Neuronal acetylcholine receptor subunit alpha-6

Overview
NameNeuronal acetylcholine receptor subunit alpha-6
Smed IDSMED30026006
Length (bp)1352
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-6 (SMED30026006) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-6 (SMED30026006) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-6 (SMED30026006) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-6 (SMED30026006) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30026006

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30026006SMESG000047472.1 SMESG000047372.1 SmedASXL_007252SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30026006SMESG000047472.1 SMESG000047372.1 dd_Smed_v6_30253_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 215.698 bits (548), Expect = 5.797e-64
Identity = 119/301 (39.53%), Postives = 187/301 (62.13%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            Q   + K+ + + ++YN   RP +N SQP+T+   ++L+ I D+DEKN++LTT +WL   W D  L WN S Y  V  +R P  +IW PDI+L+NS  E+F     + V + ++G   + P     S C +D+ +FPFD Q C L  GSW+Y    LD L+++   D+S  I +GEW++     KR++RF+    E Y +++F + ++RR LYY +N+  PC+++S L L+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLI  Y    M +  +SV++ V+V++ HH 
Sbjct:   22 QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLD-LQMQ-EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHH 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 215.698 bits (548), Expect = 5.797e-64
Identity = 119/301 (39.53%), Postives = 187/301 (62.13%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            Q   + K+ + + ++YN   RP +N SQP+T+   ++L+ I D+DEKN++LTT +WL   W D  L WN S Y  V  +R P  +IW PDI+L+NS  E+F     + V + ++G   + P     S C +D+ +FPFD Q C L  GSW+Y    LD L+++   D+S  I +GEW++     KR++RF+    E Y +++F + ++RR LYY +N+  PC+++S L L+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLI  Y    M +  +SV++ V+V++ HH 
Sbjct:   22 QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLD-LQMQ-EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHH 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 215.698 bits (548), Expect = 8.801e-64
Identity = 110/304 (36.18%), Postives = 187/304 (61.51%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            E ++ +++FR YNR  RP  N+S  V ++ G+++  + D+DEKN+++TT VWL QEW D +L WN +++ ++  +R P   IW+PDIVL+N+   +F     +   +++ G + W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL    E GEW I N +     + +    E Y ++++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR      +
Sbjct:   37 EDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTM 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 215.698 bits (548), Expect = 1.414e-63
Identity = 110/304 (36.18%), Postives = 187/304 (61.51%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            E ++ +++FR YNR  RP  N+S  V ++ G+++  + D+DEKN+++TT VWL QEW D +L WN +++ ++  +R P   IW+PDIVL+N+   +F     +   +++ G + W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL    E GEW I N +     + +    E Y ++++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR      +
Sbjct:   59 EDRLFKHLFRGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTM 362          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 215.312 bits (547), Expect = 1.622e-63
Identity = 119/305 (39.02%), Postives = 187/305 (61.31%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQN 1052
            Q   + K+ + + ++YN   RP +N SQP+T+   ++L+ I D+DEKN++LTT +WL   W D  L WN S Y  V  +R P  +IW PDI+L+NS  E+F     + V + ++G   + P     S C +D+ +FPFD Q C L  GSW+Y    LD L+++   D+S  I +GEW++     KR++RF+    E Y +++F + ++RR LYY +N+  PC+++S L L+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLI  Y    M +  +SV++ V+V++ HH     
Sbjct:   51 QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLD-LQMQ-EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDG 353          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 224.557 bits (571), Expect = 8.728e-68
Identity = 116/303 (38.28%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  147 QEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            QE ++ +++ R+YN   RP +N S+PVT+ L + L  I D+DEKN+++    WL+  W D  L W+ + Y ++  +R P  KIW PD++L+NSV   F    ++ + +Y+ G + W P       C++DI +FPFD+Q C    GSW Y   +LD+       D+S  I +GEW +  T+ +R ++F+    E Y ++ F L ++RR LYY  N+  PCI+ +++TL+GF LPP++GEK+TL +TVLL   FFL +V+E  P TSE  PL+GI+ T  M + + S +  V V+ +H+R  +  
Sbjct:   22 QERRLYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETH 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 211.075 bits (536), Expect = 5.237e-63
Identity = 115/324 (35.49%), Postives = 194/324 (59.88%), Query Frame = 3
Query:  105 FIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTK--IWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDI-----LKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
             + + S L +G  + E K+  ++ + YN   RP  NSSQP+ +K+ + L  I D+DEKN+I++   WL+  W D +L W    Y  +  IR P +   IW PD++L+NS  E F    KS +  Y+ G ++W P   +   C+LD+++FPFDDQ+C +  GSW +    +D+          ++DLS+ + +GEW + +T++KR   ++    E Y  +++ L ++RR LYY  N+  P +++S++ ++GF+ PP++GEK+TL +T+LL   FFL MV+E  P TSE  PLIG++ +  M + S SV+  ++V+ +H R + + 
Sbjct:   12 LVIIHSNLCDGSVA-ETKLFTDLLKGYNPLERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQIDDDTNGTQSMDLSTYLVNGEWQVISTNAKRVVSYYKCCPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSH 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 201.83 bits (512), Expect = 4.956e-59
Identity = 116/339 (34.22%), Postives = 200/339 (59.00%), Query Frame = 3
Query:  117 FSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPN----------------------IDLSSLIEHGEWNIFNTSSKRTDRFHPST--NETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            F  L+EG +  + ++  ++  +YNR+ RPS++ ++P+TIKL + L  I D+ E ++I+T  VWL Q W+D +L+W+  NY  V+ +  P   IW+PDIVL+N+    +     +  T++  G++ W+P     S C++D+ +FPFD+Q C L  GSW +S++ L +   +P+                      IDLS      EW+I +  +KR  + +PS      Y ++++ LQL+R+ L+Y +N+ FPC+ +S LT++ F LP +SGEKVTL +++L+  + F L++TE +PATS   PLIG Y+   M + ++SV++ V+ + +H R     ++
Sbjct:   17 FIKLTEGNEDAK-RLYDDLMVNYNRHRRPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTVAEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLM 354          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-9 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q18556])

HSP 1 Score: 200.675 bits (509), Expect = 2.294e-58
Identity = 123/327 (37.61%), Postives = 194/327 (59.33%), Query Frame = 3
Query:  114 LFSCLSEGQKS-QEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTP--CTKIWLPDIVLFNSVQEKF-TEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKP--------NIDLSSLIEHGEWNIFNTSSKR-TDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            LF  L+E   S  EY++L ++  +Y+   RP +N+S+P+ + + I L  I D+DEKN+++T + W+  +W D +L W+ S Y  +  IR P     IW PD++L+NS  E F + Y  + V  Y  G ++  P   +   C++DI+YFPFDDQIC L  GSW YS + +D+    P         ID+   +++GEWN+    ++  T+ F     + Y  + F L ++RR LYY +N+  P  ++S++T++GF LPP++GEK+TL +T+LL   FFL MV +  P TSE  PLIG + +  M + S SV+  VLV+ +H+RK +  
Sbjct:   15 LFHLLTEVHSSADEYRLLADLRHNYDPYERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWIEYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSY-TGDVLQVPPGILKLSCKIDITYFPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEGIDVQYYVQNGEWNLLAVPARHETNIF---DEQPYPSLFFYLIIQRRTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASVVFTVLVLNLHNRKPETH 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Match: acr-19 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:B3WFZ2])

HSP 1 Score: 200.29 bits (508), Expect = 4.298e-58
Identity = 109/316 (34.49%), Postives = 174/316 (55.06%), Query Frame = 3
Query:  102 FFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQ 1049
            FF  LF  +  G    E ++   +  +YN+  RP  N S+ V + LG+    I D+DEK++I+ + VWL   W D  L W+ S + ++ ++R P   IW PD++L+NSV ++F         +   G + W P   + S C +DI+YFPFD Q C +  GSW YS    D++     I  ++   +GEW +   +S+R+  F+    E Y +++F + ++RR LYY  N+  PC+++S L L+ F LP + GEK+ L +T+ +    F++MV E MP TS+  PLI IY +  M     SV+  V+ +  HHR  +
Sbjct:   11 FFFALFRVIWTGD--HERRLYAKLAENYNKLARPVRNESEAVVVLLGMDYQQILDIDEKHQIMNSNVWLRMSWTDHYLTWDPSEFGNIKEVRLPINNIWKPDVLLYNSVDQQFDSTWPVNAVVLYTGNVTWIPPAIIRSSCAIDIAYFPFDTQHCTMKFGSWTYSGFFTDLINT--TISPATYKPNGEWELLGLTSQRSIFFYECCPEPYYDVTFTVSIRRRTLYYGFNLLLPCMLISSLALLSFTLPADCGEKLNLGVTIFMSLCVFMIMVAEAMPQTSDALPLIQIYFSCIMFQVGASVVATVIALNFHHRSPE 322          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0331284)

