SMED30025988

Overview
NameSMED30025988
Smed IDSMED30025988
Length (bp)1545
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025988 (SMED30025988) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025988 (SMED30025988) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025988

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30025988h1SMcG0001650 SmedASXL_015674SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025988h1SMcG0001650 dd_Smed_v4_16012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025988h1SMcG0001650 dd_Smed_v4_16012_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025988 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.007007:16097..22789 +6926
Homology
BLAST of SMED30025988 vs. Planmine SMEST
Match: SMESG000022434.1 (SMESG000022434.1)

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 408/430 (94.88%), Postives = 412/430 (95.81%), Query Frame = 1
Query:  124 MGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNXXXXXXXXXXXXXXXXNTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDSKILFYFIINDRIFGIYLLFIAPYLLVI 1413
            MGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSD + +        I   Y + I   LLV+
Sbjct:    1 MGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDREFI-------SIHSFYTIAIILSLLVL 423          
BLAST of SMED30025988 vs. Planmine SMEST
Match: SMESG000022434.1 (SMESG000022434.1)

HSP 1 Score: 781.171 bits (2016), Expect = 0.000e+0
Identity = 408/459 (88.89%), Postives = 412/459 (89.76%), Query Frame = 1
Query:  124 MGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDF-----------------------------ANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNXXXXXXXXXXXXXXXXNTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDSKILFYFIINDRIFGIYLLFIAPYLLVI 1413
            MGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDF                             ANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSD + +        I   Y + I   LLV+
Sbjct:    1 MGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFLISPWTNYSAHQPRKNKHYYWSMQMLADCANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDREFI-------SIHSFYTIAIILSLLVL 452          
BLAST of SMED30025988 vs. Planmine SMEST
Match: SMESG000022434.1 (SMESG000022434.1)

HSP 1 Score: 764.992 bits (1974), Expect = 0.000e+0
Identity = 392/414 (94.69%), Postives = 396/414 (95.65%), Query Frame = 1
Query:  172 MKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNXXXXXXXXXXXXXXXXNTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDSKILFYFIINDRIFGIYLLFIAPYLLVI 1413
            MKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSD + +        I   Y + I   LLV+
Sbjct:    1 MKTIGQNCIEKFYDENRYCGIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNGRIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLILFRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDREFI-------SIHSFYTIAIILSLLVL 407          
BLAST of SMED30025988 vs. Planmine SMEST
Match: SMESG000022434.1 (SMESG000022434.1)

HSP 1 Score: 463.381 bits (1191), Expect = 9.295e-163
Identity = 255/285 (89.47%), Postives = 260/285 (91.23%), Query Frame = 1
Query:  559 VSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNXXXXXXXXXXXXXXXXNTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDSKILFYFIINDRIFGIYLLFIAPYLLVI 1413
            +S I      ANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSD + +        I   Y + I   LLV+
Sbjct:    1 MSSIIFSVQLANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDREFI-------SIHSFYTIAIILSLLVL 278          
BLAST of SMED30025988 vs. Planmine SMEST
Match: SMESG000022434.1 (SMESG000022434.1)

