Innexin

Overview
NameInnexin
Smed IDSMED30026015
Length (bp)1803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30026015) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30026015) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30026015) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30026015) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026015

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026015SMESG000068735.1 SmedASXL_014226SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30026015SMESG000068735.1 dd_Smed_v4_15435_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30026015SMESG000068735.1 dd_Smed_v6_15502_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 288.5 bits (737), Expect = 7.887e-92
Identity = 143/387 (36.95%), Postives = 236/387 (60.98%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWR-----VASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNF----RQAKITGTEE 1548
            ++ +  +FK  +     DF D+LNY +TS +I  F  IVS +QYVG PIQCWVP +FT AWE+Y EN CWV NTY+L      P++  + +  + ISYYQW+  VLA +AL  ++P + WR      +   +  L + A +A + D D R   V  +   +E   DA    R V  +   C+     N  +T+L++ ++++++GN V Q++++  F+G++N+ +G+ +L+DLL G++WE++GNFPRVT C   VR +G V    +T+QCVL IN F EK+++FLWFW+ ++A ++ +S   W+  + LP + + ++R+YL+A  L  +T+ +   +FV+  LG DGVF + ++S+ A D+++ ++   LW NF    R+ +   TE 
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGD-RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHME---DALEIQREVTDVSGMCVQKRWAN-YVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH--HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTES 380          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 288.5 bits (737), Expect = 7.887e-92
Identity = 143/387 (36.95%), Postives = 236/387 (60.98%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWR-----VASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNF----RQAKITGTEE 1548
            ++ +  +FK  +     DF D+LNY +TS +I  F  IVS +QYVG PIQCWVP +FT AWE+Y EN CWV NTY+L      P++  + +  + ISYYQW+  VLA +AL  ++P + WR      +   +  L + A +A + D D R   V  +   +E   DA    R V  +   C+     N  +T+L++ ++++++GN V Q++++  F+G++N+ +G+ +L+DLL G++WE++GNFPRVT C   VR +G V    +T+QCVL IN F EK+++FLWFW+ ++A ++ +S   W+  + LP + + ++R+YL+A  L  +T+ +   +FV+  LG DGVF + ++S+ A D+++ ++   LW NF    R+ +   TE 
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGD-RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHME---DALEIQREVTDVSGMCVQKRWAN-YVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH--HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQFNSTES 380          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 285.804 bits (730), Expect = 3.360e-90
Identity = 140/375 (37.33%), Postives = 231/375 (61.60%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWR-----VASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQ 1524
            ++ +  +FK  +     DF D+LNY +TS +I  F  IVS +QYVG PIQCWVP +FT AWE+Y EN CWV NTY+L      P++  + +  + ISYYQW+  VLA +AL  ++P + WR      +   +  L + A +A + D D R   V  +   +E   DA    R V  +   C+     N  +T+L++ ++++++GN V Q++++  F+G++N+ +G+ +L+DLL G++WE++GNFPRVT C   VR +G V    +T+QCVL IN F EK+++FLWFW+ ++A ++ +S   W+  + LP + + ++R+YL+A  L  +T+ +   +FV+  LG DGVF + ++S+ A D+++ ++   LW NF  
Sbjct:    3 LYYLAAIFKGLHPRVDDDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGD-RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHME---DALEIQREVTDVSGMCVQKRWANY-VTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHH--HTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDL--ATDRQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFND 368          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-9 (Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O01393])

HSP 1 Score: 261.922 bits (668), Expect = 1.218e-81
Identity = 139/362 (38.40%), Postives = 221/362 (61.05%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPV----LLRSAREAVLPDRDLRVKAVSCMVASLEEQ---ADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAK 1530