HSP 1 Score: 233.802 bits (595), Expect = 3.426e-71
Identity = 127/318 (39.94%), Postives = 189/318 (59.43%), Query Frame = 3
Query:   99 IFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLD-ILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQ 1049
            +  IFL       Q   E ++L ++   YN   RP +N S+P+ +K G+TL  I D+DEKN+ILTT  WLN EW D  L WN + Y  V  +R    K+W PD++++NS  E F     + + + +NG  ++ P     S C++DI++FPFDDQ C +  GSW Y  +QLD +L  +   DLS  I +GEW +     K+    +    E Y +I+F +Q++RR LYY  N+  PC+++S + L+GF LPP+SGEK+TL +T+LL  + FL +V E MP TS+  PLIG Y    M + + SV++ V+V+  HHR + 
Sbjct:   13 VLLIFLAIIKESCQGPHEKRLLNHLLSTYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTAD 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079912)

HSP 1 Score: 231.106 bits (588), Expect = 8.299e-70
Identity = 119/296 (40.20%), Postives = 178/296 (60.14%), Query Frame = 3
Query:   99 IFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLD-ILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINM 983
            +  IFL       Q   E ++L ++   YN   RP +N S+P+ +K G+TL  I D+DEKN+ILTT  WLN EW D  L WN + Y  V  +R    K+W PD++++NS  E F     + + + +NG  ++ P     S C++DI++FPFDDQ C +  GSW Y  +QLD +L  +   DLS  I +GEW +     K+    +    E Y +I+F +Q++RR LYY  N+  PC+++S + L+GF LPP+SGEK+TL +T+LL  + FL +V E MP TS+  PLIG+ I +++
Sbjct:   13 VLLIFLAIIKESCQGPHEKRLLNHLLSTYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGVTILLSL 308          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079915)

HSP 1 Score: 228.794 bits (582), Expect = 2.574e-69
Identity = 124/318 (38.99%), Postives = 188/318 (59.12%), Query Frame = 3
Query:   99 IFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLD-ILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQ 1049
            +  IFL       Q   E ++L ++   YN   RP +N S+P+ +K G+TL  I D+DEKN+ILTT  WLN EW D  L WN + Y  V  +R    K+W PD++++NS  E F     + + + +NG  ++ P     S C++DI++FPFDDQ C +  GSW Y  +QLD +L  +   DLS  I +GEW +     K+    +    E Y +I+F +Q++RR LYY  N+  PC+++S + L+GF LPP+SGEK+TL +T+LL  + FL +V E +P  S+  PL+G Y    M + + SV++ V+V+  HHR + 
Sbjct:   13 VLLIFLAIIKESCQGPHEKRLLNHLLSTYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQILTTNAWLNLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAETLPQVSDAIPLLGTYFNCIMFMVASSVVLTVVVLNYHHRTAD 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0303898)

HSP 1 Score: 228.794 bits (582), Expect = 2.801e-69
Identity = 124/318 (38.99%), Postives = 189/318 (59.43%), Query Frame = 3
Query:   99 IFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLD-ILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQ 1049
            +  IFL       Q   E ++L ++   YN   RP +N S+P+ +K G+TL  I D+DEKN++L T +WL+ EW D  L WN + Y  V  +R    K+W PD++++NS  E F     + + + +NG  ++ P     S C++DI++FPFDDQ C +  GSW Y  +QLD +L  +   DLS  I +GEW +     K+    +    E Y +I+F +Q++RR LYY  N+  PC+++S + L+GF LPP+SGEK+TL +T+LL  + FL +V E MP TS+  PLIG Y    M + + SV++ V+V+  HHR + 
Sbjct:   13 VLLIFLAIIKESCQGPHEKRLLNHLLSTYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTAD 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Match: nAChRalpha6 (gene:FBgn0032151 transcript:FBtr0079916)

HSP 1 Score: 228.794 bits (582), Expect = 2.801e-69
Identity = 124/318 (38.99%), Postives = 189/318 (59.43%), Query Frame = 3
Query:   99 IFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLD-ILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQ 1049
            +  IFL       Q   E ++L ++   YN   RP +N S+P+ +K G+TL  I D+DEKN++L T +WL+ EW D  L WN + Y  V  +R    K+W PD++++NS  E F     + + + +NG  ++ P     S C++DI++FPFDDQ C +  GSW Y  +QLD +L  +   DLS  I +GEW +     K+    +    E Y +I+F +Q++RR LYY  N+  PC+++S + L+GF LPP+SGEK+TL +T+LL  + FL +V E MP TS+  PLIG Y    M + + SV++ V+V+  HHR + 
Sbjct:   13 VLLIFLAIIKESCQGPHEKRLLNHLLSTYNTLERPVANESEPLEVKFGLTLQQIIDVDEKNQLLITNLWLSLEWNDYNLRWNETEYGGVKDLRITPNKLWKPDVLMYNSADEGFDGTYHTNIVVKHNGSCLYVPPGIFKSTCKIDITWFPFDDQHCEMKFGSWTYDGNQLDLVLNSEDGGDLSDFITNGEWYLLAMPGKKNTIVYACCPEPYVDITFTIQIRRRTLYYFFNLIVPCVLISSMALLGFTLPPDSGEKLTLGVTILLSLTVFLNLVAESMPTTSDAVPLIGTYFNCIMFMVASSVVLTVVVLNYHHRTAD 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 230.335 bits (586), Expect = 2.160e-69
Identity = 123/313 (39.30%), Postives = 191/313 (61.02%), Query Frame = 3
Query:  102 FFIFLFSCL-SEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            FF+ L  C  + G  +Q  K+L ++F +Y   +RP  ++   + + L ITL  I D+DE+N+ILT  +W+ Q W+D  L WN  NY+ +D IR P + +W PDIVL+NS  + FT    + V I ++G+++W       S C++D+S+FPFD Q C L+ GSW Y+ +QLDIL    + DL+ L+++ EW +    +KR    +    + Y ++++ L+LKRR  +Y+ N+  PC+M+S L  +GF LP +SGEKV+L +TV+L  + F L+V E MP  SE  PLIG Y    M + + S  + + V+ IHH
Sbjct:   10 FFLSLLVCWGANGIYAQ--KLLNDLFNNYTSALRPVEDTEDILNVTLQITLSQIIDMDERNQILTAYLWIRQVWIDKYLTWNKENYDGLDTIRIPGSYVWRPDIVLYNSADDHFTSTMDTNVVIRHDGQIMWDAPAITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGNQLDILNAMESADLADLVDNVEWEVLGMPAKRNIILYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFVMNIHH 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 227.639 bits (579), Expect = 2.215e-68
Identity = 117/294 (39.80%), Postives = 182/294 (61.90%), Query Frame = 3
Query:  156 KILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            K+L ++F +Y   +RP  ++   + + L ITL  I D+DE+N+ILT  +W+ Q W+D  L WN  NY+ +D IR P + +W PDIVL+NS  + FT    + V I ++G+++W       S C++D+S+FPFD Q C L+ GSW Y+ +QLDIL    + DL+ L+++ EW +    +KR    +    + Y ++++ L+LKRR  +Y+ N+  PC+M+S L  +GF LP +SGEKV+L +TV+L  + F L+V E MP  SE  PLIG Y    M + + S  + + V+ IHH
Sbjct:   32 KLLNDLFNNYTSALRPVEDTEDILNVTLQITLSQIIDMDERNQILTAYLWIRQVWIDKYLTWNKENYDGLDTIRIPGSYVWRPDIVLYNSADDHFTSTMDTNVVIRHDGQIMWDAPAITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGNQLDILNAMESADLADLVDNVEWEVLGMPAKRNIILYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFVMNIHH 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: CR847523.3 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101882637])

HSP 1 Score: 223.402 bits (568), Expect = 6.369e-67
Identity = 117/306 (38.24%), Postives = 193/306 (63.07%), Query Frame = 3
Query:  123 CLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIW-QPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            CL   Q    +K+L+++F +Y   +RP  +++  + + L ITL  I D+DE+N+ILTT +W+ Q W D  L WN ++Y+ +D IR P + +W PD+VL+N+  ++F+   ++ V I ++G+++W QP +T  S C++D+S+FPFD Q C L+ GSW ++ +Q+D+     + DL+  +E+ EW +    +K+    +   ++ Y +I++ L LKRR  +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH
Sbjct:    9 CLC-AQGRYAFKLLKDLFVNYTSALRPVEDTNNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWFDAYLTWNTTDYDGLDTIRIPSSYVWRPDVVLYNNADDQFSSSMETNVVIRHDGQIMWDQPAITKSS-CKVDVSFFPFDVQHCRLTFGSWTHNGNQMDLHNALDSADLADFVENVEWEVQGMPAKKNVILYGCCSDPYPDITYTLHLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHH 311          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: chrna2b (cholinergic receptor, nicotinic, alpha 2b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-041001-99])

HSP 1 Score: 218.779 bits (556), Expect = 8.317e-65
Identity = 118/316 (37.34%), Postives = 193/316 (61.08%), Query Frame = 3
Query:  120 SCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRK-SQNEVLC 1064
            SC  +     E ++ + +F  YN+  RP  N+S  V +K G+++  + D+DEKN+++TT VWL QEW D +L W  S+Y++V  IR P   IW+PDIVL+N+   +F     +   +++ GK+ W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL    E GEW I N       + +   +E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR  S +++ C
Sbjct:   25 SCCEKTHSHAEDELFKKLFDGYNKWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENTVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPC 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Match: si:ch211-39a7.1 (si:ch211-39a7.1 [Source:ZFIN;Acc:ZDB-GENE-060503-606])