HSP 1 Score: 462.611 bits (1189), Expect = 2.614e-162
Identity = 253/275 (92.00%), Postives = 257/275 (93.45%), Query Frame = 1
Query:  589 ANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNXXXXXXXXXXXXXXXXNTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDSKILFYFIINDRIFGIYLLFIAPYLLVI 1413
            ANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSD + +        I   Y + I   LLV+
Sbjct:   20 ANKIAKTHFGNCAVVQAQSQPFSVVFTNLFENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSISIKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLEIFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKCPVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKFGNFSKEMEFKVSGTKSDREFI-------SIHSFYTIAIILSLLVL 287          
The following BLAST results are available for this feature:
BLAST of SMED30025988 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025988 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022434.10.000e+094.88SMESG000022434.1[more]
SMESG000022434.10.000e+088.89SMESG000022434.1[more]
SMESG000022434.10.000e+094.69SMESG000022434.1[more]
SMESG000022434.19.295e-16389.47SMESG000022434.1[more]
SMESG000022434.12.614e-16292.00SMESG000022434.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025988 ID=SMED30025988|Name=SMED30025988|organism=Schmidtea mediterranea sexual|type=transcript|length=1545bp
GTTTATTAATAATTGCATCGAGTTTCATATTTGTTAATTATCATTATTAT
ATTGAATTTAAATAAAATATTATTTTTAATGACAAAATTGAAAATTTATT
TAATAATACATTTATTCTGTGAAATGGGAAACATATTTATAAATAATTTA
GGAGTCTCCGGAATTTTTCAAATGAAAACAATTGGCCAAAACTGCATAGA
GAAATTTTATGACGAGAATCGCTACTGTGGAATCGGTTTGACGACCAGGA
AGAAGCATCAATGTATAAGATGGAAGGATTCGTCTTATTCACATGATAAC
AATGTAAGAGAGACGAGTATTTGTAAAGTAAATTGGTTAGGATACTTATG
GTGTCCTGTAAAAACCCATCAGAATGGACGTATTGTTTATATGCATGACT
GGTGTTCATACATTAAATGCGAACCCCAAACGTTTGATCTATGTCACTCT
GATATTTCATGGACATCGAAATCCTCATGGATAAAGTTAAATTTTGCAGG
AACTCCTCCAAAATATGGACTAATATTGTTTCGATATGACAACTCCGTTT
CTTGTTTCGTATCTCTAATCTGTGTCTTTTGTGACTTCGCTAATAAAATT
GCTAAAACGCACTTTGGTAATTGCGCAGTTGTCCAAGCGCAAAGTCAACC
ATTTTCAGTGGTTTTCACGAATCTTTTCGAAAACTCAGCGTATCCAATTT
ATTTAATTCCTGTGATAAATGCCAACACAATAGGGACATTGGCTCGATTG
TCACTCAAAACGTCATTCAAAAAATTCAACCTTTCATTGGTTATTCAAAT
AGTGAATATAAAATATAAAAGCATATCTATCAAATGGAAAAGTTCAACGA
AAATAAATACGTTAGAATACAAAGTAAATATCCAAGGAGAAGATTCTTCT
CAAACTATAACATCATTTGTACCCACCTATGCGTTCACGGATCTGCAACC
CTGTAGGGAATATATTATCTCTTTAGAAATTTTCAAAGAAGACCAAACTT
CGAACCTGTCTAAACCAATTCGTGTCAACACTAAATTTGAGTTTGATGAA
GTTAAAATTAAAAGTATCCGTCAAACTAATCGTGATTTTCAACAAGTTGA
ATGGGCCTACAACAATTCCCAAAAGTGTCCCGTCTCATTTCATATTCTTT
ATTATCCTAAATATAATTCCAAAGAAATAAAGAATATAAAAACAAGAAAT
TTATCAACAAAGCTGGCAAATTTGACAATAGGAAGTACATATATTGTAAA
AATACGACCGGAAGTGCTTAATAAATTTGGAAATTTTTCGAAAGAAATGG
AATTTAAAGTTTCTGGAACGAAATCGGATAGTAAAATCCTTTTTTATTTT
ATCATCAATGATCGAATATTTGGAATTTACTTGCTCTTCATTGCACCCTA
TCTATTAGTTATACACAATGACCATAAAAGACAGGAACTTTTGGGGCGCA
TACAACAAATTTTTAAAGCACTGCAAAAATCCAAAAAAATTAAACTTATT
ATTAATTTATAAATAAATAAAAAAATAAATTTGGCAACGATTTAA
back to top

protein sequence of SMED30025988-orf-1

>SMED30025988-orf-1 ID=SMED30025988-orf-1|Name=SMED30025988-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=478bp
MTKLKIYLIIHLFCEMGNIFINNLGVSGIFQMKTIGQNCIEKFYDENRYC
GIGLTTRKKHQCIRWKDSSYSHDNNVRETSICKVNWLGYLWCPVKTHQNG
RIVYMHDWCSYIKCEPQTFDLCHSDISWTSKSSWIKLNFAGTPPKYGLIL
FRYDNSVSCFVSLICVFCDFANKIAKTHFGNCAVVQAQSQPFSVVFTNLF
ENSAYPIYLIPVINANTIGTLARLSLKTSFKKFNLSLVIQIVNIKYKSIS
IKWKSSTKINTLEYKVNIQGEDSSQTITSFVPTYAFTDLQPCREYIISLE
IFKEDQTSNLSKPIRVNTKFEFDEVKIKSIRQTNRDFQQVEWAYNNSQKC
PVSFHILYYPKYNSKEIKNIKTRNLSTKLANLTIGSTYIVKIRPEVLNKF
GNFSKEMEFKVSGTKSDSKILFYFIINDRIFGIYLLFIAPYLLVIHNDHK
RQELLGRIQQIFKALQKSKKIKLIINL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR013783Ig-like_fold
IPR003961FN3_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 238..312
e-value: 6.7E-8
score: 34.8
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 326..416
e-value: 2.6E-5
score: 26.2
IPR003961Fibronectin type IIICDDcd00063FN3coord: 239..318
e-value: 0.00937541
score: 33.6239
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 240..410
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 430..447