Gamma-aminobutyric acid type B receptor subunit 2

Overview
NameGamma-aminobutyric acid type B receptor subunit 2
Smed IDSMED30025983
Length (bp)2533
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gamma-aminobutyric acid type B receptor subunit 2 (SMED30025983) t-SNE clustered cells

Violin plots show distribution of expression levels for Gamma-aminobutyric acid type B receptor subunit 2 (SMED30025983) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gamma-aminobutyric acid type B receptor subunit 2 (SMED30025983) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gamma-aminobutyric acid type B receptor subunit 2 (SMED30025983) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025983

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025983SMESG000005548.1 SmedASXL_004832SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025983SMESG000005545.1 SMESG000005543.1 SmedASXL_052745SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025983SMESG000005545.1 SMESG000005543.1 dd_Smed_v6_51663_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Human
Match: GABBR2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:HGNC Symbol;Acc:HGNC:4507])

HSP 1 Score: 229.18 bits (583), Expect = 2.048e-62
Identity = 178/630 (28.25%), Postives = 296/630 (46.98%), Query Frame = 2
Query:  578 PRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM----------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQ---DYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A++++L    W+ + TL  D     EV      +L    I +     +  +    +  +K    RI++    +N+    F C  Y   MYG  YQW+            V    NS+ C   N +AA +  I    E  +    +   GK       + N  ++    S  +    D +W I  ++ +     ++S  +Q   D+  T     ++  N M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD  +IL ++  I   +Y        + + ++   +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G    D + ++E  +  +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W+  D L+   +  + E        +I      C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:  125 PNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVF-CCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 747          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 209.149 bits (531), Expect = 8.078e-56
Identity = 190/766 (24.80%), Postives = 347/766 (45.30%), Query Frame = 2
Query:  194 ICNGNKDPCACKMRHFSLGQQNNSHYNIERRFT*EMHLTMEAL-ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +C G ++    K+R               R      H    A+ I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N   I + S NCT+D    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G N+  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +D++ L IW++ D L    +    EE    I  +I      C +R    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:   66 VCRGEREVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSERRAVYIGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 802          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 208.764 bits (530), Expect = 1.011e-55
Identity = 190/766 (24.80%), Postives = 347/766 (45.30%), Query Frame = 2
Query:  194 ICNGNKDPCACKMRHFSLGQQNNSHYNIERRFT*EMHLTMEAL-ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +C G ++    K+R               R      H    A+ I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N   I + S NCT+D    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G N+  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +D++ L IW++ D L    +    EE    I  +I      C +R    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:   66 VCRGEREVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSERRAVYIGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 802          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 208.764 bits (530), Expect = 1.011e-55
Identity = 190/766 (24.80%), Postives = 347/766 (45.30%), Query Frame = 2
Query:  194 ICNGNKDPCACKMRHFSLGQQNNSHYNIERRFT*EMHLTMEAL-ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +C G ++    K+R               R      H    A+ I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N   I + S NCT+D    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G N+  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +D++ L IW++ D L    +    EE    I  +I      C +R    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:   66 VCRGEREVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSERRAVYIGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 802          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Human
Match: GABBR1 (gamma-aminobutyric acid type B receptor subunit 1 [Source:HGNC Symbol;Acc:HGNC:4070])

HSP 1 Score: 208.764 bits (530), Expect = 1.011e-55
Identity = 190/766 (24.80%), Postives = 347/766 (45.30%), Query Frame = 2
Query:  194 ICNGNKDPCACKMRHFSLGQQNNSHYNIERRFT*EMHLTMEAL-ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +C G ++    K+R               R      H    A+ I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N   I + S NCT+D    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G N+  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +D++ L IW++ D L    +    EE    I  +I      C +R    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:   66 VCRGEREVVGPKVRKCLANGSWTDMDTPSRCVNRTPHSERRAVYIGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 802          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Celegans
Match: gbb-2 (Gamma-aminobutyric acid type B receptor subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:G5ECB2])