HSP 1 Score: 218.394 bits (555), Expect = 2.270e-64
Identity = 122/301 (40.53%), Postives = 187/301 (62.13%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            Q   +  +L+N+ + YNR  RP +N SQP+T+ L ++L+ I D+DEKN++LTT +WLN  W D  L WN S Y  V  +R    ++W PDI+L+NS  +KF    KS V + ++G   + P     S C +D+ +FPFD Q C L  GSW +    LD L++    D+S  + +GEW++      R + F+    E Y +++F++ ++RR LYY +N+  PC++LS +TL+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLIG Y    M +  +SVI  V+V++ HH 
Sbjct:   21 QGPYQRTLLKNLLKDYNRMERPVANDSQPLTVFLSMSLIQIMDVDEKNQVLTTNIWLNMHWYDHYLQWNQSEYPGVKNLRFTTDQVWTPDILLYNSADDKFDSTFKSNVVVNSSGYCNYLPPGIFMSTCNVDVRWFPFDIQKCELKFGSWTFDGWLLD-LQMN-EADISGYMPNGEWDLVGVPGTRNELFYDCCKEPYPDVTFVVTIRRRTLYYALNLLIPCVLLSSMTLLIFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSIPLIGQYFASIMIIVGMSVIATVVVLQYHHH 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 228.794 bits (582), Expect = 5.118e-69
Identity = 121/307 (39.41%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  120 SCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            SC+   +   E ++ + +F  YNR  RP  N+S  V +K G+++  + D+DEKN+++TT VWL QEW D +L WN ++Y++V  IR P   IW+PDIVL+N+   +F     +   +++NGK+ W P     S C +D+++FPFD Q C +  GSW Y K  LD+  ++ N+DL    E GEW I N   K   + +    E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR
Sbjct:   22 SCMERTRTHAEERLFKRLFTGYNRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESMERNVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHR 328          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 228.794 bits (582), Expect = 7.277e-69
Identity = 121/307 (39.41%), Postives = 190/307 (61.89%), Query Frame = 3
Query:  120 SCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            SC+   +   E ++ + +F  YNR  RP  N+S  V +K G+++  + D+DEKN+++TT VWL QEW D +L WN ++Y++V  IR P   IW+PDIVL+N+   +F     +   +++NGK+ W P     S C +D+++FPFD Q C +  GSW Y K  LD+  ++ N+DL    E GEW I N   K   + +    E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR
Sbjct:   22 SCMERTRTHAEERLFKRLFTGYNRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESMERNVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHR 328          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: prepl (prolyl endopeptidase-like [Source:Xenbase;Acc:XB-GENE-981635])

HSP 1 Score: 223.016 bits (567), Expect = 1.106e-66
Identity = 115/301 (38.21%), Postives = 183/301 (60.80%), Query Frame = 3
Query:  135 GQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
             Q    YK++ ++F +Y+  +RP  +  + + + L +TL  I D+DE+N+IL   +W+ Q W D  L WN  +Y+ +D IR P + +W PDIVL+N+  ++FT   ++ V I  +G+++W       S C++D+S+FPFD Q C L+ GSW Y+ +Q+DIL      DL+  +E+ EW I    +K++   +   +E Y ++++ L LKRR  +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH
Sbjct:   20 AQGRFAYKLMNDLFANYSNALRPVEDMDKAMNVTLQVTLSQIIDMDERNQILMAYLWIRQVWFDAYLRWNKEDYDGLDTIRIPSSYVWRPDIVLYNNADDQFTGSMETNVVIRYDGQIMWDSPAITKSSCKVDVSFFPFDGQQCRLTFGSWTYNGNQIDILNHLDTGDLTDFVENVEWEILGMPAKKSVITYGCCSEPYPDVTYTLILKRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHH 319          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 215.312 bits (547), Expect = 5.432e-64
Identity = 117/315 (37.14%), Postives = 182/315 (57.78%), Query Frame = 3
Query:  123 CLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVLCG 1067
            C+   +      + +++F  Y+  +RP  ++ + + + L ITL  I D+DE+N+ILT  +W+   W D  L W+   Y+ +D IR P   +W PDIVL+N   ++F+E   + V +  +GK+ W       S C +D+SYFPFD+Q C L+ GSW Y+ +Q+DI+    + DLS  +E+ EW +    + +    +   +E Y +I+F L LKRR+ +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F LMV E MP  SE  PLIG Y    M + + S  + ++++ IH        LCG
Sbjct:    6 CVESAKGKYAQMLFRDLFEDYSNALRPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDIINTMDSGDLSDFVENVEWEMQGMPAVKNVITYGCCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMPP-SESVPLIGKYYIATMTMITASTALTIIIMNIH--------LCG 311          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 213.772 bits (543), Expect = 2.198e-63
Identity = 118/313 (37.70%), Postives = 185/313 (59.11%), Query Frame = 3
Query:  129 SEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVLCG 1067
            ++G+ +Q   + +++F  Y+  +RP  ++ + + + L ITL  I D+DE+N+ILT  +W+   W D  L W+   Y+ +D IR P   +W PDIVL+N   ++F+E   + V +  +GK+ W       S C +D+SYFPFD+Q C L+ GSW Y+ +Q+DI+    + DLS  +E+ EW +    + +    +   +E Y +I+F L LKRR+ +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F LMV E MP  SE  PLIG Y    M + + S  + ++++ IH        LCG
Sbjct:   33 AKGKYAQ--MLFRDLFEDYSNALRPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDIINTMDSGDLSDFVENVEWEMQGMPAVKNVITYGCCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMPP-SESVPLIGKYYIATMTMITASTALTIIIMNIH--------LCG 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 213.001 bits (541), Expect = 5.565e-63
Identity = 117/301 (38.87%), Postives = 186/301 (61.79%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            Q   + ++ + + ++YN   RP +N SQP+T+   ++L+ I D+DEKN++LTT +WL   W D  L WN S Y  V  +R P  +IW PDI+L+NS  E+F     + V +  +G   + P     S C +D+ +FPFD Q C L  GSW+Y    LD L+++   D+SS I +GEW++     KR ++F+    E Y ++++ + ++RR LYY +N+  PC+++S L L+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLI  Y    M +  +SV++ V+V++ HH 
Sbjct:   22 QGEFQRRLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLD-LQMQ-EADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHH 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 210.69 bits (535), Expect = 2.892e-62
Identity = 116/319 (36.36%), Postives = 188/319 (58.93%), Query Frame = 3
Query:  105 FIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            F+ LF   S G +S+E ++   +F HYNR IRP  N S PVT+   + +  + ++DE N+I+ T +WL   W D RL W+ + Y+ ++ +R P   IW PDIVL+N+    F    K+   +  +G + W P     S C +DI++FPFD Q C L  GSW Y K ++D+L +   +D++   E+ EW I + S  + D  +    E Y++I++   ++R  ++Y IN+  PC+ +S LT++ F LP + GEKVTL ++VLL  + FLL++TE +P+TS   PL+G Y+   M   ++S+++ V V+ IH+R      +
Sbjct:   21 FLALFKG-STGCESEE-QLFHRLFAHYNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSKVDMNDFWENSEWEIVDASGYKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTM 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 209.534 bits (532), Expect = 1.191e-61
Identity = 109/306 (35.62%), Postives = 183/306 (59.80%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
                E ++ +++F  YNR  RP  N+S  V ++ G+++  + D+DEKN+++TT VWL QEW D +L W+ + + ++  +R P   IW+PDIVL+N+   +F     +   ++  G + W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL    E GEW I N +     + +    E Y ++++   ++R  L+Y IN+  PC+++S LT++ F LP E GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR     
Sbjct:   32 HTHAEDRLFKHLFGGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 209.534 bits (532), Expect = 1.191e-61
Identity = 109/306 (35.62%), Postives = 183/306 (59.80%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
                E ++ +++F  YNR  RP  N+S  V ++ G+++  + D+DEKN+++TT VWL QEW D +L W+ + + ++  +R P   IW+PDIVL+N+   +F     +   ++  G + W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL    E GEW I N +     + +    E Y ++++   ++R  L+Y IN+  PC+++S LT++ F LP E GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR     
Sbjct:   32 HTHAEDRLFKHLFGGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTH 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Match: Chrna4 (cholinergic receptor, nicotinic, alpha polypeptide 4 [Source:MGI Symbol;Acc:MGI:87888])

