (muscle segment homeobox 2b [Source:NCBI gene;Acc:30531])

HSP 1 Score: 131.724 bits (330), Expect = 1.647e-36
Identity = 63/96 (65.62%), Postives = 73/96 (76.04%), Query Frame = 1
Query:  358 NNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLE 645
            N+ + +      C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L 
Sbjct:   80 NSRYSQTRQESPCPLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLTLTETQVKIWFQNRRAKAKRLQEAELEKLKLTAKPALH 175          
BLAST of Msh2 protein vs. Ensembl Zebrafish
Match: msx2a (muscle segment homeobox 2a [Source:NCBI gene;Acc:573620])

HSP 1 Score: 131.339 bits (329), Expect = 4.754e-36
Identity = 61/86 (70.93%), Postives = 71/86 (82.56%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELE+++   +P L   
Sbjct:  114 CPLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELERFKMASKPILHPG 199          
BLAST of Msh2 protein vs. Ensembl Xenopus
Match: kcnk18 (potassium channel, two pore domain subfamily K, member 18 [Source:Xenbase;Acc:XB-GENE-6257492])

HSP 1 Score: 136.346 bits (342), Expect = 1.497e-37
Identity = 64/86 (74.42%), Postives = 71/86 (82.56%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A
Sbjct:  142 CTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPA 227          
BLAST of Msh2 protein vs. Ensembl Xenopus
Match: cbln2 (cerebellin 2 precursor [Source:Xenbase;Acc:XB-GENE-5897871])

HSP 1 Score: 133.265 bits (334), Expect = 1.428e-36
Identity = 62/86 (72.09%), Postives = 70/86 (81.40%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E E+EK +   +P L   
Sbjct:  123 CTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAEIEKLKMAAKPILPPG 208          
BLAST of Msh2 protein vs. Ensembl Xenopus
Match: ENSXETT00000052399.1 (motor neuron and pancreas homeobox protein 1-like [Source:NCBI gene;Acc:100486032])

HSP 1 Score: 78.5666 bits (192), Expect = 2.631e-16
Identity = 38/57 (66.67%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKR 591
            R+PRT FT+QQL+ELEN+F   +YLS  +R E +T+L LTETQVKIWFQNRR K KR
Sbjct:  125 RRPRTAFTSQQLLELENQFKANKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 181          
BLAST of Msh2 protein vs. Ensembl Xenopus
Match: ENSXETT00000053265.1 (gastrulation brain homeobox 2, gene 1 [Source:NCBI gene;Acc:100485559])

HSP 1 Score: 77.411 bits (189), Expect = 1.608e-15
Identity = 35/60 (58.33%), Postives = 49/60 (81.67%), Query Frame = 1
Query:  418 NRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLE 597
            NR+ RT FT++QL+ELE +F  K+YLS++ER++ +  L L+E QVKIWFQNRRAK KR++
Sbjct:  239 NRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVK 298          
BLAST of Msh2 protein vs. Ensembl Xenopus
Match: MNX1 (motor neuron and pancreas homeobox 1 [Source:NCBI gene;Acc:100496534])

HSP 1 Score: 77.0258 bits (188), Expect = 2.360e-15
Identity = 37/57 (64.91%), Postives = 46/57 (80.70%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKR 591
            R+PRT FT+QQL+ELE++F   +YLS  +R E +T+L LTETQVKIWFQNRR K KR
Sbjct:  178 RRPRTAFTSQQLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 234          
BLAST of Msh2 protein vs. Ensembl Mouse
Match: Msx1 (msh homeobox 1 [Source:MGI Symbol;Acc:MGI:97168])

HSP 1 Score: 137.502 bits (345), Expect = 7.680e-38
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLS 666
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A   LS
Sbjct:  164 CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLS 254          
BLAST of Msh2 protein vs. Ensembl Mouse
Match: Msx2 (msh homeobox 2 [Source:MGI Symbol;Acc:MGI:97169])

HSP 1 Score: 134.42 bits (337), Expect = 4.402e-37
Identity = 63/86 (73.26%), Postives = 70/86 (81.40%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E ELEK +   +P L   
Sbjct:  134 CTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSG 219          
BLAST of Msh2 protein vs. Ensembl Mouse
Match: Msx3 (msh homeobox 3 [Source:MGI Symbol;Acc:MGI:106587])

HSP 1 Score: 129.413 bits (324), Expect = 7.612e-36
Identity = 62/85 (72.94%), Postives = 70/85 (82.35%), Query Frame = 1
Query:  397 NLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
             LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A
Sbjct:   80 TLRKHKTNRKPRTPFTTAQLLALERKFHQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKLAAKPLLPAA 164          
BLAST of Msh2 protein vs. Ensembl Mouse
Match: Nkx3-1 (NK3 homeobox 1 [Source:MGI Symbol;Acc:MGI:97352])