HSP 1 Score: 192.586 bits (488), Expect = 8.636e-51
Identity = 160/668 (23.95%), Postives = 309/668 (46.26%), Query Frame = 2
Query:  485 LEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTR---YSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLK------SNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM-----SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPS---LKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF-----CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGV 2422
            L+ +   +  +  +    Q ++ + +   + PR   +LG       E  A  +  ++I Q+ Y    +K ++      ++  F+++P     N A  + +    W+ + T++ +    Y +          +   +K       N+   E +  +LD +K    RI++  +   +      C+ Y+ GMYG  Y W+     S+  L     NCT++    A +        +  + +    +G     D    N +      +T    L D LW + ++++        S+ +    S     E + N+     F GLTG V F  N +R+  V+I Q+ +  ++    YD +    K +   +  W     PP DS +   +   I   ++    + A I I ++L  +++N ++R+ + I+MSS NLNN++  G + ++ S+I +G   + I   +   W+C+ + W L + F   FG++FSKTWR+H IF+  +M +K  IKD  LF+I+ +++ +DI +L  W       +        E+     +NI +      C + +S  F  +L+++KG+L+++G   AWETR V++  LNDSK +G ++Y  ++M+ + +    +L   +VN  F + +  +I  +  TL LVFVPK +++ ++ V
Sbjct:   68 LQGYRLEMIVKDTHCKTSQGMKALFDLIASRPRPVAILGGQCTEVNEPIAMALKYWQIVQLSYAETHAKFASSDSHELFTTFFRVVPGSRNTNMAKCKFVNHFGWKRVGTVKQNDQPRYALPHEALTTRLEHGFGVKIVHTAGVNWEQIETVGGELDELKERDVRIILVDVDEEMAATVL-CAGYHRGMYGDNYVWILPGYHSDKWLNQTHDNCTVEEMREAAKNHFSVEFALTRRDVDTKIVGNTRAGDVW--NEITQLDPNNTWRGYLYDGLWTLAIALSH-------SMGDNAEFSHHKMMEAIDNS----SFQGLTGKVKF-ANNERLGLVDIKQWSDGQYVPFAVYDGADDEFKIIDSTTKGW----SPPLDSTITERRREHISSILFLAMSLLALIGIFLALIFLLINFRYRNHRFIKMSSPNLNNIIIAGSICTFASVIMLGLD-TRIVSPDVFVWLCYTKTWTLCIGFTLSFGAMFSKTWRVHSIFTNIRMDRK-AIKDSKLFIILGILLFIDICVLVTWAFVSPFSYTVT-----ELPHIPEDNIVIIPEVEKCNSSHSGVFQAVLYAVKGVLMILGCFLAWETRHVNVPALNDSKYIGTSVYCCVVMSVLGLSTSVIL-QERVNEMFSLASFFVIFSTTLTLCLVFVPKVIELARNPV 708          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 181.03 bits (458), Expect = 5.542e-47
Identity = 166/658 (25.23%), Postives = 290/658 (44.07%), Query Frame = 2
Query:  536 PQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLK---SRIVINFLPRNLKTNDFECSIYNNGMYGPLY-----QWMSNVLLIT---NSTNCTLDNQIAARQAAIYFLSE---IYNQTIP--QDFIG---KKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSK-----SKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQ------VNNSEEVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P    Q +  F+  P   ++L  G      + A+    +K+  + Y  +S  LSN+ R+  LF+  PS  + N   I I+    W+    L          +K    +     I +     Y +      D +KTL+   +RI++       +     C  Y++G+YG  Y      W ++   I       NCT +    A  A  +F +E   +    IP   +  G   ++    Y Q +   N   F  E  L  D++WA+ L+ N TR    S +  +++   +    + L   ++   F G++G V F+++GDR++R  I Q Q   +   G YD +   L   N   W  G  PP DS +I      +    YY  ++FA + I+  +   +   K     II  S    NN++  G  +   S+  IG  PSD   I+ES    +CHARV +L+  F   +GS+F+K W +H + +      +   K   I     ++I++ +  +D+ + F+W L D L    Q        +SEE    +   +   C +     ++ I+   K +LL+ G   ++ETR + +  +NDS+ VG+AIY V +M  V  P+  +L + +V+  F  ++  ++IC++ ++ L++ PK   I
Sbjct:   79 PGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIKVDRQSFYGDPT----DAMKTLQRQDARIIVGLF-YVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWYIPPPEEHLNCTAEQMTEA--AEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDT-ANVGGFP-EAPLAYDAVWALALAFNCTRNNLPSHIRLENFTYDNKVIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVIKKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGL-PSDDISISESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQKDEPISSSKFYVIVAALTAVDVFVCFVWVLIDPLHLTEQKFPLFTPADSEEDE--MIMPVLQQCQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHI 724          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 176.022 bits (445), Expect = 2.895e-45