HSP 1 Score: 211.46 bits (537), Expect = 1.990e-61
Identity = 114/310 (36.77%), Postives = 185/310 (59.68%), Query Frame = 3
Query:  132 EGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            E +   E ++L+ +F  YN+  RP +N S  V ++ G+++  + D+DEKN+++TT VW+ QEW D +L W+  +YE+V  IR P   IW PDIVL+N+    F     +   ++ +G++ W P     S C +D+++FPFD Q C +  GSW Y K ++D++ +   +D     E GEW I +       R +    E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP E GEKVTL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR  +   +
Sbjct:   33 ETRAHAEERLLKRLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPGDYENVTSIRIPSELIWRPDIVLYNNADGDFAVTHLTKAHLFYDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMHSRVDQLDFWESGEWVIVDAVGTYNTRKYECCAEIYPDITYAFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPRTHTM 342          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|Q9I8C7|ACH10_CHICK (Neuronal acetylcholine receptor subunit alpha-10 OS=Gallus gallus OX=9031 GN=CHRNA10 PE=3 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 3.393e-68
Identity = 112/303 (36.96%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  129 SEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
               Q    +K+L ++F +Y+  +RP+ ++ + + + L +TL  I D+DE+N++LT+ +W+ Q W+D  LAW+   Y  +D IR P + +W PDIVL+N+  E+F    ++ V + ++G ++W       S C++D+SYFPFD Q C L+ GSW Y+ +Q+D+  L    DL+  +E+ EW +    + R    +   +E Y ++++ L L+RR  +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH
Sbjct:   25 GAAQGRLAHKLLHDLFANYSSALRPAEDTERALNVTLQVTLSQIIDMDERNQVLTSYLWVRQAWLDAHLAWDKDAYGGIDSIRIPSSYVWRPDIVLYNNADERFGGSMETNVVLRSDGHIMWDSPAITKSSCKVDVSYFPFDGQQCRLTFGSWTYNGNQIDLRNLLDTGDLTDFVENVEWEVLGMPATRNVVTYGCCSEPYPDVTYTLLLRRRASFYIFNLLLPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMP-PSESVPLIGKYYIATMTMITASTALTIFIMNIHH 326          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P48180|ACH1_CAEEL (Acetylcholine receptor subunit alpha-type acr-16 OS=Caenorhabditis elegans OX=6239 GN=acr-16 PE=2 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.110e-66
Identity = 116/303 (38.28%), Postives = 184/303 (60.73%), Query Frame = 3
Query:  147 QEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            QE ++ +++ R+YN   RP +N S+PVT+ L + L  I D+DEKN+++    WL+  W D  L W+ + Y ++  +R P  KIW PD++L+NSV   F    ++ + +Y+ G + W P       C++DI +FPFD+Q C    GSW Y   +LD+       D+S  I +GEW +  T+ +R ++F+    E Y ++ F L ++RR LYY  N+  PCI+ +++TL+GF LPP++GEK+TL +TVLL   FFL +V+E  P TSE  PL+GI+ T  M + + S +  V V+ +H+R  +  
Sbjct:   22 QERRLYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPATGGFDISEYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETH 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|A8WQK3|ACH1_CAEBR (Acetylcholine receptor subunit alpha-type acr-16 OS=Caenorhabditis briggsae OX=6238 GN=acr-16 PE=3 SV=2)

HSP 1 Score: 224.557 bits (571), Expect = 1.125e-66
Identity = 119/318 (37.42%), Postives = 189/318 (59.43%), Query Frame = 3
Query:  111 FLFSC---LSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
             L SC   L      QE ++ +++ R+YN   RP +N S+PVT+ L + L  I D+DEKN+++    WL+  W D  L W+ + Y ++  +R P  KIW PD++L+NSV   F    ++ + +Y++G + W P       C++DI +FPFD+Q C    GSW Y   +LD+       D+S  + +GEW +  T+ +R ++F+    E Y ++ F L ++RR LYY  N+  PCI+ +++TL+GF LPP++GEK+TL +TVLL   FFL +V+E  P TSE  PL+GI+ T  M + + S +  V V+ +H+R  +  
Sbjct:    7 LLLSCALFLVAHGSLQERRLYEDLMRNYNNLERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWKDYNLVWDQAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSSGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPATGGFDISEYLPNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETH 324          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P09480|ACHA2_CHICK (Neuronal acetylcholine receptor subunit alpha-2 OS=Gallus gallus OX=9031 GN=CHRNA2 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 1.876e-65
Identity = 118/304 (38.82%), Postives = 188/304 (61.84%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            E ++ +++F  YNR  RP  N+S  V +K G+++  + D+DEKN+++TT VWL QEW D +L WN  ++++V  IR P   IW+PDIVL+N+   +F     +   +++NGK+ W P     S C +D++YFPFD Q C +  GSW Y K ++D+  ++ ++DL    E GEW I N   +   + +    E Y +I+F   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S+II V V+ +HHR      +
Sbjct:   34 EDRLFKHLFTGYNRWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPEDFDNVTSIRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSNGKVKWVPPAIYKSSCSIDVTYFPFDQQNCKMKFGSWTYDKAKIDLENMEHHVDLKDYWESGEWAIINAIGRYNSKKYDCCTEIYPDITFYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPSTHTM 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Match: sp|P36544|ACHA7_HUMAN (Neuronal acetylcholine receptor subunit alpha-7 OS=Homo sapiens OX=9606 GN=CHRNA7 PE=1 SV=5)

HSP 1 Score: 215.698 bits (548), Expect = 2.784e-63
Identity = 119/301 (39.53%), Postives = 187/301 (62.13%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            Q   + K+ + + ++YN   RP +N SQP+T+   ++L+ I D+DEKN++LTT +WL   W D  L WN S Y  V  +R P  +IW PDI+L+NS  E+F     + V + ++G   + P     S C +D+ +FPFD Q C L  GSW+Y    LD L+++   D+S  I +GEW++     KR++RF+    E Y +++F + ++RR LYY +N+  PC+++S L L+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLI  Y    M +  +SV++ V+V++ HH 
Sbjct:   22 QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLD-LQMQ-EADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHH 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: V4AMN3 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_152290 PE=3 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 1.329e-88
Identity = 145/315 (46.03%), Postives = 218/315 (69.21%), Query Frame = 3
Query:   96 RIFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            +IF    +  ++  + + E ++LQ +  HY+ N RP  ++++PV I+LGITL  + D+DEKN++L+T VWL+QEW D +L+WN   + ++  IR PC  +WLPDIVL+NSV      Y KSL  + ++GK+ W PIV M S C++DI+YFPFDDQ+C L +GSWAY   Q+D+     +IDL + +++GEW + +T   R   F+P   E + +++F + ++RR LYY  NV  PC++LS L++ GF+LPP+SGEKVTL LTVLL +S F+L+V E MP TSE+ PLIGIY+T+ M ++++SV + V V+  HH+
Sbjct:  115 QIFCDLRYHNINVSRLTDEQRLLQKLLEHYDPNTRPVFDAAKPVVIRLGITLTQVLDVDEKNQVLSTNVWLDQEWYDEKLSWNKEEFSNISIIRIPCKLLWLPDIVLYNSVDNHNKGYMKSLAMVESDGKVFWPPIVRMRSSCKMDITYFPFDDQVCRLKLGSWAYDGFQVDVSNRSTDIDLENYVDNGEWTLIDTKVIRNVIFYPCCREPFPDVTFYIHIRRRVLYYFFNVIIPCMLLSSLSMTGFLLPPDSGEKVTLGLTVLLAFSVFMLLVAENMPPTSEYIPLIGIYLTVIMAMSALSVALSVFVLNCHHK 429          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A210QVW8 (Acetylcholine receptor subunit alpha-type acr-16 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT15059 PE=3 SV=1)

HSP 1 Score: 288.115 bits (736), Expect = 1.850e-88
Identity = 148/308 (48.05%), Postives = 210/308 (68.18%), Query Frame = 3
Query:  126 LSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNN-SNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKS 1046
            + E   ++E ++L  I + Y+R+ RP  ++  PV I+LGITL  + D+DEKN+ILTT VWL+QEW+D +L W N S +  +   R PC  IWLPDIVL+NSV      Y KSL  +   G + W PIV M S C++DI+YFPFDDQ+CIL MGSWAY   Q+D+      +D S+ +++GEW + +T   R  +++P   E + +++F + L+RR LYY  NV  PC++LS LTL GF+LPP+SGEKVTL LTVLL +S F+L++ E MP TSE+ PLIGIY+T+ M ++ +SV+  V V+ IHH+ +
Sbjct:   38 IPEKDMTEEQRLLYRIMKSYDRSSRPVFSAKTPVVIRLGITLTQVLDVDEKNQILTTNVWLDQEWVDEKLQWTNISEFAHIKIFRIPCDLIWLPDIVLYNSVDNHNKGYMKSLAMVEQTGNVFWPPIVRMRSSCKMDITYFPFDDQVCILKMGSWAYDGFQVDVTNRTMEVDTSNYVDNGEWTLIDTKVVRNVKYYPCCPEPFPDVTFYIHLRRRVLYYAFNVIIPCMLLSSLTLTGFLLPPDSGEKVTLGLTVLLAFSVFMLLIAENMPPTSEYIPLIGIYLTVIMAMSGLSVVFSVFVLNIHHKGA 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A3S1AA16 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_005785 PE=3 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 4.613e-88
Identity = 146/301 (48.50%), Postives = 214/301 (71.10%), Query Frame = 3
Query:  144 SQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKS 1046
            + E ++L+++ R+Y+  +RP  ++  PV IKLGITL  + D+DEKN++LTT +WL+QEW D +L WN S+Y ++  +R PC  IWLPDIVL+NSV      Y KSL  ++++G + W PIV M S C++DI+YFPFDDQ+C L +GSWAY   Q+D+     N+DLS+ +++GEW +  T   R  +++    + Y +++F + ++RR LYY +NV  PC+MLS L+L GF+LPPESGEKVTL LTVLL +S F+L+V E MP TSE+ PLIGIY+T+ M ++++SV + V V+  HHR +
Sbjct:   43 TDEQRLLRDLTRNYDPAVRPVFDAKTPVVIKLGITLTQVIDVDEKNQVLTTNIWLDQEWHDEQLIWNMSDYNNITILRVPCDFIWLPDIVLYNSVDNHNKGYMKSLAMVHDDGNVFWPPIVRMRSSCKMDITYFPFDDQLCGLKLGSWAYDGFQVDVTNRSDNVDLSNYVDNGEWELLGTKVIRRVKYYTCCPQPYIDVTFYILIRRRVLYYFLNVIIPCMMLSSLSLTGFLLPPESGEKVTLGLTVLLAFSVFMLLVAENMPPTSEYIPLIGIYLTVIMAMSALSVAVSVFVLNCHHRGT 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: R7V1T8 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_201263 PE=3 SV=1)