HSP 1 Score: 77.0258 bits (188), Expect = 4.933e-16
Identity = 42/86 (48.84%), Postives = 55/86 (63.95%), Query Frame = 1
Query:  412 KPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETE----LEKYRFIKRPGLEDAQL 657
            +P ++ R  F+  Q++ELE KF  ++YLS  ERA  + NL LTETQVKIWFQNRR K KR + +E    LEK   +  P L+D  L
Sbjct:  123 QPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKTKRKQLSEDLGVLEKNSPLSLPALKDDSL 208          
BLAST of Msh2 protein vs. Ensembl Mouse
Match: Gbx2 (gastrulation brain homeobox 2 [Source:MGI Symbol;Acc:MGI:95668])

HSP 1 Score: 77.7962 bits (190), Expect = 1.040e-15
Identity = 35/60 (58.33%), Postives = 49/60 (81.67%), Query Frame = 1
Query:  418 NRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLE 597
            NR+ RT FT++QL+ELE +F  K+YLS++ER++ +  L L+E QVKIWFQNRRAK KR++
Sbjct:  247 NRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVK 306          
BLAST of Msh2 protein vs. UniProt/SwissProt
Match: sp|P50223|HMGX7_CHICK (Homeobox protein GHOX-7 OS=Gallus gallus OX=9031 GN=GHOX-7 PE=2 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 1.694e-38
Identity = 68/129 (52.71%), Postives = 83/129 (64.34%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLS---NSQNCITNSIINDESWNQKIQKNLRSISLFDGQID 771
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A   +S           S+    S  Q+    +  + L+   + 
Sbjct:  153 CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGISFPLGGPAVAGASLYGASSPFQRAGLPVAPVGLYTAHVG 281          
BLAST of Msh2 protein vs. UniProt/SwissProt
Match: sp|P28361|MSX1_CHICK (Homeobox protein MSX-1 OS=Gallus gallus OX=9031 GN=MSX1 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.789e-37
Identity = 68/129 (52.71%), Postives = 83/129 (64.34%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLS---NSQNCITNSIINDESWNQKIQKNLRSISLFDGQID 771
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A   +S           S+    S  Q+    +  + L+   + 
Sbjct:  114 CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGISFPLGGPAVAGASLYGASSPFQRAGLPVAPVGLYTAHVG 242          
BLAST of Msh2 protein vs. UniProt/SwissProt
Match: sp|P15857|HM17_APIME (Homeobox protein H17 (Fragment) OS=Apis mellifera OX=7460 PE=3 SV=1)