Identity = 166/669 (24.81%), Postives = 289/669 (43.20%), Query Frame = 2
Query:  536 PQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLK---SRIVINFLPRNLKTNDFECSIYNNGMYGPLY-----QWMSNVLLIT---NSTNCTLDNQIAARQAAIYFLSE---IYNQTIP--QDFIG---KKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXX----------------XXXXXXXXXXXXXXXXWELTDNLKWCTQ------VNNSEEVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P    Q +  F+  P   ++L  G      + A+    +K+  + Y  +S  LSN+ R+  LF+  PS  + N   I I+    W+    L          +K    +     I +     Y +      D +KTL+   +RI++       +     C  Y++G+YG  Y      W ++   I       NCT +    A  A  +F +E   +    IP   +  G   ++    Y Q +   N   F  E  L  D++WA+ L+ N TR    S +  +++   +    + L   ++   F G++G V F+++GDR++R  I Q Q   +   G YD +   L   N   W  G  PP DS +I      +    YY  ++FA + I+  +   +   K     II  S    NN++  G  +   S+  IG  PSD   I+ES    +CHARV +L+  F   +GS+F+K W +H + +       +  KD                    +I++ +  +D+ + F+W L D L    Q        +SEE    +   +   C +     ++ I+   K +LL+ G   ++ETR + +  +NDS+ VG+AIY V +M  V  P+  +L + +V+  F  ++  ++IC++ ++ L++ PK   I
Sbjct:   79 PGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIKVDRQSFYGDPT----DAMKTLQRQDARIIVGLF-YVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWYIPPPEEHLNCTAEQMTEA--AEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDT-ANVGGFP-EAPLAYDAVWALALAFNCTRNNLPSHIRLENFTYDNKVIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVIKKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGL-PSDDISISESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQKDELKPLLSNFSEKPISSSKFYVIVAALTAVDVFVCFVWVLIDPLHLTEQKFPLFTPADSEEDE--MIMPVLQQCQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHI 735          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 137.887 bits (346), Expect = 4.018e-33
Identity = 125/496 (25.20%), Postives = 208/496 (41.94%), Query Frame = 2
Query:  536 PQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLK---SRIVINFLPRNLKTNDFECSIYNNGMYGPLY-----QWMSNVLLIT---NSTNCTLDNQIAARQAAIYFLSE---IYNQTIP--QDFIG---KKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKD 1954
            P    Q +  F+  P   ++L  G      + A+    +K+  + Y  +S  LSN+ R+  LF+  PS  + N   I I+    W+    L          +K    +     I +     Y +      D +KTL+   +RI++       +     C  Y++G+YG  Y      W ++   I       NCT +    A  A  +F +E   +    IP   +  G   ++    Y Q +   N   F  E  L  D++WA+ L+ N TR    S +  +++   +    + L   ++   F G++G V F+++GDR++R  I Q Q   +   G YD +   L   N   W  G  PP DS +I      +    YY  ++FA + I+  +   +   K     II  S    NN++  G  +   S+  IG  PSD   I+ES    +CHARV +L+  F   +GS+F+K W +H + +       +  KD
Sbjct:   79 PGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIKVDRQSFYGDPT----DAMKTLQRQDARIIVGLF-YVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWYIPPPEEHLNCTAEQMTEA--AEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDT-ANVGGFP-EAPLAYDAVWALALAFNCTRNNLPSHIRLENFTYDNKVIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVIKKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGL-PSDDISISESLFPLLCHARVTILLFGFTFAYGSMFAKVWIVHRMGATENQQLASRQKD 564          