            D  D+LNY +T+ +I +F  +VS +QYVG PIQCWVP  FT+  E+Y EN CWV NTYFL     IP +  E +N + I YYQW+  VLA +ALL +VP + WR+ S +  +    L++ A ++ L D + R +A+  +  ++EE        M   R+K +    +        +T L+I V+I++  N VGQI+L+  F+G+ +  +G  +L DL+ G++WE +G+FPRVT C   V+ +G V +  +T+QCVL IN F EK+++FLWFW+ L+AG T+ S   W++ +++P +++++V +YL  +      + +   RFV + L  DGVFLL +V++ A +L   ++  TLW N+   K
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLK-LLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHR--HTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNK 379          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 256.144 bits (653), Expect = 2.978e-79
Identity = 136/393 (34.61%), Postives = 229/393 (58.27%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWR-----VASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTR--------LTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITS---TEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTE 1545
            ++ +   F+  Y     DF D+LNY +T+ ++  F  +VS +QYVG PIQCWVP  FT A E+Y EN CWV NTY++   ++IP +    +N + I YYQW+  +LA +ALL +VP + WR      +   L  L++ A +A L D +++ + V  M   ++++   T   R  +G  R C   L             +T+L+I +++++  N + Q +L+   +GSN++ +G++LLKDL+   +WE TG FPRVT C   VR +G + +  +T+QCVL IN F EK+++FLWFWF+    +T+ +T+ W+    +P + + +VR+YL+ +    +    ++    +F NN L  DGVF+L ++S+ A +L+S ++   LW++F     + T+
Sbjct:    3 LYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRN-RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDR--QGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHR--HTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRSPTQ 390          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 95.1301 bits (235), Expect = 7.780e-21
Identity = 94/377 (24.93%), Postives = 157/377 (41.64%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEF------------KNVKYISYYQWIVIVLAGQALLSWVPHLAWRV-ASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGN---FPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSR 1560
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F + ++   +  ++               VKY  YYQW+  VL  QA+L +VP   W+     RL +L+      ++ D                       +  R K +    +G L  +      F V   +   N +GQIY +  F+      +G  +LK      D  +      FP+VT CT          Q    L CVLP+N   EK+YVFLWFWFI+++ ++ +S +  +     P  R       L+A   +  +EE +    V N       FLL+ +      LI  +V + L +     +++G E    +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGL-CVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVE---LVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSR-----EMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 95.1301 bits (235), Expect = 7.780e-21
Identity = 94/377 (24.93%), Postives = 157/377 (41.64%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEF------------KNVKYISYYQWIVIVLAGQALLSWVPHLAWRV-ASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGN---FPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSR 1560
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F + ++   +  ++               VKY  YYQW+  VL  QA+L +VP   W+     RL +L+      ++ D                       +  R K +    +G L  +      F V   +   N +GQIY +  F+      +G  +LK      D  +      FP+VT CT          Q    L CVLP+N   EK+YVFLWFWFI+++ ++ +S +  +     P  R       L+A   +  +EE +    V N       FLL+ +      LI  +V + L +     +++G E    +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGL-CVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVE---LVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSR-----EMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 95.1301 bits (235), Expect = 7.780e-21
Identity = 94/377 (24.93%), Postives = 157/377 (41.64%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEF------------KNVKYISYYQWIVIVLAGQALLSWVPHLAWRV-ASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGN---FPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSR 1560