HSP 1 Score: 130.954 bits (328), Expect = 3.106e-37
Identity = 61/77 (79.22%), Postives = 69/77 (89.61%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRF 624
            C LRKHKPNRKPRTPFTTQQL+ LE KF  KQYL+I+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E E+EK R 
Sbjct:    1 CTLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLTIAERAEFSSSLHLTETQVKIWFQNRRAKAKRLQEAEIEKLRL 77          
BLAST of Msh2 protein vs. UniProt/SwissProt
Match: sp|Q2VL80|MSX1_PERPO (Homeobox protein MSX-1 (Fragment) OS=Perodicticus potto edwarsi OX=9473 GN=MSX1 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.132e-37
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLS 666
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A   LS
Sbjct:  158 CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLS 248          
BLAST of Msh2 protein vs. UniProt/SwissProt
Match: sp|Q2VL86|MSX1_SAIBB (Homeobox protein MSX-1 (Fragment) OS=Saimiri boliviensis boliviensis OX=39432 GN=MSX1 PE=3 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 3.554e-37
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLS 666
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A   LS
Sbjct:  158 CTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLS 248          
BLAST of Msh2 protein vs. TrEMBL
Match: B0B0P1 (Msh2 protein OS=Schmidtea mediterranea OX=79327 GN=msh2 PE=2 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 4.655e-123
Identity = 178/191 (93.19%), Postives = 183/191 (95.81%), Query Frame = 1
Query:  181 MEAKPTSDFSISKLLTDSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIINDESWNQKIQKNLRSISL 753
            MEAKPTSDFSISKLLT SSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKA   FQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLED +LFLSNSQNCITNSIINDESWNQK +K+  +IS+
Sbjct:    1 MEAKPTSDFSISKLLTYSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKARYYFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLED-ELFLSNSQNCITNSIINDESWNQKFRKSSINISV 190          
BLAST of Msh2 protein vs. TrEMBL
Match: B0B0P3 (Msh2 protein OS=Dugesia japonica OX=6161 GN=msh2 PE=2 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 5.989e-114
Identity = 162/201 (80.60%), Postives = 180/201 (89.55%), Query Frame = 1
Query:  181 MEAKPTSDFSISKLLTDSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIINDESW-NQKIQKNLRSISLFDGQIDTIT 780
            ME K  SDFSISKLLTD +HET+SNFLIGK KF TDDS E  + RD+FYPWY +E+SKA+N+FQKN  NQKCNLRKHKPNRKPRTPFTTQQLMELENKF+TKQYLSISERAEFSTNL+LTETQVKIWFQNRRAKAKRLEETELEKYRFIKRP LEDA+L+LSN+QNC+ NSI+NDE+W N KI KN RSISLFDG ID ++
Sbjct:    1 MEGKSISDFSISKLLTDVTHETQSNFLIGKKKFSTDDSAENFIHRDLFYPWYFMELSKASNNFQKNVSNQKCNLRKHKPNRKPRTPFTTQQLMELENKFLTKQYLSISERAEFSTNLSLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPALEDAELYLSNNQNCLPNSIMNDENWNNHKIPKNFRSISLFDGHIDKLS 201          
BLAST of Msh2 protein vs. TrEMBL
Match: A0A182TFX2 (Homeobox domain-containing protein OS=Anopheles melas OX=34690 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 4.811e-40
Identity = 75/128 (58.59%), Postives = 88/128 (68.75%), Query Frame = 1
Query:  322 FYPWYLIEMSKANNSFQKNAPNQ-KCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIIN 702
             Y W+ I M      FQ N P + KCNLRKHKPNRKPRTPFTTQQL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK +         AQL++      +    ++
Sbjct:    1 MYSWHAITM------FQYNEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAELEKIKMAALGRAPGAQLYMGYFHPSLMGGAMH 122          
BLAST of Msh2 protein vs. TrEMBL
Match: A0A182SXI6 (Homeobox domain-containing protein OS=Anopheles maculatus OX=74869 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 9.695e-39
Identity = 72/124 (58.06%), Postives = 87/124 (70.16%), Query Frame = 1
Query:  331 WYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIIN 702
            + L+ +SK +N      P  KCNLRKHKPNRKPRTPFTTQQL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK +         AQL++      +    ++
Sbjct:    7 FVLLLISKTDN----EPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAELEKIKMAALGRAPGAQLYMGYFHPSLMGGAMH 126          
BLAST of Msh2 protein vs. TrEMBL
Match: A0A182QJ35 (Homeobox domain-containing protein OS=Anopheles farauti OX=69004 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.530e-38
Identity = 69/112 (61.61%), Postives = 80/112 (71.43%), Query Frame = 1
Query:  367 FQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIIN 702
            F    P  KCNLRKHKPNRKPRTPFTTQQL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK +         AQL++      +    ++
Sbjct:    6 FDNEPPRIKCNLRKHKPNRKPRTPFTTQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKRLQEAELEKIKMAALGRAPGAQLYMGYFHPSLMGGAMH 117          
BLAST of Msh2 protein vs. Ensembl Cavefish
Match: msx3 (homeobox protein MSH-C-like [Source:NCBI gene;Acc:103037925])

HSP 1 Score: 135.191 bits (339), Expect = 1.546e-37
Identity = 67/104 (64.42%), Postives = 77/104 (74.04%), Query Frame = 1
Query:  331 WYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGL 642
            WY    S    S  +++    C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E ELEK +   +P L
Sbjct:  115 WY---QSPPYTSPPRHSSPTPCALRKHKNNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKLAAKPVL 215          
BLAST of Msh2 protein vs. Ensembl Cavefish
Match: msx2b (homeobox protein MSX-2-like [Source:NCBI gene;Acc:103040314])

HSP 1 Score: 131.724 bits (330), Expect = 1.345e-36
Identity = 66/99 (66.67%), Postives = 74/99 (74.75%), Query Frame = 1
Query:  358 NNSF-QKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            N SF Q    +  C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L   
Sbjct:   80 NPSFPQTRQVSPPCALRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLTLTETQVKIWFQNRRAKAKRLQEAELEKLKLAAKPALHPG 178          
BLAST of Msh2 protein vs. Ensembl Cavefish
Match: ENSAMXT00000052410.1 (homeobox protein MSH-B-like [Source:NCBI gene;Acc:103039552])

HSP 1 Score: 132.88 bits (333), Expect = 1.354e-36
Identity = 63/83 (75.90%), Postives = 69/83 (83.13%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGL 642
            C+LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS+ LNLTETQVKIWFQNRRAKAKRL E ELEK +   +P L
Sbjct:  139 CHLRKHKSNRKPRTPFTTAQLLSLERKFRQKQYLSIAERAEFSSALNLTETQVKIWFQNRRAKAKRLHEAELEKLKLAAKPVL 221          
BLAST of Msh2 protein vs. Ensembl Cavefish
Match: ENSAMXT00000058088.1 (homeobox protein MSX-2 [Source:NCBI gene;Acc:103023202])

HSP 1 Score: 130.568 bits (327), Expect = 4.593e-36
Identity = 61/86 (70.93%), Postives = 70/86 (81.40%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C+LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E E+EK +   +P L   
Sbjct:  102 CSLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLCLTETQVKIWFQNRRAKAKRLQEAEMEKLKMAGKPMLHSG 187          
BLAST of Msh2 protein vs. Ensembl Cavefish
Match: MSX1 (msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391])