HSP 1 Score: 277.715 bits (709), Expect = 4.708e-86
Identity = 146/311 (46.95%), Postives = 205/311 (65.92%), Query Frame = 3
Query:  177 RHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVLCGGISNQQKTRSILWL 1109
            + Y + +RP  NS+Q +T+ LG+TL  I D+DEKN++LT  VWL+Q W D +L WN   Y  V  IR PC  +WLPDIVL+NSV +    Y +SL  + ++G + W PIV   S C++DI+YFPFDDQIC + MGSWAY   Q+D+     ++DLS+ I++GEW + +  + R  +F+    E + +++F   L+RR  YY  N+  PC +LS+LTL GF+LP +SGEKV+L LTVLL +S F+L++ E MPATSEF PLIG+Y+T+ M +TS SV+  V V+ IHH+        GG  N    R+ LWL
Sbjct:    2 KGYEKAVRPVFNSTQTITVNLGLTLTQIFDMDEKNQVLTVNVWLDQSWKDDKLQWNPEQYGGVKVIRIPCDFVWLPDIVLYNSVDDYSEPYMRSLAMLSHDGMIFWPPIVKFRSSCKVDITYFPFDDQICSMKMGSWAYDGLQVDVTNNSDSVDLSNYIDNGEWQLIHAKAVRNVKFYSCCPEPFPDVTFWFHLRRRTTYYTFNIIIPCAILSVLTLGGFLLPADSGEKVSLGLTVLLAFSVFMLLIAENMPATSEFVPLIGLYLTVIMAMTSASVVFSVFVLHIHHK--------GGRGN----RAPLWL 300          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Match: A0A1S3I5A0 (neuronal acetylcholine receptor subunit alpha-3 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106160803 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 1.447e-84
Identity = 138/300 (46.00%), Postives = 210/300 (70.00%), Query Frame = 3
Query:  138 QKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            +K+ E ++L+ +   Y    RP  N+S+ V +K GITL  I+D+DE N++LTT VWL QEW+D RL WN ++Y ++  +R PC KIWLPDIVL+NS  +    Y +S   + +NG + W P     S C++DI++FPFDDQ+C +  GSWAY   QL++      +D+S+ +  GEW++ +    R ++F+    E Y +++F L+++RR LYY+INV FPC+ LS+L+L+GF LPP+SGEK+TL +TVLL +S F+L++ E MPATS+F PLIGIY+T+ M +TS+S+++ V V+++HH
Sbjct:   47 RKTDEQRLLEKLLHGYESYSRPVFNASESVEVKFGITLTTISDMDEVNQVLTTNVWLEQEWVDERLKWNPADYNNLVVMRMPCEKIWLPDIVLYNSADDYTAGYMQSKAMVDHNGTVFWPPPAKFRSSCKIDITFFPFDDQVCKMKFGSWAYDGFQLNMTSRNEKVDMSNYVFSGEWDLLSIDIVRNEKFYGCCPEPYPDVTFYLRIRRRTLYYLINVIFPCLWLSILSLLGFWLPPDSGEKITLGITVLLAFSVFMLLIAENMPATSDFVPLIGIYLTMTMAMTSLSIVLTVFVLQLHH 346          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: ENSAMXT00000019858.2 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 237.654 bits (605), Expect = 4.131e-73
Identity = 122/321 (38.01%), Postives = 199/321 (61.99%), Query Frame = 3
Query:   93 KRIFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            K   F + + C S  Q    +K+L+++F +Y+  +RP  ++   + + L ITL  I D+DE+N+ILTT +W+ Q W+D  L WN ++Y+ +D IR P + +W PDIVL+N+  ++F+   ++ V I+++G+++W       S C++D+S+FPFD Q C L+ GSW ++ +Q+DIL    + DL+  +E+ EW +    +K+    +   +E Y +I++ LQLKRR  +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH  S  +
Sbjct:    2 KHFMFRYFYLCWS-AQGRYAHKLLKDLFVNYSNAVRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDILNGMDSADLADFVENVEWEVLGMPAKKNVILYGCCSEPYPDITYTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQ 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: ENSAMXT00000032409.1 (neuronal acetylcholine receptor subunit alpha-10 [Source:NCBI gene;Acc:103033580])

HSP 1 Score: 234.958 bits (598), Expect = 5.197e-71
Identity = 119/314 (37.90%), Postives = 195/314 (62.10%), Query Frame = 3
Query:  114 LFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            +F      Q    +K+L+++F +Y+  +RP  ++   + + L ITL  I D+DE+N+ILTT +W+ Q W+D  L WN ++Y+ +D IR P + +W PDIVL+N+  ++F+   ++ V I+++G+++W       S C++D+S+FPFD Q C L+ GSW ++ +Q+DIL    + DL+  +E+ EW +    +K+    +   +E Y +I++ LQLKRR  +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH  S  +
Sbjct:   18 MFPVCWSAQGRYAHKLLKDLFVNYSNAVRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWLDAYLTWNKADYDGLDTIRIPSSYVWRPDIVLYNNADDQFSSSMETNVVIHHDGQIMWDQPAISKSSCKVDVSFFPFDSQKCRLTFGSWTHNGNQMDILNGMDSADLADFVENVEWEVLGMPAKKNVILYGCCSEPYPDITYTLQLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHHCGSDAQ 330          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 224.557 bits (571), Expect = 5.107e-68
Identity = 116/303 (38.28%), Postives = 187/303 (61.72%), Query Frame = 3
Query:  129 SEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            ++G+ +Q  ++L ++FR+Y   +RP  N++  + + L ITL  I  +DE+N+ILT  +W+ Q W D  L WN  +Y+ +D IR P + +W PDIVL+NS  + FT    + V I  +G+++W   +   S C++D+S+FPFD Q C L+ GSW Y+  QLDIL    + DL+ L+++ EW +    +K+    +    + Y ++++ L+LKRR  +Y+ N+  PC+M+S L  +GF LP +SGEKV+L +TV+L  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH
Sbjct:   10 AQGKYAQ--RLLNDLFRNYTSAMRPVENTNDILNVTLQITLSQIIGMDERNQILTAYLWIRQVWTDAYLTWNKDDYDGLDTIRIPGSYVWRPDIVLYNSADDHFTGTMDTNVVIRYDGQIMWDSPIITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGKQLDILNALESADLADLVDNVEWEVLGMPAKKNVIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHH 309          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrna10a (cholinergic receptor, nicotinic, alpha 10a [Source:ZFIN;Acc:ZDB-GENE-060503-725])

HSP 1 Score: 224.942 bits (572), Expect = 2.640e-67
Identity = 119/314 (37.90%), Postives = 192/314 (61.15%), Query Frame = 3
Query:   99 IFFIFLFSCL-SEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            +  IF  +C  ++G+ +Q  ++L ++FR+Y   +RP  N++  + + L ITL  I  +DE+N+ILT  +W+ Q W D  L WN  +Y+ +D IR P + +W PDIVL+NS  + FT    + V I  +G+++W   +   S C++D+S+FPFD Q C L+ GSW Y+  QLDIL    + DL+ L+++ EW +    +K+    +    + Y ++++ L+LKRR  +Y+ N+  PC+M+S L  +GF LP +SGEKV+L +TV+L  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH
Sbjct:   13 VCIIFTPACWGAQGKYAQ--RLLNDLFRNYTSAMRPVENTNDILNVTLQITLSQIIGMDERNQILTAYLWIRQVWTDAYLTWNKDDYDGLDTIRIPGSYVWRPDIVLYNSADDHFTGTMDTNVVIRYDGQIMWDSPIITKSSCKVDVSFFPFDAQQCRLTYGSWTYNGKQLDILNALESADLADLVDNVEWEVLGMPAKKNVIQYGCCADPYPDVTYTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHH 323          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103031133])