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F + ++   +  ++               VKY  YYQW+  VL  QA+L +VP   W+     RL +L+      ++ D                       +  R K +    +G L  +      F V   +   N +GQIY +  F+      +G  +LK      D  +      FP+VT CT          Q    L CVLP+N   EK+YVFLWFWFI+++ ++ +S +  +     P  R       L+A   +  +EE +    V N       FLL+ +      LI  +V + L +     +++G E    +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGL-CVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVE---LVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSR-----EMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 95.1301 bits (235), Expect = 7.780e-21
Identity = 94/377 (24.93%), Postives = 157/377 (41.64%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEF------------KNVKYISYYQWIVIVLAGQALLSWVPHLAWRV-ASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGN---FPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSR 1560
            +++Y+ T  +++ F  +V+ RQY+G PI C V +      + Y    CW+ +T F + ++   +  ++               VKY  YYQW+  VL  QA+L +VP   W+     RL +L+      ++ D                       +  R K +    +G L  +      F V   +   N +GQIY +  F+      +G  +LK      D  +      FP+VT CT          Q    L CVLP+N   EK+YVFLWFWFI+++ ++ +S +  +     P  R       L+A   +  +EE +    V N       FLL+ +      LI  +V + L +     +++G E    +
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGVMDTY----CWIYST-FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKMLVMDLNSPIVNDE---------------------CKNDRKKILVDYFIGNLNRHNFYAFRFFVCEALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGL-CVLPLNIVNEKIYVFLWFWFIILSIMSGISLIYRIAVVAGPKLR----HLLLRARSRLAESEEVE---LVANKCNIGDWFLLYQLGKNIDPLIYKEVISDLSR-----EMSGDEHSAHK 362          
BLAST of Innexin vs. Ensembl Fly
Match: shakB (gene:FBgn0085387 transcript:FBtr0112571)

HSP 1 Score: 90.1225 bits (222), Expect = 4.218e-19
Identity = 89/358 (24.86%), Postives = 153/358 (42.74%), Query Frame = 1
Query:  478 QLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFL----LADQEIPV-------DDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGN---FPRVTYCTIL-VRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATL 1506
            +L+Y  T  +++ F  I++ RQYVG PI C   ++     E+     CW+ +TY L    L  Q + V        D +  + K+  YYQW+   L  QA+L + P   W+               A++ D D+ + + +      +   D      R    +                + V  ++ + N +GQ++LM +F     I FG  ++  +   Q+  +      FPR+T CT       G+V++  +   C+LP+N   EK+Y+FLWFWFIL+  +T+L+ +  +     P  RV+  R   + +R       RD    +         FLL+++      +I  DV   L
Sbjct:   25 RLHYSITVMILMSFSLIITTRQYVGNPIDCVHTKDIP---EDVLNTYCWIQSTYTLKSLFLKKQGVSVPYPGIGNSDGDPADKKHYKYYQWVCFCLFFQAILFYTPRWLWKSWEG-------GKIHALIMDLDIGICSEAEKKQKKKLLLDYLWENLRYHNWW-------------AYRYYVCELLALINVIGQMFLMNRFFDGEFITFGLKVIDYMETDQEDRMDPMIYIFPRMTKCTFFKYGSSGEVEK--HDAICILPLNVVNEKIYIFLWFWFILLTFLTLLTLIYRVVIIFSPRMRVYLFRMRFRLVR-------RDAIEIIVRRSKMGDWFLLYLLGENIDTVIFRDVVQDL 350          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 261.922 bits (668), Expect = 1.549e-80
Identity = 139/362 (38.40%), Postives = 221/362 (61.05%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPV----LLRSAREAVLPDRDLRVKAVSCMVASLEEQ---ADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAK 1530
            D  D+LNY +T+ +I +F  +VS +QYVG PIQCWVP  FT+  E+Y EN CWV NTYFL     IP +  E +N + I YYQW+  VLA +ALL +VP + WR+ S +  +    L++ A ++ L D + R +A+  +  ++EE        M   R+K +    +        +T L+I V+I++  N VGQI+L+  F+G+ +  +G  +L DL+ G++WE +G+FPRVT C   V+ +G V +  +T+QCVL IN F EK+++FLWFW+ L+AG T+ S   W++ +++P +++++V +YL  +      + +   RFV + L  DGVFLL +V++ A +L   ++  TLW N+   K
Sbjct:   22 DIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAEREN-RQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQSGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLK-LLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLGNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHR--HTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNYCDNK 379          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.116e-76
Identity = 137/393 (34.86%), Postives = 228/393 (58.02%), Query Frame = 1
Query:  415 VFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWR-----VASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTR--------LTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERD---CSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTE 1545