HSP 1 Score: 120.553 bits (301), Expect = 1.093e-32
Identity = 76/175 (43.43%), Postives = 98/175 (56.00%), Query Frame = 1
Query:  136 FYSGIKLTAINEQLEMEAKPTSDFSISKLLTDSSHETRSNFLIGKSKF-FTDDSIEACVQ--RDIFYPWYLIEMSKANNSFQKN--APNQKCNLRK-HKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGL 642
             +SG  +  +  + EM+ +    FS+  L+ D +    +    G S    TD      V   RD        E  + ++  Q    AP      R+    NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK +   +P L
Sbjct:    7 MWSGCAV--LKTEAEMKPRAPLPFSVEALMADRTPSGPARAATGTSASPMTDGGAAHAVGGIRDQVK----AESPERSSWIQSARFAPTPPSKTRRTQTTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPML 175          
BLAST of Msh2 protein vs. Ensembl Sea Lamprey
Match: MSX1 (msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391])

HSP 1 Score: 130.568 bits (327), Expect = 7.621e-38
Identity = 60/81 (74.07%), Postives = 69/81 (85.19%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRP 636
            C LRKHK  RKPRTPFTT QL+ LE+KF  KQYLSI+ERAEFST+L+LTETQVKIWFQNRRAKAKRL+E ELE+ +   +P
Sbjct:    6 CPLRKHKATRKPRTPFTTSQLLALEHKFRQKQYLSIAERAEFSTSLSLTETQVKIWFQNRRAKAKRLQEAELERLKMAAKP 86          
BLAST of Msh2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001141.1 (pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 gene:ENSPMAG00000001023.1 transcript:ENSPMAT00000001141.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 3.606e-16
Identity = 35/65 (53.85%), Postives = 49/65 (75.38%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEK 615
            R+PRT F++QQL+ELE  F  ++YLS  +R + ++ L LTETQVKIWFQNRR K KR +  +L++
Sbjct:    4 RRPRTAFSSQQLLELERHFSRQRYLSRPQRFQVASALMLTETQVKIWFQNRRMKWKRGKGGQLQE 68          
BLAST of Msh2 protein vs. Ensembl Sea Lamprey
Match: dlx5a (distal-less homeobox 5a [Source:NCBI gene;Acc:30569])

HSP 1 Score: 75.0998 bits (183), Expect = 1.745e-15
Identity = 33/58 (56.90%), Postives = 45/58 (77.59%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
            RKPRT +++ QL  L+ +F   QYL++ ERAE + +L LT+TQVKIWFQNRR+K K+L
Sbjct:  203 RKPRTIYSSFQLAALQRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKL 260          
BLAST of Msh2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001480.1 (pep scaffold:Pmarinus_7.0:GL487501:66:2428:-1 gene:ENSPMAG00000001338.1 transcript:ENSPMAT00000001480.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.081e-14
Identity = 33/63 (52.38%), Postives = 42/63 (66.67%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAK 582
            C +R+    RK RT FT  QL  LE +F+ ++YLS  ER + +T L L+ETQVK WFQNRR K
Sbjct:    2 CGVRR----RKARTVFTDSQLSGLERRFVRQRYLSTPERVDLATALGLSETQVKTWFQNRRMK 60          
BLAST of Msh2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011242.1 (pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-1 gene:ENSPMAG00000010215.1 transcript:ENSPMAT00000011242.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.2402 bits (160), Expect = 1.125e-14
Identity = 31/60 (51.67%), Postives = 41/60 (68.33%), Query Frame = 1
Query:  418 NRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLE 597
             RK R P++ QQ +ELE +F+   YL+   R E +  LNLTE QVKIWFQNRR K K+++
Sbjct:    1 GRKKRCPYSKQQTLELEKEFLFNMYLTRDRRYEVARGLNLTERQVKIWFQNRRMKLKKMK 60          
BLAST of Msh2 protein vs. Ensembl Nematostella
Match: MSX (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI73])

HSP 1 Score: 131.339 bits (329), Expect = 1.188e-38
Identity = 63/82 (76.83%), Postives = 68/82 (82.93%), Query Frame = 1
Query:  391 KCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRP 636
            KC LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS +LNLTETQVKIWFQNRRAKAKRL E ELEK +   +P
Sbjct:    5 KCQLRKHKANRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSASLNLTETQVKIWFQNRRAKAKRLHEAELEKLKLASKP 86          
BLAST of Msh2 protein vs. Ensembl Nematostella
Match: ANTH-HBXE (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1J1])

HSP 1 Score: 78.9518 bits (193), Expect = 1.236e-18
Identity = 36/58 (62.07%), Postives = 48/58 (82.76%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
            R+ RT FT++QL++LE +F  K+Y+S+ ER+  +TNLNLTE QVKIWFQNRRAK KR+
Sbjct:    6 RRKRTAFTSKQLLQLEREFHNKKYVSLEERSVIATNLNLTEVQVKIWFQNRRAKWKRV 63          
BLAST of Msh2 protein vs. Ensembl Nematostella
Match: EDO49538 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ7])