HSP 2 Score: 63.1586 bits (152), Expect = 7.627e-10
Identity = 30/101 (29.70%), Postives = 59/101 (58.42%), Query Frame = 2
Query: 2105 CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            C +     ++ I+   K +LL+ G   ++ETR + +  +NDS+ VG+AIY V +M  V  P+  +L + +V+  F  ++  ++IC++ ++ L++ PK   I
Sbjct:  668 CQSNQQEVWIGIIMGFKCLLLVFGTFLSYETRNLKLRFINDSRFVGLAIYNVAVMTLVTAPVVTLLIHGKVDANFAFISLTVLICTYISVGLIYGPKIRHI 768          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Celegans
Match: gbb-1 (Gamma-aminobutyric acid type B receptor subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:H2L0Q3])

HSP 1 Score: 112.464 bits (280), Expect = 1.113e-25
Identity = 112/455 (24.62%), Postives = 186/455 (40.88%), Query Frame = 2
Query:  536 PQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLK---SRIVINFLPRNLKTNDFECSIYNNGMYGPLY-----QWMSNVLLITNST---NCTLDNQIAARQAAIYFLSE---IYNQTIP--QDFIG---KKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCH 1831
            P    Q +  F+  P   ++L  G      + A+    +K+  + Y  +S  LSN+ R+  LF+  PS  + N   I I+    W+    L          +K    +     I +     Y +      D +KTL+   +RI++       +     C  Y++G+YG  Y      W ++   I       NCT +    A  A  +F +E   +    IP   +  G   ++    Y Q +   N   F  E  L  D++WA+ L+ N TR    S +  +++   +    + L   ++   F G++G V F+++GDR++R  I Q Q   +   G YD +   L   N   W  G  PP DS +I      +    YY  ++FA + I+  +   +   K     II  S    NN++  G  +   S+  IG  PSD   I+ES    +CH
Sbjct:   79 PGLAMQQLYDFLYKPPTKLMLLTGCSPVTTVIAEAAPVWKLVVLSYGGSSPALSNRNRFPTLFRTHPSANMQNPTRIHIMEKFKWKRFTILMSVEEVFVTTAKDLEAIARKKGIKVDRQSFYGDPT----DAMKTLQRQDARIIVGLF-YVTEARKVLCQAYHHGLYGRRYVWFFIGWYADTWYIPPPEEHLNCTAEQMTEA--AEYHFTTESVMLSRDNIPAISEMTGMQFQQRLTQYFQKDT-ANVGGFP-EAPLAYDAVWALALAFNCTRNNLPSHIRLENFTYDNKVIADTLFQCVKNTSFRGVSGKVMFSDSGDRIARTQIEQMQGGKYKIMGYYDTTSGDLEWYNKEQWLNGKGPPPDSTVIKKHAMTVSNEFYYPTILFAVLGIAACVFIYLFTQKHHERLIIFQSQPECNNILLIGCSLCLFSLFLIGL-PSDDISISESLFPLLCH 523          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Fly
Match: GABA-B-R2 (gene:FBgn0027575 transcript:FBtr0084167)