            ++ +   F+  Y     DF D+LNY +T+ ++  F  +VS +QYVG PIQCWVP  FT A E+Y EN CWV NTY++   ++IP +    +N + I YYQW+  +LA +ALL +VP + WR      +   L  L++ A +A L D +++ + V  M   ++++   T   R  +G  R C   L             +T+L+I +++++  N + Q +L+   +GSN++ +G++LLKDL+   +WE TG FPRVT C   VR +G + +  +T+QCVL IN F EK+++FLWFWF+    +T+ +T+ W+    +P + + +VR+YL+ +    +    D     +F NN L  DGVF+L ++S+ A +L+S ++   LW++F     + T+
Sbjct:  123 LYYLASAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDAMEQYTENYCWVQNTYWVPMQEDIPREIYSRRN-RQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDR--QGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLAYGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHR--HTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNNVDRSPTQ 510          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 221.861 bits (564), Expect = 8.034e-65
Identity = 118/353 (33.43%), Postives = 195/353 (55.24%), Query Frame = 1
Query:  466 DFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRR----LPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWK 1512
            D  D+L+Y  T+ L+  F  +VS +QYVG  IQCW+P EF   WE+YAE+ C++ NT+F+    EIP D ++ +  + I YYQW+ IVLA QA + ++P   W    ++     P ++  A      D + R K V+ +V  + +  D   R++   G F     G    +  ++L+I +++M++ N   Q  ++ KF+G+   ++G+    DL AG++W+ +G FPRVT C   VR++  V +  YT+QCVL IN F EK+Y+F+WFWF+ +   T ++TL  ++       R +Y+R  L         E+   + F NN L  DGV L+  +   A  +++ ++   L+K
Sbjct:   22 DAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGGWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE-IGYYQWVPIVLAIQAFMFYLPSWIWSSLYKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDT--RSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLGNETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHR--YTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFK 369          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 208.379 bits (529), Expect = 1.685e-59
Identity = 120/391 (30.69%), Postives = 204/391 (52.17%), Query Frame = 1
Query:  451 GGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFL----LADQEIPVD--DKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADAT---------MRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDC---SRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNF--RQAKITGTEEDLSRL 1563
              E  D AD+ +YQ+TS L+     +++  QYVG+PIQCWVP +FT+ WE+YAE  C++  TYFL     ++ E+ V   D        + YYQWI IVL  QA L ++P + WR  +    + ++    A + +   ++K+        ++Q  AT         +  R    +F+     +     L  L+++V+I+++ N V Q +++  F+ + + M+GW   +DL+AG++WE TG FPRVT C   +  +  V    +++QCV+ IN   EKVYVF WFW + +  +T+ S   W    +L     +++  YL+      + +ER     + FV+  L PDGVF+  +V   + DL +  +   ++  +  R+A+    ++D S L
Sbjct:   15 SAESNDIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKEL--AAVSEASRKIKSNMS-----DDQVKATKFGRYFFKKLNFRNESPVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILTYFLETKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFSIMDLTSVH--DHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYRAREAEKAHKKDDDSAL 396          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q27295|EAT5_CAEEL (Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN=eat-5 PE=2 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 3.246e-59
Identity = 110/380 (28.95%), Postives = 210/380 (55.26%), Query Frame = 1
Query:  472 ADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPV----LLRSAREAVLPDRDLRVKAVSCMVASLEE------QADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERD--------------CSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNF--RQAKI 1533
             D+LNY +++ +I+     ++ RQYVG P+QCWVP +FTKAWE+YAE+ C+V NTY++  + ++P+  +E  + + I YYQW   ++A +A   ++P + W + S +  +    L+ +A++A   + + R K +  +   +          + T +  +++ IF     G+     +T +++V +++++ N+  Q Y   KF+G N+  +G  +L D+L G DWE +GNFPR+  C   VR +G +++  Y++QCVL +N F EK+++FL+ WF+L+  +T+  ++   +N     K V +++Q+L       + E++                S F  +   PD + LL ++++   D++  ++   +W  F  R AK+