HSP 1 Score: 75.0998 bits (183), Expect = 1.816e-17
Identity = 35/66 (53.03%), Postives = 47/66 (71.21%), Query Frame = 1
Query:  403 RKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEE 600
            RKHK +R PR PF+  QL  LE KF+   YLS  E  + S++L++TE +VKIWFQNRRA+ K+ +E
Sbjct:    1 RKHKLDRNPRIPFSASQLAALEAKFLDTHYLSSVEVRDLSSSLSVTEHRVKIWFQNRRAREKKTKE 66          
BLAST of Msh2 protein vs. Ensembl Nematostella
Match: EDO42196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S291])

HSP 1 Score: 74.3294 bits (181), Expect = 4.144e-17
Identity = 40/73 (54.79%), Postives = 54/73 (73.97%), Query Frame = 1
Query:  403 RKHKPN--RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEK 615
            RK K N  R+ RT FT++Q ++LE +F   +Y++ S R E +  LNLTETQVKIWFQNRRAK KRLE+ ++E+
Sbjct:    2 RKRKENKPRRQRTTFTSEQTLKLELEFHQNEYITRSRRFELAACLNLTETQVKIWFQNRRAKDKRLEKAQMEQ 74          
BLAST of Msh2 protein vs. Ensembl Nematostella
Match: EDO42243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S290])

HSP 1 Score: 71.2478 bits (173), Expect = 4.120e-16
Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = 1
Query:  418 NRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKR 591
            +R+PRT F++ QL+ LE +F   +YL+  +R E +T+L LTETQVKIWFQNRR K KR
Sbjct:    7 HRRPRTAFSSHQLLALERQFQLHKYLTRPQRYELATSLMLTETQVKIWFQNRRMKWKR 64          
BLAST of Msh2 protein vs. Ensembl Medaka
Match: msx1a (msh homeobox 1 [Source:NCBI gene;Acc:101167951])

HSP 1 Score: 137.117 bits (344), Expect = 4.093e-38
Identity = 64/86 (74.42%), Postives = 71/86 (82.56%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDA 651
            C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E ELEK +   +P L  A
Sbjct:  144 CPLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPA 229          
BLAST of Msh2 protein vs. Ensembl Medaka
Match: ENSORLT00000044102.1 (homeobox protein MSX-2 [Source:NCBI gene;Acc:101155486])

HSP 1 Score: 135.576 bits (340), Expect = 8.298e-38
Identity = 77/168 (45.83%), Postives = 101/168 (60.12%), Query Frame = 1
Query:  277 FFTDDSIEA-CVQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIINDESW---NQKIQKNLRSISLFDGQI 768
            F+ D  + A   + D  +P     +S  +   + ++P Q C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L+LTETQVKIWFQNRRAKAKRL+E ELEK++   +P L    L           + +   +W   N   + +L    LF G +
Sbjct:   85 FYADSRVPAESSEEDSPHP-----VSSFSTPPRSSSPAQ-CTLRKHKNNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKFKLASKPVLPAFALPFP------LGAHVGAPTWGPSNALPRPSLPVPGLFSGPV 240          
BLAST of Msh2 protein vs. Ensembl Medaka
Match: msx3 (homeobox protein MSX-2 [Source:NCBI gene;Acc:100049217])

HSP 1 Score: 134.806 bits (338), Expect = 1.814e-37
Identity = 63/81 (77.78%), Postives = 70/81 (86.42%), Query Frame = 1
Query:  394 CNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRP 636
            CNLRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++LNLTETQVKIWFQNRRAKAKRL+E ELEK +   +P
Sbjct:  123 CNLRKHKNNRKPRTPFTTSQLLSLERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRLQEAELEKLKLAAKP 203          
BLAST of Msh2 protein vs. Ensembl Medaka
Match: ENSORLT00000043119.1 (homeobox protein MSH-D [Source:NCBI gene;Acc:101172514])

HSP 1 Score: 130.568 bits (327), Expect = 1.453e-35
Identity = 63/88 (71.59%), Postives = 70/88 (79.55%), Query Frame = 1
Query:  364 SFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFI 627
            S Q    N  C LRKHK NRKPRTPFTT QL+ LE KF  KQYLSI+ERAEFS++L LTETQVKIWFQNRRAKAKRL+E ELEK + +
Sbjct:  124 STQLGPVNPGCQLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLTLTETQVKIWFQNRRAKAKRLQEAELEKLKIV 211          
BLAST of Msh2 protein vs. Ensembl Medaka
Match: ENSORLT00000022856.2 (pep primary_assembly:ASM223467v1:21:28760997:28766425:-1 gene:ENSORLG00000018251.2 transcript:ENSORLT00000022856.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.1073 bits (196), Expect = 3.203e-18
Identity = 43/72 (59.72%), Postives = 53/72 (73.61%), Query Frame = 1
Query:  376 NAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKR 591
            +AP+Q   L K    R+PRT FT+QQL+ELEN+F   +YLS  +R E +T+L LTETQVKIWFQNRR K KR
Sbjct:    9 SAPSQAALLGK---CRRPRTAFTSQQLLELENQFKVNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKR 77          
BLAST of Msh2 protein vs. Planmine SMEST
Match: SMESG000002984.1 (SMESG000002984.1)