HSP 1 Score: 218.394 bits (555), Expect = 9.120e-65
Identity = 121/317 (38.17%), Postives = 192/317 (60.57%), Query Frame = 3
Query:   99 IFFIFLF---SCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            + FI L+   SC  +     E ++ + +F  YN+  RP  N+S  V +K G+++  + D+DEKN+++TT VWL QEW D +L W  S+Y++V  IR P   IW+PDIVL+N+   +F     +   ++  GK+ W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +L+  +DL    E GEW I N       + +   +E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S+II V V+ +HHR
Sbjct:   15 LLFIMLWKSVSCYEKTHSHAEDELFKKLFIGYNKWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFYTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERLETMVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHR 331          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 202.986 bits (515), Expect = 3.894e-60
Identity = 113/314 (35.99%), Postives = 182/314 (57.96%), Query Frame = 3
Query:  120 SCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
             C +    S+ YK L   F  YN  IRP  N S PV ++  +++  +  LDE N+I+ T +WL   W D +  WN   +E ++ IR P  KIW PDIVL+N+    F    K+   +  +G ++W P     S C++D++YFPFD Q C +  GSW Y K ++D++ +   I+L    E GEW I +    + D  +    + Y +I++ + ++R  L+Y IN+  PC+++S LT++ F LP + GEKVTLS++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I + V+ +H+R  +   +
Sbjct:    1 GCRASEAASRLYKTL---FTSYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVGTKINLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTM 311          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 195.282 bits (495), Expect = 1.460e-57
Identity = 104/302 (34.44%), Postives = 176/302 (58.28%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            E ++L+ + + Y + +RP    S  V +K G+ +  + D+DEKN+++TT VWL QEW+D  L WN  +Y  ++ IR P + IWLPDIVL+++   +F     +   + ++G++ W P     S C +D+++FPFD Q C +  GSW Y    +D++ +  ++D     ++GEW   N +  +  R     +  Y  I++   ++R  L+Y + +  PC+ LS LT+  F LP + GEK++L  +VL+  + FLL++ E +P++S+  PLIG Y+   M   ++S+II V VI +HHR S   
Sbjct:   35 EDRLLKRMLKDYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVNSDVDRGEYFDNGEWEFLNATGNKGVRL--DGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTH 334          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 188.734 bits (478), Expect = 3.426e-54
Identity = 100/268 (37.31%), Postives = 163/268 (60.82%), Query Frame = 3
Query:  258 INDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVL 1061
            + D DEKN+++TT VWL QEW D +L W+ + YE+V  IR P   IW+PDIVL+N+    F     +   +++ G++ W+P     S C +D+++FPFD Q C +  GSW Y K ++D++ +  ++DL    E GEW I +       + +    + Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR      +
Sbjct:   10 LCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDLVSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAM 277          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: htr3a (5-hydroxytryptamine (serotonin) receptor 3A [Source:ZFIN;Acc:ZDB-GENE-071012-5])

HSP 1 Score: 150.984 bits (380), Expect = 5.812e-41
Identity = 94/292 (32.19%), Postives = 164/292 (56.16%), Query Frame = 3
Query:  183 YNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPN----IDLSSLIEHGEWNIFNTSSKRTDRFHPSTNET-YSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRK 1043
            Y++ +RP  N  QP+ + + + L  I ++DEKN++LT  +W  Q W D  L W+   Y+ +++I  P   IW+PDI++   V    +     +   YN   + ++P+  + S C LDI  FPFD Q C L+  SW ++ + +++   +       D S  +  GEW + +  +   +  HP   E  +SE+   + ++RR L+Y++N+  P   L M+   GF LPP+SGE+V+  +T+LL YS FL++V + +PAT   TPLI +Y  + M L  IS++  + ++++ H++
Sbjct:   46 YDKGVRPVKNWRQPIIVAIDVMLYAILNVDEKNQVLTAYIWYRQRWTDEFLQWDPVQYDGIEQISIPTNNIWVPDIMISEFVDVGKSPDIGYVYLSYNGTVMNYKPLQVV-SACSLDIYSFPFDVQNCTLTFTSWLHTSNDINLTLWRTTEEIKEDKSIFLNFGEWELISVPN---ELLHPLYGENRFSELKIYVVIRRRPLFYVVNLIMPSAFL-MVMDAGFYLPPDSGERVSFKITLLLGYSVFLIVVQDTLPATPIGTPLIAVYFVVCMALLVISLMETIFIVRLVHKQ 332          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.739 bits (356), Expect = 6.462e-38
Identity = 85/234 (36.32%), Postives = 137/234 (58.55%), Query Frame = 3
Query:  354 YESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            +  V  +R    +IW PDI+L+NS  E+F     + V +   G     P   + S C +D+ +FPFD Q C L  GSW +    +D+  L+   D S  I +GEW++     KR + ++    E Y ++++ L ++RR LYY +N+  PC+++S L+L+ F+LP +SGEK++L +TVLL  + F+L+V E MPATS+  PLIG Y    M + + SV++ V+V++ HH     +
Sbjct:    3 HPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQMLE--ADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGK 234          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO42072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2P1])

HSP 1 Score: 200.29 bits (508), Expect = 1.157e-60
Identity = 103/285 (36.14%), Postives = 174/285 (61.05%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQE-------KFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINM 983
            E ++   +F +YN+++RP  N S+ +T++LG+TL  I  L EK++ L T +W+ Q W +  L W+   +  +  I     K+W+PDI L+N+          KF    K L     NG  IW   V + S C++D++YFPFD+Q C L  GSW Y  ++LD++   P+ D+S  +  G+W++ + ++KR + F+    ++Y +++F L ++R+ ++Y +N+  PC +++ LTL+ F LPPESGE++TL +T LL  + F+L+V + +P TSE  PLI +Y T+ M
Sbjct:    1 EARLHMFLFENYNKHLRPVVNKSRALTVRLGLTLHQIASLVEKSQFLQTSLWVRQMWRNEYLTWDPKEFGGISTINVNVDKVWVPDIYLYNNADADGDGALNKFGTQIKLLF----NGINIWLAPVLLTSSCKIDVTYFPFDEQHCSLKFGSWTYDGERLDLVSESPSGDVSKYVPSGQWDLVSFTAKRNEIFYVCCPQSYPDVTFTLNIRRKTIFYYMNLIMPCFLITGLTLLSFFLPPESGERITLVITNLLAMTVFMLLVADWLPPTSEVVPLISMYYTLTM 281          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 200.29 bits (508), Expect = 3.640e-59
Identity = 105/305 (34.43%), Postives = 182/305 (59.67%), Query Frame = 3
Query:  135 GQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFT---EYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
             +++ E ++L ++FR+Y+  +RP  N S  V ++  ++L+ I  ++ K++++T  VW+ Q+W +  LAWN S Y  ++ +     K+W+PDI+L+N+  E +    E  K+ V   ++G   W    +  S C +++ YFPFD Q C L  GSW Y  ++L +     + DLS  + +GEW++    +K    F+      + +++  L+++R+ LYY+ N+  PC +++ LTL+ F LPPESGEKV L +TVLL  + FLL+V E +P+TS+  PL+G Y    M +T+IS++   L++   HR
Sbjct:   33 SRETAEKRLLADLFRNYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSDSADLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHR 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 194.512 bits (493), Expect = 6.593e-59
Identity = 100/283 (35.34%), Postives = 176/283 (62.19%), Query Frame = 3
Query:  147 QEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQ---EKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDIL-KLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINM 983
             E K+L+++F +YN ++RP   ++  VT++LG++L  I DLDE+N+IL + +W+ Q+W +  L W+ +++ ++  I     ++W PD++L+N+     +   +   + V +  +G  +W   +   S C+ D++YFPFD+Q CIL  GSW Y   +L+I+ +   +I +   + +GEW +   S+ R   F+    E Y +++F L+++R  L+Y +N+  PC +++ LTL+ +ILPPESGE++TL +T LL  + +LL+V+E MP  +E  PLI IY T  M
Sbjct:    1 MENKLLKDLFSNYNPSVRPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIVPENGTDIGIDKFVSNGEWELTGVSANRNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIYYTTAM 283          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 195.282 bits (495), Expect = 1.186e-58
Identity = 107/303 (35.31%), Postives = 181/303 (59.74%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFT---EYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIG-IYITINMGLTXXXXXXXXXXXKIHHRKS 1046
            E +++ ++ + Y+RN RP  NS+  + +  G+ +V I +++ +N+I+ T VW+ Q W +  L W+ SNYE V  +R     +W+PDIVL++S    F+   E  K+ V I  +G   W    +  S C++D++YFPFD+Q C +  GSW Y+   +DI      +  S  ++  EW++ + ++ R  + +    E  S+++  + ++R+ L+Y  N+  PC+++  + L+GF LPPESGE++TLS+TVLL  + FL +V E +P  SE  PL+G  YITI M   ++S++    V+ IHHR S
Sbjct:    1 EQRLISDLLQGYSRNARPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITI-MTEIAVSLMATCWVLNIHHRNS 302          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Match: EDO37425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX0])

HSP 1 Score: 185.267 bits (469), Expect = 3.019e-55
Identity = 101/301 (33.55%), Postives = 178/301 (59.14%), Query Frame = 3
Query:  150 EYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFT---EYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDL-SSLIEHGEWNIFNTSSKRTDRFHPSTNE-TYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            E K+ +++    +  IRP  N+S+PV + + +TL  + D+DEK +ILT+ VW+ QEW++ R+ W+   +  +  +    + IW PDIVL+N+V E+F    ++  +LV +Y NG   W       + C++ +  FPFD Q C L  GSW Y   ++D+  +K    L ++ + +GEW++      R    +P   +  Y +I+FI+QL+RR+L+YI N+  P  ++++L    F +P E GE+++  +TVLL  + FLL+V E +P TSE  P I +Y T +M L +++++   + +K+++
Sbjct:    2 ELKLTRDLLSRTSTRIRPVENTSRPVNVTMDMTLSNVIDIDEKQQILTSCVWMRQEWINERMQWDPKLFGGIKDVTLHTSDIWQPDIVLYNNVFEEFDGRLDHVSTLVRVYYNGSTHWNAPFIFKTLCKIQVKNFPFDLQECTLKFGSWQYDSSEIDLHYVKTEGKLDNTRVRNGEWDVIRVKITRNALSYPCCPDVVYPDITFIVQLRRRSLFYIFNLIIPNFLIALLAFFSFYIPIECGERISFVITVLLSMTVFLLLVAESIPPTSEALPAIALYYTSSMILVALALVATGITLKVNY 302          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: ENSORLT00000016544.2 (neuronal acetylcholine receptor subunit alpha-10-like [Source:NCBI gene;Acc:101157879])