Sbjct:   20 TDRLNYYYSTLIIMGMSLTITARQYVGSPLQCWVPAQFTKAWEQYAEDYCFVYNTYWVKPNDKVPLTVEERVSQQLI-YYQWAPFIMAIEAAFFYLPVIFWSMLSTKSGINIIKLVETAQKAEGAESEERKKQIDIICRHISNNLRKRRNEEETTKMAKIQRIF-----GMQHGKYITNVYLVTKLIYMTNSFLQFYSTNKFLGQNDPYWGMRILDDILKGTDWEHSGNFPRIAMCDFQVRVLGNLQR--YSIQCVLTLNMFNEKIFLFLYIWFLLVFFVTLFDSIFLCYNMFSSHKLVEFLQQFLDNQDQDENDEKKPEERKVYRKEQHSILLSEFCLHKFTPDIIILLKMINNHTGDIVCTEIVGRMWNEFLERDAKL 391          
BLAST of Innexin vs. TrEMBL
Match: A0A4E0RM26 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 638.262 bits (1645), Expect = 0.000e+0
Identity = 289/401 (72.07%), Postives = 353/401 (88.03%), Query Frame = 1
Query:  397 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 1599
            L++ GFVFK+GRLF+TPYGGEGVDF DQLNYQFT GL++IFI I+S+RQYVGKPIQCWVPQEFTK+WEEYAENLCWVSNTYFLL ++EIP D  +++ VK+I YYQW+VIVLAGQA+++WVPHL WRV SRRLP+LL+SAREA +PDR+LR+KAVSC+VA+LEEQA++  R RR+K +  RCL G+ PN RLT+LF+ VR +F+ N+VGQIYLM++F G N+ +FG  LL+DL AG +WE TG+FPRVTYCTI VR+MGQ K ASYTLQCVLPIN+F EK+YVFLWFWF+++  +T L+TLQW  NT+LPM+RVHY++QYLKA+RLI+STEERDC+RFVNN LG DGVF+LHVVS  ASDLI+LDVTATLWKN+RQAKITGTEED++RLLET NR GSS+V
Sbjct:    8 LLDGGFVFKLGRLFRTPYGGEGVDFVDQLNYQFTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVLAGQAMMAWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLSRCLCGVTPNARLTMLFLFVRTLFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFVILGVLTTLNTLQWALNTMLPMRRVHYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNR-GSSVV 407          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2LXE0 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 282/400 (70.50%), Postives = 351/400 (87.75%), Query Frame = 1
Query:  397 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSI 1596
            L++ GFVFK+GRLF+TPYGGEGVDF DQLNYQ+T GL++IFI I+S+RQYVGKPIQCWVPQEFTK+WEEYAENLCWVSNTYFLL ++EIP D  +++ VK+I YYQW+VIV+AGQALLSWVPHL WRV SRRLP+LL+SAREA +PDR+LR+KAVSC+VA+LEEQA++  R RR+K +  RCL G+ PN RLT LF++VR++F+ N+VGQIY+M++F G N+ +FG  LL+DL AG +WE TG+FPRVTYCTI VR+MGQ K ASYTLQCVLPIN+F EK+YVFLWFWF ++  +T L+TLQW  NT+LP++RV+Y++QYLKA+RLI+STEERDC+RFVNN LG DGVF+LHVVS  ASDLI+LDVTATLW+N+RQAKITGTEED++RLLET NR+ + +
Sbjct:    8 LLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQYTGGLMIIFIAIISLRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVVIVMAGQALLSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSLLNRCLCGVTPNARLTTLFLLVRMLFVANSVGQIYMMKRFTGFNSTLFGMKLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGILTTLNTLQWAMNTILPVRRVNYIKQYLKALRLISSTEERDCARFVNNTLGADGVFILHVVSKIASDLIALDVTATLWRNYRQAKITGTEEDVNRLLETVNRSSAVV 407          
BLAST of Innexin vs. TrEMBL
Match: A0A5K4F4I8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 623.239 bits (1606), Expect = 0.000e+0
Identity = 291/401 (72.57%), Postives = 349/401 (87.03%), Query Frame = 1
Query:  397 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 1599
            L++ GFVFK+GRLFKTPYGGEGVDF DQLNYQFT GL+VIFI I+S RQYVGKPIQCWVPQEFTK+WEEYAENLCWVSNTYFLL ++EIP D  +++ VK+I YYQW+ IVLAGQA++SWVPHL WRV SRRLP+LL+SAREA +PDR+LR+KAVSC+VA+LEEQA++  R RR+K I  RCL G+ PN RLT+LF+ VR +F+ N+VGQIYLM++F G N+ +FG  LL+DL AG +WE TG+FPRVTYCTI VR+MGQ K ASYTLQCVLPIN+F EK+YVFLWFWF ++  +T L+TLQW  NT+LP +RV Y++QYLKA+RLI+STEERDC+RFVNNNLG DGVF+LHVVS  ASDLI+LDVTATLWKN+RQAKITGTEED++RLLET NR GSS+V
Sbjct:    8 LLDGGFVFKLGRLFKTPYGGEGVDFIDQLNYQFTGGLMVIFIAIISFRQYVGKPIQCWVPQEFTKSWEEYAENLCWVSNTYFLLPNEEIPTDQVDYEKVKFIGYYQWVAIVLAGQAMMSWVPHLLWRVGSRRLPLLLKSAREAAIPDRELRLKAVSCLVATLEEQAESQSRFRRIKSILTRCLCGVTPNARLTMLFLFVRALFVANSVGQIYLMKRFTGFNSTVFGLRLLQDLSAGVEWERTGHFPRVTYCTIKVRKMGQTKPASYTLQCVLPINNFTEKIYVFLWFWFAILGLLTTLNTLQWALNTILPSRRVRYIKQYLKALRLISSTEERDCARFVNNNLGADGVFILHVVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNR-GSSVV 407          
BLAST of Innexin vs. TrEMBL
Match: A0A0X3P900 (Innexin OS=Schistocephalus solidus OX=70667 GN=UNC9 PE=3 SV=1)

HSP 1 Score: 594.349 bits (1531), Expect = 0.000e+0
Identity = 270/400 (67.50%), Postives = 343/400 (85.75%), Query Frame = 1
Query:  397 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSI 1596