HSP 1 Score: 461.07 bits (1185), Expect = 1.509e-164
Identity = 223/224 (99.55%), Postives = 223/224 (99.55%), Query Frame = 1
Query:  109 NHSNQPIRNFYSGIKLTAINEQLEMEAKPTSDFSISKLLTDSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIINDESWNQKIQKNLRSISLFDGQIDTIT 780
            N SNQPIRNFYSGIKLTAINEQLEMEAKPTSDFSISKLLTDSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIINDESWNQKIQKNLRSISLFDGQIDTIT
Sbjct:   82 NVSNQPIRNFYSGIKLTAINEQLEMEAKPTSDFSISKLLTDSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYPWYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIKRPGLEDAQLFLSNSQNCITNSIINDESWNQKIQKNLRSISLFDGQIDTIT 305          
BLAST of Msh2 protein vs. Planmine SMEST
Match: SMESG000019757.1 (SMESG000019757.1)

HSP 1 Score: 130.568 bits (327), Expect = 1.913e-36
Identity = 62/84 (73.81%), Postives = 73/84 (86.90%), Query Frame = 1
Query:  373 KNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRF 624
            + +PN KC LRKHKPNRKPRTPFTTQQL++LE KF  KQYLSI+ERAEFS++L LTE QVKIWFQNRRAK+KRL+E E++K R 
Sbjct:   91 RTSPN-KCTLRKHKPNRKPRTPFTTQQLIQLEKKFHQKQYLSIAERAEFSSSLGLTEIQVKIWFQNRRAKSKRLQEAEIDKLRI 173          
BLAST of Msh2 protein vs. Planmine SMEST
Match: SMESG000019757.1 (SMESG000019757.1)

HSP 1 Score: 130.954 bits (328), Expect = 1.915e-36
Identity = 62/84 (73.81%), Postives = 73/84 (86.90%), Query Frame = 1
Query:  373 KNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRF 624
            + +PN KC LRKHKPNRKPRTPFTTQQL++LE KF  KQYLSI+ERAEFS++L LTE QVKIWFQNRRAK+KRL+E E++K R 
Sbjct:   95 RTSPN-KCTLRKHKPNRKPRTPFTTQQLIQLEKKFHQKQYLSIAERAEFSSSLGLTEIQVKIWFQNRRAKSKRLQEAEIDKLRI 177          
BLAST of Msh2 protein vs. Planmine SMEST
Match: SMESG000045025.1 (SMESG000045025.1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.380e-15
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
            RKPRT +++ QL +L  +F   QYLS+ ERAE +++L LT+TQVKIWFQNRR+K K+L
Sbjct:  279 RKPRTIYSSLQLQQLSKRFQRTQYLSLPERAELASSLGLTQTQVKIWFQNRRSKYKKL 336          
BLAST of Msh2 protein vs. Planmine SMEST
Match: SMESG000045025.1 (SMESG000045025.1)