HSP 1 Score: 226.098 bits (575), Expect = 9.176e-68
Identity = 120/311 (38.59%), Postives = 190/311 (61.09%), Query Frame = 3
Query:  120 SCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIW-QPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQ 1049
            S  S  Q     K+L ++F +Y   +RP  ++   + + L ITL  I D+DE+N+ILTT +W+ Q WMD  L+W   +Y+ +D IR P + +W PDIVL+NS  ++F+   ++ V + N+G+++W QP +T  S C +D+++FPFD Q C L+ GSW ++ +Q+D+     + DLS  + + EW +    +K+    +   ++ Y +I+F L LKRR  +YI N+  PC+M+S L  +GF LP +SGEKV+L +TVLL  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH  S+
Sbjct:   19 SVCSAAQGRFAQKLLNDLFSNYTSALRPVEDTDNIINVTLQITLSQIIDMDERNQILTTYLWIRQVWMDAFLSWRKEDYDGLDTIRIPSSLVWRPDIVLYNSANDEFSSSMETNVVLRNDGQVMWDQPAITKSS-CSVDVAFFPFDVQQCHLTFGSWTHNGNQMDLFNALDSADLSDFVPNVEWEVLGMPAKKNVILYGCCSDPYPDITFTLNLKRRASFYIFNLLIPCMMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLLVAESMPP-SESVPLIGKYYIATMTMVTASTALTIFIMNIHHCGSE 327          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101158195])

HSP 1 Score: 222.246 bits (565), Expect = 2.619e-65
Identity = 120/321 (37.38%), Postives = 191/321 (59.50%), Query Frame = 3
Query:   93 KRIFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNE 1055
            K    I + S   E +   E ++LQN+F  YN+  RP  N+S  V +  G+++  + D+DEKN+++TT VWL QEW D +L WN  +YE+V  IR P   IW PDIVL+N+    F     +   ++ +G++ W P     S C +D+++FPFD Q C +  GSW Y + ++D++ +  ++D     E GEW I N   K   + +    E Y++I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S+II + V+ +HHR  Q  
Sbjct:   26 KNAILIGVVSSQIEPRAHAEERLLQNLFARYNKLSRPVQNTSDTVLVHFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPEDYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAHLFYDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDRAKIDLISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCAEIYADITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMVFVTLSIIITIFVLNVHHRSPQTH 346          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrna10a (neuronal acetylcholine receptor subunit alpha-9-like [Source:NCBI gene;Acc:101158786])

HSP 1 Score: 216.853 bits (551), Expect = 2.865e-65
Identity = 110/294 (37.41%), Postives = 180/294 (61.22%), Query Frame = 3
Query:  156 KILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHH 1037
            K+L ++  +Y + + P  +++  + + L +TL  I D+DE+N+ILT  +W+ Q W D  L WN  +++ +D IR P + +W PDIVL+NS  ++FT    + V I ++G+++W       S C++D+S+FPFD Q C  + GSW Y+ +QLDI     + DL+ L+E+ EW +    +K+    +    + Y +++F L+LKRR  +Y+ N+  PC+M+S L  +GF LP +SGEKV+L +TV+L  + F L+V E MP  SE  PLIG Y    M + + S  + + ++ IHH
Sbjct:   23 KLLTDLMSNYTKALIPVEDTNIILNVTLQVTLSQIIDMDERNQILTAYLWIRQVWFDAHLKWNKEDFDGLDTIRIPGSYVWRPDIVLYNSADDRFTGPMDTNVVIRHDGQMMWDSPYITKSSCKVDVSFFPFDAQQCRFTYGSWTYNGNQLDIQNAMESADLADLVENVEWEVLGMPAKKNIVLYGCCADPYPDVTFTLKLKRRASFYVFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVMLALTVFQLLVAEIMPP-SENVPLIGKYYIATMTMITASTALTIFIMNIHH 315          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 218.009 bits (554), Expect = 8.841e-65
Identity = 116/306 (37.91%), Postives = 188/306 (61.44%), Query Frame = 3
Query:  123 CLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            C  +     E ++ Q +F  YN+  RP  N S  V +K G+++  + D+DEKN+++TT VWL QEW D +L W  S+Y++V  IR P   IW+PDIVL+N+   +F     +   +++ GK+ W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL++  E GEW I N       + +   +E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR
Sbjct:   35 CYDKSHAHAEEELFQTLFTGYNKWSRPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENTVDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHR 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 218.009 bits (554), Expect = 8.841e-65
Identity = 116/306 (37.91%), Postives = 188/306 (61.44%), Query Frame = 3
Query:  123 CLSEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHR 1040
            C  +     E ++ Q +F  YN+  RP  N S  V +K G+++  + D+DEKN+++TT VWL QEW D +L W  S+Y++V  IR P   IW+PDIVL+N+   +F     +   +++ GK+ W P     S C +D+++FPFD Q C +  GSW Y K ++D+ +++  +DL++  E GEW I N       + +   +E Y +I++   ++R  L+Y IN+  PC+++S LT++ F LP + GEK+TL ++VLL  + FLL++TE +P+TS   PLIG Y+   M   ++S++I V V+ +HHR
Sbjct:   35 CYDKSHAHAEEELFQTLFTGYNKWSRPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENTVDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHR 340          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000047372.1 (SMESG000047372.1)

HSP 1 Score: 379.793 bits (974), Expect = 1.541e-131
Identity = 235/235 (100.00%), Postives = 235/235 (100.00%), Query Frame = 3
Query:  606 LDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGXXXXXXXXXXXXXXXXXKPCFRQNLSTGFKNLSKH 1310
            LDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFTPLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLIVLKPCFRQNLSTGFKNLSKH
Sbjct:    7 LDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFTPLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLIVLKPCFRQNLSTGFKNLSKH 241          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000047372.1 (SMESG000047372.1)

HSP 1 Score: 379.407 bits (973), Expect = 1.829e-131
Identity = 235/235 (100.00%), Postives = 235/235 (100.00%), Query Frame = 3
Query:  606 LDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGXXXXXXXXXXXXXXXXXKPCFRQNLSTGFKNLSKH 1310
            LDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFTPLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLIVLKPCFRQNLSTGFKNLSKH
Sbjct:    2 LDILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFTPLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLIVLKPCFRQNLSTGFKNLSKH 236          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000047372.1 (SMESG000047372.1)

HSP 1 Score: 377.481 bits (968), Expect = 1.265e-130
Identity = 234/234 (100.00%), Postives = 234/234 (100.00%), Query Frame = 3
Query:  609 DILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKXXXXXXXXXXXXXXXXMVTEKMPATSEFTPLIGIYITINMGLTXXXXXXXXXXXKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGXXXXXXXXXXXXXXXXXKPCFRQNLSTGFKNLSKH 1310
            DILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFTPLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLIVLKPCFRQNLSTGFKNLSKH
Sbjct:    8 DILKLKPNIDLSSLIEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFPCIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFTPLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSILWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLIVLKPCFRQNLSTGFKNLSKH 241          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000047472.1 (SMESG000047472.1)

HSP 1 Score: 335.109 bits (858), Expect = 1.664e-114
Identity = 159/165 (96.36%), Postives = 164/165 (99.39%), Query Frame = 3
Query:  129 SEGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKL 623
            S+GQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQ++I ++
Sbjct:   42 SKGQKSQEYKILQNIFRHYNRNIRPSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQVNISEI 206          
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Match: SMESG000047472.1 (SMESG000047472.1)