            L++ GFVFK+GRLFKTPYGGEGVDF DQLNYQFT G+I+IFI I+S+RQYVGKPIQCWVP EFT+AWEEY EN CWVSNTYFLL  ++IP +D E K+ K+I YYQW+ IVLAGQA++SWVPHL WRV SRRLP+LL+SA+EA +PDR+LR+KAVSC+VA+LEEQA++  R RR+K    RCL G+ PN+RLT LF+ VR++F+ N+VGQIYLM+ F G N+ +FG  LLKDL  G+DW+ +G+FPRVTYC I VR MGQ K A+Y++QCVLPIN+F+EK+Y+FLWFWF+++  +T ++T+QW  NT LPM+RV+Y++QYLKA+RLI+STEERDC+RFVNN+LG DG+F+L +VS  ASDLI+LDVTATLWKN+R+AKITGTEED++RLLET NR  S++
Sbjct:    8 LLDGGFVFKLGRLFKTPYGGEGVDFIDQLNYQFTGGIILIFIIIISLRQYVGKPIQCWVPPEFTRAWEEYTENYCWVSNTYFLLPSEDIPAEDHELKSAKFIGYYQWMSIVLAGQAMMSWVPHLLWRVGSRRLPLLLKSAKEASIPDRELRLKAVSCLVATLEEQAESQSRFRRMKSFVNRCLCGIAPNSRLTFLFLFVRMLFLVNSVGQIYLMKSFTGFNSTLFGVNLLKDLTKGEDWDNSGHFPRVTYCNIKVRVMGQPKPATYSIQCVLPINNFVEKIYIFLWFWFVILCCLTTMNTIQWTINTALPMRRVYYIKQYLKALRLISSTEERDCTRFVNNSLGADGIFILQIVSKVASDLIALDVTATLWKNYRRAKITGTEEDVNRLLETVNRGSSAV 407          
BLAST of Innexin vs. TrEMBL
Match: A0A158QHF3 (Innexin OS=Rodentolepis nana OX=102285 GN=inx PE=3 SV=1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 275/401 (68.58%), Postives = 345/401 (86.03%), Query Frame = 1
Query:  397 LMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 1599
            L++ GFVFK+GRLF+TPYGGEGVDF DQLNYQFT GLI+IFI I+S+RQYVGKPIQCWVP EFT+AWEEY EN CWVSNTYFLL  ++IP ++ E++ +K+I YYQW+ IVLAGQA++SWVPHL WRV SRRLP+LL+SA+EA +PDR+LR+KAVSC+VA+LEEQA++  R RR+K    RCL G+ PN RLTVLF+ VR +FI N +GQIYLM+ F G N+  FG  LL+DL  G++W+ +G+FPRVTYC I VR MGQ K ASY+LQCVLPIN+F+EK+Y+FLWFWF+++  +TI++TLQW  NT+LP++RV+Y++QYLKA+RLI+STEERDC+RFVN NLG DG+F+LH+VS  ASDLI+LDVTATLWKN+RQAKITGTEED++RLLET NR GSS+V
Sbjct:    8 LLDGGFVFKLGRLFRTPYGGEGVDFIDQLNYQFTGGLILIFIIIISLRQYVGKPIQCWVPPEFTRAWEEYTENYCWVSNTYFLLPHEDIPAEELEYEKIKFIGYYQWMSIVLAGQAMMSWVPHLLWRVCSRRLPLLLKSAKEASIPDRELRLKAVSCLVATLEEQAESQSRFRRMKSFVNRCLCGIAPNARLTVLFLFVRALFIANCLGQIYLMKCFTGFNSTFFGLQLLQDLTKGEEWDTSGHFPRVTYCNIKVRVMGQPKPASYSLQCVLPINNFVEKIYIFLWFWFVILCSLTIMNTLQWTINTMLPVRRVYYIKQYLKALRLISSTEERDCTRFVNQNLGADGIFILHIVSKIASDLIALDVTATLWKNYRQAKITGTEEDVNRLLETVNR-GSSVV 407          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000068735.1 (SMESG000068735.1)

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 411/411 (100.00%), Postives = 411/411 (100.00%), Query Frame = 1
Query:  367 MARXXXXXXXLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 1599
            MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV
Sbjct:    1 MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 411          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000033444.1 (SMESG000033444.1)

HSP 1 Score: 558.525 bits (1438), Expect = 0.000e+0
Identity = 254/399 (63.66%), Postives = 332/399 (83.21%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSI 1596
            MESG  F+IG+LF+ PYGGEGVDF DQLNYQFTSGL+++FI I+ IRQYVGKPIQCWVPQEFT++WEEYAEN+CWV NTYFLL  +++P +D E   V+YISYYQW+ IVLAGQA++SWVPHL WRV SRR+P+LLRSAREA  PDR++R KA+SC+VA+LEEQ ++  R R++KGIF +CLGG+ P  R+T+LFI VRI+FI N VGQI++M+KF+G+N   FG T+ +DLL G + +++  FPRVTYCTI VR+MGQ+K  SYTLQCVLPIN+F+EKVYVFLWFWFI+++ +T L+T+QW  N  LP++RV +VRQYLKA+++ITST+ERDC RFV  NLG DG+FLL  VS  +SDLI+LDVT TLW N+++AK+ G E+D+ R++++ NR+ + +
Sbjct:    1 MESGIFFRIGQLFRVPYGGEGVDFVDQLNYQFTSGLLIVFIIIIGIRQYVGKPIQCWVPQEFTRSWEEYAENVCWVQNTYFLLPHEDVPNNDFELSKVRYISYYQWVAIVLAGQAVMSWVPHLIWRVWSRRVPILLRSAREASFPDREIRRKAISCLVAALEEQTESGARFRKIKGIFGKCLGGVNPTARVTLLFIFVRILFIANNVGQIFMMKKFIGTNETTFGITVFRDLLNGNEGQISETFPRVTYCTIKVRKMGQIKPGSYTLQCVLPINYFVEKVYVFLWFWFIILSILTTLNTVQWTLNVCLPLRRVQFVRQYLKALKVITSTDERDCVRFVRKNLGCDGIFLLQSVSRISSDLIALDVTGTLWNNYKRAKLAGNEDDIHRIIDSVNRSSTVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000051126.1 (SMESG000051126.1)

HSP 1 Score: 507.294 bits (1305), Expect = 5.085e-177
Identity = 230/402 (57.21%), Postives = 311/402 (77.36%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVK-GIFRR-CLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 1599
            ME+    KIG+ F T YGG  +DF DQLNYQ+++GL+ IFI+I+  RQYVGKPIQCWVPQ+FTK+WEEYAENLCW+ +TY LL +++IP DD E  ++KYISYYQW+ IV+ GQA++S++PHL WR+ S+RLP+LL++AREA +PDR++R KA+ C+V  LEE  +A +R RR + GIF R       P+TRLT+LF+ VR +FI N +GQIYLM+ F+ +NN  FG  ++ DLL G +W+  GNFPR+TYCTI VR+ GQ+KQAS+T QCVLPINHF+EK+YVFLW WF L+A +T L+TLQW     LP K+  ++++YLKA++LI+++E R+C RFV  NLG DG+F+L  VS  +SDLI+LDVTATLW N+RQAK+ G E+D++R +ET  +   +IV