HSP 1 Score: 76.6406 bits (187), Expect = 2.577e-15
Identity = 34/58 (58.62%), Postives = 46/58 (79.31%), Query Frame = 1
Query:  421 RKPRTPFTTQQLMELENKFMTKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRL 594
            RKPRT +++ QL +L  +F   QYLS+ ERAE +++L LT+TQVKIWFQNRR+K K+L
Sbjct:  283 RKPRTIYSSLQLQQLSKRFQRTQYLSLPERAELASSLGLTQTQVKIWFQNRRSKYKKL 340          
The following BLAST results are available for this feature:
BLAST of Msh2 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSX11.073e-3771.43msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391][more]
MSX27.919e-3773.26msh homeobox 2 [Source:HGNC Symbol;Acc:HGNC:7392][more]
MNX15.138e-1664.91motor neuron and pancreas homeobox 1 [Source:HGNC ... [more]
MNX11.007e-1565.38motor neuron and pancreas homeobox 1 [Source:HGNC ... [more]
DLX31.015e-1553.73distal-less homeobox 3 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vab-151.733e-3576.92Homeobox protein vab-15 [Source:UniProtKB/Swiss-P... [more]
ceh-97.214e-1752.00Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Pr... [more]
ceh-283.116e-1552.94C. Elegans Homeobox; NK-2 family homeodomain prote... [more]
tab-11.020e-1443.75pep chromosome:WBcel235:II:6803758:6804863:1 gene:... [more]
ceh-11.114e-1459.65Homeobox protein ceh-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dr1.741e-3779.01gene:FBgn0000492 transcript:FBtr0085441[more]
unpg6.330e-1560.00gene:FBgn0015561 transcript:FBtr0088586[more]
Dll8.462e-1555.17gene:FBgn0000157 transcript:FBtr0072378[more]
Dll8.812e-1555.17gene:FBgn0000157 transcript:FBtr0072379[more]
exex1.089e-1456.25gene:FBgn0041156 transcript:FBtr0076751[more]
back to top
BLAST of Msh2 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msx1a3.168e-3772.09muscle segment homeobox 1a [Source:ZFIN;Acc:ZDB-GE... [more]
msx2b1.405e-3665.63muscle segment homeobox 2b [Source:NCBI gene;Acc:3... [more]
msx1a1.441e-3672.09muscle segment homeobox 1a [Source:ZFIN;Acc:ZDB-GE... [more]
msx2b1.647e-3665.63muscle segment homeobox 2b [Source:NCBI gene;Acc:3... [more]
msx2a4.754e-3670.93muscle segment homeobox 2a [Source:NCBI gene;Acc:5... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kcnk181.497e-3774.42potassium channel, two pore domain subfamily K, me... [more]
cbln21.428e-3672.09cerebellin 2 precursor [Source:Xenbase;Acc:XB-GENE... [more]
ENSXETT00000052399.12.631e-1666.67motor neuron and pancreas homeobox protein 1-like ... [more]
ENSXETT00000053265.11.608e-1558.33gastrulation brain homeobox 2, gene 1 [Source:NCBI... [more]
MNX12.360e-1564.91motor neuron and pancreas homeobox 1 [Source:NCBI ... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Msx17.680e-3871.43msh homeobox 1 [Source:MGI Symbol;Acc:MGI:97168][more]
Msx24.402e-3773.26msh homeobox 2 [Source:MGI Symbol;Acc:MGI:97169][more]
Msx37.612e-3672.94msh homeobox 3 [Source:MGI Symbol;Acc:MGI:106587][more]
Nkx3-14.933e-1648.84NK3 homeobox 1 [Source:MGI Symbol;Acc:MGI:97352][more]
Gbx21.040e-1558.33gastrulation brain homeobox 2 [Source:MGI Symbol;A... [more]
back to top
BLAST of Msh2 protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P50223|HMGX7_CHICK1.694e-3852.71Homeobox protein GHOX-7 OS=Gallus gallus OX=9031 G... [more]
sp|P28361|MSX1_CHICK2.789e-3752.71Homeobox protein MSX-1 OS=Gallus gallus OX=9031 GN... [more]
sp|P15857|HM17_APIME3.106e-3779.22Homeobox protein H17 (Fragment) OS=Apis mellifera ... [more]
sp|Q2VL80|MSX1_PERPO3.132e-3771.43Homeobox protein MSX-1 (Fragment) OS=Perodicticus ... [more]
sp|Q2VL86|MSX1_SAIBB3.554e-3771.43Homeobox protein MSX-1 (Fragment) OS=Saimiri boliv... [more]
back to top
BLAST of Msh2 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B0B0P14.655e-12393.19Msh2 protein OS=Schmidtea mediterranea OX=79327 GN... [more]
B0B0P35.989e-11480.60Msh2 protein OS=Dugesia japonica OX=6161 GN=msh2 P... [more]
A0A182TFX24.811e-4058.59Homeobox domain-containing protein OS=Anopheles me... [more]
A0A182SXI69.695e-3958.06Homeobox domain-containing protein OS=Anopheles ma... [more]
A0A182QJ352.530e-3861.61Homeobox domain-containing protein OS=Anopheles fa... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msx31.546e-3764.42homeobox protein MSH-C-like [Source:NCBI gene;Acc:... [more]
msx2b1.345e-3666.67homeobox protein MSX-2-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000052410.11.354e-3675.90homeobox protein MSH-B-like [Source:NCBI gene;Acc:... [more]
ENSAMXT00000058088.14.593e-3670.93homeobox protein MSX-2 [Source:NCBI gene;Acc:10302... [more]
MSX11.093e-3243.43msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391][more]
back to top
BLAST of Msh2 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MSX17.621e-3874.07msh homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7391][more]
ENSPMAT00000001141.13.606e-1653.85pep scaffold:Pmarinus_7.0:GL478075:36995:38394:-1 ... [more]
dlx5a1.745e-1556.90distal-less homeobox 5a [Source:NCBI gene;Acc:3056... [more]
ENSPMAT00000001480.11.081e-1452.38pep scaffold:Pmarinus_7.0:GL487501:66:2428:-1 gene... [more]
ENSPMAT00000011242.11.125e-1451.67pep scaffold:Pmarinus_7.0:GL476758:607601:607780:-... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Msh2 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MSX1.188e-3876.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTH-HBXE1.236e-1862.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495381.816e-1753.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421964.144e-1754.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422434.120e-1656.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Msh2 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
msx1a4.093e-3874.42msh homeobox 1 [Source:NCBI gene;Acc:101167951][more]
ENSORLT00000044102.18.298e-3845.83homeobox protein MSX-2 [Source:NCBI gene;Acc:10115... [more]
msx31.814e-3777.78homeobox protein MSX-2 [Source:NCBI gene;Acc:10004... [more]
ENSORLT00000043119.11.453e-3571.59homeobox protein MSH-D [Source:NCBI gene;Acc:10117... [more]
ENSORLT00000022856.23.203e-1859.72pep primary_assembly:ASM223467v1:21:28760997:28766... [more]
back to top
BLAST of Msh2 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002984.11.509e-16499.55SMESG000002984.1[more]
SMESG000019757.11.913e-3673.81SMESG000019757.1[more]
SMESG000019757.11.915e-3673.81SMESG000019757.1[more]
SMESG000045025.12.380e-1558.62SMESG000045025.1[more]
SMESG000045025.12.577e-1558.62SMESG000045025.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026019 ID=SMED30026019|Name=Msh2 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=949bp
CATTGATCTCATAGAACTAATAGAAAATCATCGCCTATTAAATTTGGACA
CGCCTCATTGGCTAATTGAATTGACTGCTTGATGCCAGCATGAAACTGCA
CTAACATCAATCACAGCAATCAGCCTATCAGAAATTTTTACAGCGGAATA
AAACTAACTGCCATTAATGAACAATTAGAAATGGAAGCAAAGCCAACCTC
TGATTTTTCAATATCGAAATTGTTGACTGATTCTTCTCATGAAACGCGTT
CGAATTTCCTTATTGGGAAAAGCAAATTTTTCACCGACGATTCAATAGAA
GCCTGCGTTCAACGAGACATATTCTATCCGTGGTATTTAATAGAAATGTC
AAAAGCAAATAATTCCTTTCAGAAAAATGCCCCCAATCAAAAGTGCAATT
TGCGAAAACACAAACCGAACAGAAAACCGAGAACCCCATTCACGACCCAG
CAGTTGATGGAGCTGGAAAACAAATTCATGACCAAGCAATACTTGTCAAT
ATCAGAACGCGCCGAATTTTCTACGAATTTGAATTTGACAGAAACTCAAG
TGAAAATATGGTTTCAAAATCGGCGAGCCAAAGCTAAACGATTAGAAGAA
ACAGAGCTTGAAAAATACAGATTTATCAAGCGTCCTGGTCTAGAAGATGC
CCAATTATTTTTATCAAACTCTCAAAATTGCATAACAAATTCCATTATCA
ACGATGAAAGTTGGAATCAAAAAATTCAGAAAAATCTTCGATCAATATCT
CTGTTTGATGGCCAAATTGACACTATTACGTCATCATCGACATCACTTCC
AGCATTTTCCTCAAAATTCATTCCTCCCTCGTCATCTTCCTTTTAACAAA
TTTGTGTAAACTATCAAATTATCCAATGATTTTCGATATTTTGGGTTCAC
TTCTAATGAATATTGGAATGTTTTATTACGATTAAAACATAAATCTATT
back to top