HSP 1 Score: 251.136 bits (640), Expect = 8.367e-83
Identity = 118/120 (98.33%), Postives = 120/120 (100.00%), Query Frame = 3
Query:  255 MINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDI 614
            MINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQ++I
Sbjct:    1 MINDLDEKNEILTTIVWLNQEWMDGRLAWNNSNYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQPIVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQVNI 120          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA75.797e-6439.53cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.15.797e-6439.53cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA28.801e-6436.18cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA21.414e-6336.18cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA71.622e-6339.02cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-168.728e-6838.28Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-115.237e-6335.49AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
unc-384.956e-5934.22Acetylcholine receptor subunit alpha-type unc-38 ... [more]
acr-92.294e-5837.61AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
acr-194.298e-5834.49AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha63.426e-7139.94gene:FBgn0032151 transcript:FBtr0331284[more]
nAChRalpha68.299e-7040.20gene:FBgn0032151 transcript:FBtr0079912[more]
nAChRalpha62.574e-6938.99gene:FBgn0032151 transcript:FBtr0079915[more]
nAChRalpha62.801e-6938.99gene:FBgn0032151 transcript:FBtr0303898[more]
nAChRalpha62.801e-6938.99gene:FBgn0032151 transcript:FBtr0079916[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna10a2.160e-6939.30cholinergic receptor, nicotinic, alpha 10a [Source... [more]
chrna10a2.215e-6839.80cholinergic receptor, nicotinic, alpha 10a [Source... [more]
CR847523.36.369e-6738.24neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrna2b8.317e-6537.34cholinergic receptor, nicotinic, alpha 2b (neurona... [more]
si:ch211-39a7.12.270e-6440.53si:ch211-39a7.1 [Source:ZFIN;Acc:ZDB-GENE-060503-6... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA25.118e-6939.41cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
CHRNA27.277e-6939.41cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
prepl1.106e-6638.21prolyl endopeptidase-like [Source:Xenbase;Acc:XB-G... [more]
CHRNA95.432e-6437.14cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
CHRNA92.198e-6337.70cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna75.565e-6338.87cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna62.892e-6236.36cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna21.191e-6135.62cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna21.191e-6135.62cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna41.990e-6136.77cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I8C7|ACH10_CHICK3.393e-6836.96Neuronal acetylcholine receptor subunit alpha-10 O... [more]
sp|P48180|ACH1_CAEEL1.110e-6638.28Acetylcholine receptor subunit alpha-type acr-16 O... [more]
sp|A8WQK3|ACH1_CAEBR1.125e-6637.42Acetylcholine receptor subunit alpha-type acr-16 O... [more]
sp|P09480|ACHA2_CHICK1.876e-6538.82Neuronal acetylcholine receptor subunit alpha-2 OS... [more]
sp|P36544|ACHA7_HUMAN2.784e-6339.53Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AMN31.329e-8846.03Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
A0A210QVW81.850e-8848.05Acetylcholine receptor subunit alpha-type acr-16 O... [more]
A0A3S1AA164.613e-8848.50Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
R7V1T84.708e-8646.95Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1S3I5A01.447e-8446.00neuronal acetylcholine receptor subunit alpha-3 is... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000019858.24.131e-7338.01neuronal acetylcholine receptor subunit alpha-10 [... [more]
ENSAMXT00000032409.15.197e-7137.90neuronal acetylcholine receptor subunit alpha-10 [... [more]
chrna10a5.107e-6838.28cholinergic receptor, nicotinic, alpha 10a [Source... [more]
chrna10a2.640e-6737.90cholinergic receptor, nicotinic, alpha 10a [Source... [more]
chrna2b9.120e-6538.17neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna33.894e-6035.99cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b1.460e-5734.44cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a3.426e-5437.31cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
htr3a5.812e-4132.195-hydroxytryptamine (serotonin) receptor 3A [Sourc... [more]
ENSPMAT00000008550.16.462e-3836.32pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO420721.157e-6036.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420543.640e-5934.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436426.593e-5935.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479691.186e-5835.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO374253.019e-5533.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000016544.29.176e-6838.59neuronal acetylcholine receptor subunit alpha-10-l... [more]
chrna4b2.619e-6537.38neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna10a2.865e-6537.41neuronal acetylcholine receptor subunit alpha-9-li... [more]
chrna2b8.841e-6537.91neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b8.841e-6537.91neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-6 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000047372.11.541e-131100.00SMESG000047372.1[more]
SMESG000047372.11.829e-131100.00SMESG000047372.1[more]
SMESG000047372.11.265e-130100.00SMESG000047372.1[more]
SMESG000047472.11.664e-11496.36SMESG000047472.1[more]
SMESG000047472.18.367e-8398.33SMESG000047472.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30026006 ID=SMED30026006|Name=Neuronal acetylcholine receptor subunit alpha-6|organism=Schmidtea mediterranea sexual|type=transcript|length=1352bp
ACCAATCACAATCGAGCAAATTCTCATTAAAAATGAATATTGATTAGAGT
ATGGAGTTTATATTTTCATATTTCATAATGCTTATCGAGACAAAGAGGAT
ATTTTTTATTTTTTTATTTTCATGCCTATCAGAAGGCCAGAAATCTCAAG
AGTACAAGATACTGCAGAATATATTTAGACATTATAATAGAAATATTCGT
CCATCCTCAAATTCTTCACAACCTGTAACAATAAAACTCGGAATAACATT
AGTAATGATAAACGATTTGGATGAAAAGAATGAAATATTGACAACTATTG
TATGGTTAAATCAGGAATGGATGGATGGAAGATTAGCTTGGAATAATAGC
AATTATGAATCAGTTGATAAAATAAGAACTCCTTGTACCAAAATATGGCT
GCCCGATATTGTCTTATTTAACAGCGTTCAAGAGAAATTCACAGAATATC
GGAAATCTCTTGTCACAATTTATAATAATGGGAAATTAATTTGGCAGCCC
ATAGTTACAATGCATAGTTTTTGCCGACTTGATATTTCCTATTTCCCATT
TGATGACCAAATTTGTATTCTATCTATGGGGTCCTGGGCATACTCAAAGG
ATCAGTTAGACATTCTAAAATTAAAACCGAATATAGACTTAAGCAGTCTA
ATTGAACATGGAGAATGGAATATTTTCAATACAAGTTCGAAAAGAACTGA
TAGATTTCATCCATCGACCAATGAGACTTATTCGGAAATATCATTTATCC
TCCAATTGAAAAGACGAAATTTATATTACATAATCAACGTAACATTTCCC
TGTATTATGTTGTCTATGCTCACTCTAGTTGGATTTATTTTGCCCCCAGA
ATCTGGTGAGAAAGTTACATTGAGTCTTACAGTTCTGCTATTGTATTCAT
TCTTTTTATTGATGGTTACTGAAAAGATGCCAGCTACATCAGAATTTACT
CCTTTAATCGGGATTTATATAACCATCAATATGGGTTTGACATCAATATC
AGTGATTATAGTTGTATTGGTTATCAAGATCCATCATAGAAAAAGTCAAA
ATGAAGTTTTATGTGGAGGTATATCTAATCAACAGAAAACTCGATCAATT
CTATGGTTAGGTTTTGAAGAATGTTTAGATCTTGAAAGTCCGCGAGAATT
GGTCTCAAGAAATTATTATCAAACGCTCGCCAGAAAGATTGAGAAATACG
TTGGAATAATTTTTTCAGTTTTAACTATAATAATTACTTTATTTTTAATC
GTTCTTAAGCCCTGTTTCCGACAAAATTTGTCTACCGGTTTTAAGAACCT
TTCAAAACATTAATTTTTTTGATGTGTATTTATATTACTCTTTCATTGTG
CG
back to top

protein sequence of SMED30026006-orf-1

>SMED30026006-orf-1 ID=SMED30026006-orf-1|Name=SMED30026006-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=421bp
MEFIFSYFIMLIETKRIFFIFLFSCLSEGQKSQEYKILQNIFRHYNRNIR
PSSNSSQPVTIKLGITLVMINDLDEKNEILTTIVWLNQEWMDGRLAWNNS
NYESVDKIRTPCTKIWLPDIVLFNSVQEKFTEYRKSLVTIYNNGKLIWQP
IVTMHSFCRLDISYFPFDDQICILSMGSWAYSKDQLDILKLKPNIDLSSL
IEHGEWNIFNTSSKRTDRFHPSTNETYSEISFILQLKRRNLYYIINVTFP
CIMLSMLTLVGFILPPESGEKVTLSLTVLLLYSFFLLMVTEKMPATSEFT
PLIGIYITINMGLTSISVIIVVLVIKIHHRKSQNEVLCGGISNQQKTRSI
LWLGFEECLDLESPRELVSRNYYQTLARKIEKYVGIIFSVLTIIITLFLI
VLKPCFRQNLSTGFKNLSKH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR002394Nicotinic_acetylcholine_rcpt
IPR006202Neur_chan_lig-bd
IPR027361Acetylcholine_rcpt_TM
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 120..132
score: 36.15
coord: 102..116
score: 35.33
coord: 138..156
score: 26.37
coord: 68..84
score: 40.65
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 81..97
score: 43.57
coord: 158..172
score: 48.84
coord: 114..125
score: 53.21
coord: 234..246
score: 37.77
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 30..335
e-value: 5.6E-87
score: 290.3
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 32..335
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 244..414
e-value: 4.5E-36
score: 126.0
NoneNo IPR availablePANTHERPTHR18945:SF799NICOTINIC ACETYLCHOLINE RECEPTOR ALPHA7, ISOFORM Ecoord: 32..335
NoneNo IPR availableCDDcd18997LGIC_ECD_nAChRcoord: 59..239
e-value: 6.37388E-72
score: 221.98
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 241..330
e-value: 1.10653E-21
score: 87.4181
NoneNo IPR availableTMHMMTMhelixcoord: 242..264
NoneNo IPR availableTMHMMTMhelixcoord: 303..325
NoneNo IPR availableTMHMMTMhelixcoord: 271..288
NoneNo IPR availableTMHMMTMhelixcoord: 383..402
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 35..239
e-value: 8.5E-59
score: 198.6
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 249..334
e-value: 7.8E-24
score: 85.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 30..243
e-value: 4.0E-68
score: 231.0
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 33..239
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 158..172
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 241..406