Sbjct:    1 METNTFLKIGKHFHTAYGGNDIDFVDQLNYQYSTGLLFIFISIIGFRQYVGKPIQCWVPQQFTKSWEEYAENLCWIQSTYKLLDNEDIPEDDFEIHSLKYISYYQWVAIVMGGQAIMSYLPHLIWRLWSKRLPILLKTAREASIPDREMRAKAIQCIVTKLEEGTEAQIRYRRGEPGIFTRYVFFCFNPSTRLTILFLFVRTLFILNNIGQIYLMKNFIKTNNTWFGIKVISDLLKGYEWKDYGNFPRITYCTINVRKFGQIKQASHTFQCVLPINHFVEKIYVFLWLWFTLLAVLTTLNTLQWGLIVCLPWKQTQFIQRYLKALKLISNSEGRECQRFVARNLGCDGIFVLQAVSKVSSDLIALDVTATLWTNYRQAKLNGAEDDITRYMETSLKTNLNIV 402          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000027007.1 (SMESG000027007.1)

HSP 1 Score: 494.197 bits (1271), Expect = 6.758e-172
Identity = 226/400 (56.50%), Postives = 303/400 (75.75%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLLETYNRAGSSIV 1599
            M +G   KI R FK PYGG  VDF DQLNYQFTSGL+ +F+ I+  RQY+GKPIQCWVPQEFTKAWEEYAENLCWV NTYFL  +++IP  D E   +KYISYYQW+ IVL+GQAL+SW+P+L WR+ S+++ VLL SA+EA +PD  +R KAVS +V +LEEQ+    +  + KGI RR L  + P  R+T +FIVVRI+F+ N  GQI +M+ F+GS++ MFG+ + + LL    W+++  FPRVTYCT+ VR++GQ++  SYTLQCVLP+N+F+EKVYVFLWFWFI++  +T +ST QW+ N  +P  RV ++RQYLKA+++I+  EE+DC+RFVN  LG DG+FLLH VS  +SDLI+LDV   LW+NF+ AK  G E DL+ L+++ +R G ++V
Sbjct:    1 MNAGIFLKIIRFFKVPYGGADVDFVDQLNYQFTSGLLAVFVIIIGFRQYMGKPIQCWVPQEFTKAWEEYAENLCWVQNTYFLSPEEDIPRTDVELNKMKYISYYQWVAIVLSGQALMSWIPYLVWRLFSQKVIVLLNSAKEASIPDWSVRRKAVSYLVNALEEQSQINNQFYKRKGIVRRYLTEINPAYRITFIFIVVRILFVTNCFGQIIIMRIFIGSSDFMFGYNVFQYLLRNHQWQISETFPRVTYCTVKVRKLGQLRPGSYTLQCVLPVNYFVEKVYVFLWFWFIILGVLTTISTAQWIANVCIPPWRVQFIRQYLKALKVISGPEEKDCNRFVNKKLGCDGIFLLHSVSKLSSDLIALDVAGHLWQNFKMAKSQGNEVDLNNLIQSIHR-GPNVV 399          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000032206.1 (SMESG000032206.1)

HSP 1 Score: 457.218 bits (1175), Expect = 1.559e-157
Identity = 203/386 (52.59%), Postives = 285/386 (73.83%), Query Frame = 1
Query:  400 MESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVIFITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIPVDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSAREAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNTRLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWELTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFILIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVNNNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLS 1557
            M+S  + K+GR+F++P GG+GV F D LNYQ++S ++V+FI I+  RQY+GKPIQCWVPQEFT+AWE+YAEN+CWV NTYFL  ++ +P  D E  + ++ISYYQWIVIV+  QA+L ++P + WRV SRR PVLLR+++EA+LPDR+LR KAV+C+VA+LEEQA    R R+      + L GL P   L                 Q+YLM+ F+G+N+  FG  + +D+LAG DW+++G+FPRVT+C + +R+MGQ+K A YTLQCVLPIN+F+EK+Y FLWFWF+ +A  T  +TLQW  +  +  ++V +V  YLKA++ ++STEERDC RFV   LG DG+FLL  V++ ASDL++LDVT  +W+N++ AK+TGTEED++
Sbjct:    1 MDSDSILKLGRIFRSPLGGDGVSFIDVLNYQYSSAVLVVFIAIIGTRQYIGKPIQCWVPQEFTRAWEDYAENICWVQNTYFLPPEKAVPDSDVELHSAEFISYYQWIVIVMGAQAVLCYLPQIIWRVGSRRFPVLLRNSKEAILPDRELRRKAVACLVAALEEQAIRNCRFRKNNSTIYKLLCGLGPGAELR----------------QLYLMRDFLGTNHTTFGVMIFQDILAGHDWKVSGHFPRVTFCPVEIRKMGQIKPAIYTLQCVLPINYFVEKIYAFLWFWFVSLACATSFNTLQWFIDLFVKNRQVVFVSNYLKALKQLSSTEERDCGRFVEVVLGNDGIFLLRAVANVASDLMALDVTGIMWRNYKHAKVTGTEEDMA 370          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-17.887e-9236.95Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-17.887e-9236.95Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-13.360e-9037.33Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-91.218e-8138.40Innexin unc-9 [Source:UniProtKB/Swiss-Prot;Acc:O0... [more]
unc-72.978e-7934.61Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx27.780e-2124.93gene:FBgn0027108 transcript:FBtr0301860[more]
Inx27.780e-2124.93gene:FBgn0027108 transcript:FBtr0071005[more]
Inx27.780e-2124.93gene:FBgn0027108 transcript:FBtr0332314[more]
Inx27.780e-2124.93gene:FBgn0027108 transcript:FBtr0071006[more]