protein sequence of SMED30026019-orf-1

>SMED30026019-orf-1 ID=SMED30026019-orf-1|Name=SMED30026019-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=222bp
MEAKPTSDFSISKLLTDSSHETRSNFLIGKSKFFTDDSIEACVQRDIFYP
WYLIEMSKANNSFQKNAPNQKCNLRKHKPNRKPRTPFTTQQLMELENKFM
TKQYLSISERAEFSTNLNLTETQVKIWFQNRRAKAKRLEETELEKYRFIK
RPGLEDAQLFLSNSQNCITNSIINDESWNQKIQKNLRSISLFDGQIDTIT
SSSTSLPAFSSKFIPPSSSSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0000982transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0044212transcription regulatory region DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0001503ossification
GO:0001649osteoblast differentiation
GO:0002076osteoblast development
GO:0006351transcription, DNA-templated
GO:0006357regulation of transcription from RNA polymerase II promoter
GO:0006366transcription from RNA polymerase II promoter
GO:0007275multicellular organism development
GO:0010942positive regulation of cell death
GO:0043065positive regulation of apoptotic process
GO:0045892negative regulation of transcription, DNA-templated
GO:0051216cartilage development
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 102..113
score: 38.66
coord: 117..127
score: 70.25
coord: 127..136
score: 79.15
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 80..142
e-value: 2.9E-24
score: 96.6
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 81..137
e-value: 1.7E-21
score: 75.8
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 78..138
score: 20.342
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 81..139
e-value: 5.70931E-20
score: 78.054
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 44..142
e-value: 6.2E-24
score: 86.0
NoneNo IPR availablePANTHERPTHR24338FAMILY NOT NAMEDcoord: 60..155
NoneNo IPR availablePANTHERPTHR24338:SF0MUSCLE SEGMENTATION HOMEOBOXcoord: 60..155
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 113..136
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 68..139