shakB4.218e-1924.86gene:FBgn0085387 transcript:FBtr0112571[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL1.549e-8038.40Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL1.116e-7634.86Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL8.034e-6533.43Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23027|INX5_CAEEL1.685e-5930.69Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q27295|EAT5_CAEEL3.246e-5928.95Innexin eat-5 OS=Caenorhabditis elegans OX=6239 GN... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4E0RM260.000e+072.07Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A4S2LXE00.000e+070.50Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
A0A5K4F4I80.000e+072.57Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0X3P9000.000e+067.50Innexin OS=Schistocephalus solidus OX=70667 GN=UNC... [more]
A0A158QHF30.000e+068.58Innexin OS=Rodentolepis nana OX=102285 GN=inx PE=3... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000068735.10.000e+0100.00SMESG000068735.1[more]
SMESG000033444.10.000e+063.66SMESG000033444.1[more]
SMESG000051126.15.085e-17757.21SMESG000051126.1[more]
SMESG000027007.16.758e-17256.50SMESG000027007.1[more]
SMESG000032206.11.559e-15752.59SMESG000032206.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026015 ID=SMED30026015|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1803bp
ATACTCAGCCTTCGTTACTCAGTTTAGGTATGGAATTATCTTGCTTGCTG
CTTGTCTTGCACTGCTGCATATTTTGAAATTTTTTTTGAATAACACTACT
GCAACTGGTACCCTCCTTGTTAGATTGAATATTATTGATTTGTGGCTCAA
ATTATCCGTCAATATCTGCTGTGAATATTGAATTCTAATATTCTTTTACT
GTGCAACTTTGTCTAATGGCCATTTATTCTATATTCTATCAAATCATATC
TTACAAACTGTAATGACACAAAATTTGACTAATAACCAATCTTTGAACAA
TATTCAATTCAAACTGGATTTTTCGATATTTTGCCAATAATTTTCGTTTG
TTTTGGATTTTGAAAAATGGCAAGAGGAGCCGGAGGTGGTGGTGGATTAA
TGGAAAGTGGATTTGTATTCAAAATTGGTCGACTTTTTAAAACTCCATAT
GGAGGTGAAGGAGTCGACTTCGCAGATCAATTAAATTATCAGTTTACTAG
TGGATTGATTGTTATTTTCATTACTATTGTCAGTATTCGCCAATATGTCG
GAAAACCAATTCAATGTTGGGTACCTCAGGAATTCACAAAAGCCTGGGAA
GAATACGCTGAAAATCTATGTTGGGTTTCAAATACTTATTTTTTATTGGC
CGATCAGGAAATACCCGTGGATGATAAAGAATTTAAGAATGTCAAATATA
TCAGCTATTATCAATGGATAGTTATAGTATTGGCTGGACAGGCCCTTTTA
TCCTGGGTTCCGCACCTGGCTTGGAGAGTAGCGTCGAGGAGACTACCTGT
ACTCCTAAGATCAGCTAGAGAAGCAGTGCTTCCAGATCGAGATTTACGCG
TAAAAGCAGTTTCTTGTATGGTCGCCTCACTGGAAGAACAAGCTGATGCT
ACAATGCGAGCTCGCAGGGTAAAGGGAATTTTTCGGCGGTGTTTGGGGGG
TTTGCCCCCAAACACAAGATTGACAGTCTTATTTATTGTTGTGAGAATTA
TGTTTATTGGAAATGCAGTCGGTCAGATTTATCTGATGCAGAAATTCGTT
GGATCCAATAATATCATGTTTGGCTGGACTCTTCTCAAAGATTTGCTAGC
AGGACAGGATTGGGAATTAACTGGGAATTTTCCCAGAGTCACATATTGTA
CTATATTAGTTAGGCGAATGGGTCAGGTCAAACAAGCTAGTTACACTCTT
CAGTGTGTTCTACCTATCAATCATTTTATCGAAAAGGTTTATGTCTTTCT
CTGGTTCTGGTTTATCCTCATCGCTGGTATCACAATTCTTAGCACTCTTC
AGTGGATGTTCAATACTTTACTCCCAATGAAAAGGGTTCATTACGTTCGT
CAATACCTCAAAGCTATGCGACTTATCACTAGTACAGAAGAAAGAGATTG
TAGCAGATTTGTCAACAATAATCTCGGACCCGATGGGGTATTTTTGTTGC
ATGTTGTTTCAAGTACGGCTAGTGATTTAATTTCACTTGATGTGACCGCT
ACATTATGGAAAAATTTCCGCCAAGCGAAAATCACAGGAACTGAAGAGGA
TTTAAGTCGCTTACTAGAGACATATAACAGAGCTGGATCTAGTATTGTGT
GACCTCTCAGTCATTTAGCTAGTATTCCTCCTCTATAATTTATATATATA
TATATATTTTATATTTATCATTTTAGAACTTTTGGCTAATTGAATACTAC
TTATCATGAATAGTCAATATTTATATTTCAGCAACTCTGATATATTCTCA
TTTAGATTTTTCTCTAATATTTCGTTATAGATTTGTTCAATTTCTTGAAC
ATG
back to top

protein sequence of SMED30026015-orf-1

>SMED30026015-orf-1 ID=SMED30026015-orf-1|Name=SMED30026015-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=412bp
MARGAGGGGGLMESGFVFKIGRLFKTPYGGEGVDFADQLNYQFTSGLIVI
FITIVSIRQYVGKPIQCWVPQEFTKAWEEYAENLCWVSNTYFLLADQEIP
VDDKEFKNVKYISYYQWIVIVLAGQALLSWVPHLAWRVASRRLPVLLRSA
REAVLPDRDLRVKAVSCMVASLEEQADATMRARRVKGIFRRCLGGLPPNT
RLTVLFIVVRIMFIGNAVGQIYLMQKFVGSNNIMFGWTLLKDLLAGQDWE
LTGNFPRVTYCTILVRRMGQVKQASYTLQCVLPINHFIEKVYVFLWFWFI
LIAGITILSTLQWMFNTLLPMKRVHYVRQYLKAMRLITSTEERDCSRFVN
NNLGPDGVFLLHVVSSTASDLISLDVTATLWKNFRQAKITGTEEDLSRLL
ETYNRAGSSIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 56..67
score: 56.67
coord: 280..296
score: 58.59
coord: 114..136
score: 44.52
coord: 254..263
score: 56.8
coord: 206..220
score: 25.07
coord: 84..93
score: 50.0
IPR000990InnexinPFAMPF00876Innexincoord: 34..384
e-value: 3.6E-104
score: 348.8
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 24..396
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 28..390
score: 31.686
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 38..57
NoneNo IPR availableTMHMMTMhelixcoord: 114..136
NoneNo IPR availableTMHMMTMhelixcoord: 293..315