HSP 1 Score: 211.46 bits (537), Expect = 2.257e-56
Identity = 175/623 (28.09%), Postives = 299/623 (47.99%), Query Frame = 2
Query:  590 VVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQL-LSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNF-----SEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPE---FEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMN---SLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNL-KWCTQVN--NSEEVSG--YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            ++ G    +  +  A    ++ + Q+ Y   +  +  K  +   F+++PSE   N   + +L   NW  + T+ Y     Y +  +     L    + +     +  ++++ L  ++    RI++     +     F C  Y   MYG  YQW+      T+  N T D++ +  + A      I    +P    G         +  L  +     +E+S  +    D +WA  L+I          L + DY     E    E L NT     F G+TG V F  N +R + + I QFQ     K G Y     +L ++    + W  G  PPKD  LI  + + ++ +IY      + I + I+   +  NIK+R+ + I+MSS +LNNL+  G +M+YLSII +G   + ++ +    ++C AR W+LM  F   FG++FSKTWR+H IF+  K++KK VIKD  LF+++ +++ +DI ++  W++ D   +   Q+   + E +     I EN Y  C + +   F+ I+++ KG+LL+ G   AWETR V I  LNDSK +G ++Y V +       +  +L + + +  F +L+  II C+  TL LVFVPK +++
Sbjct:  105 MLFGAACTHVTDPIAKASKHWHLTQLSYA-DTHPMFTKDAFPNFFRVVPSENAFNAPRLALLKEFNWTRVGTV-YQNEPRYSLPHNHMVADLDAMEVEVVETQSFVNDVAESLKKLREKDVRIILGNFNEHFARKAF-CEAYKLDMYGRAYQWLIMATYSTDWWNVTQDSECSVEEIATALEGAILVDLLPLSTSGDITVAGITADEYLVEYDRLRGTEYSRFHGYTYDGIWAAALAIQYVAEKREDLLTHFDYRVKDWESVFLEALRNT----SFEGVTGPVRFY-NNERKANILINQFQLGQMEKIGEYHSQKSHLDLSLGKPVKWV-GKTPPKDRTLIYIEHSQVNPTIYIVSASASVIGVIIATVFLAFNIKYRNQRYIKMSSPHLNNLIIVGCMMTYLSIIFLGLD-TTLSSVAAFPYICTARAWILMAGFSLSFGAMFSKTWRVHSIFTDLKLNKK-VIKDYQLFMVVGVLLAIDIAIITTWQIADPFYRETKQLEPLHHENIDDVLVIPENEY--CQSEHMTIFVSIIYAYKGLLLVFGAFLAWETRHVSIPALNDSKHIGFSVYNVFITCLAGAAISLVLSDRK-DLVFVLLSFFIIFCTTATLCLVFVPKLVEL 713          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Fly
Match: GABA-B-R2 (gene:FBgn0027575 transcript:FBtr0084168)

HSP 1 Score: 211.46 bits (537), Expect = 2.637e-56
Identity = 175/623 (28.09%), Postives = 299/623 (47.99%), Query Frame = 2
Query:  590 VVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQL-LSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNF-----SEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPE---FEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMN---SLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNL-KWCTQVN--NSEEVSG--YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            ++ G    +  +  A    ++ + Q+ Y   +  +  K  +   F+++PSE   N   + +L   NW  + T+ Y     Y +  +     L    + +     +  ++++ L  ++    RI++     +     F C  Y   MYG  YQW+      T+  N T D++ +  + A      I    +P    G         +  L  +     +E+S  +    D +WA  L+I          L + DY     E    E L NT     F G+TG V F  N +R + + I QFQ     K G Y     +L ++    + W  G  PPKD  LI  + + ++ +IY      + I + I+   +  NIK+R+ + I+MSS +LNNL+  G +M+YLSII +G   + ++ +    ++C AR W+LM  F   FG++FSKTWR+H IF+  K++KK VIKD  LF+++ +++ +DI ++  W++ D   +   Q+   + E +     I EN Y  C + +   F+ I+++ KG+LL+ G   AWETR V I  LNDSK +G ++Y V +       +  +L + + +  F +L+  II C+  TL LVFVPK +++
Sbjct:  105 MLFGAACTHVTDPIAKASKHWHLTQLSYA-DTHPMFTKDAFPNFFRVVPSENAFNAPRLALLKEFNWTRVGTV-YQNEPRYSLPHNHMVADLDAMEVEVVETQSFVNDVAESLKKLREKDVRIILGNFNEHFARKAF-CEAYKLDMYGRAYQWLIMATYSTDWWNVTQDSECSVEEIATALEGAILVDLLPLSTSGDITVAGITADEYLVEYDRLRGTEYSRFHGYTYDGIWAAALAIQYVAEKREDLLTHFDYRVKDWESVFLEALRNT----SFEGVTGPVRFY-NNERKANILINQFQLGQMEKIGEYHSQKSHLDLSLGKPVKWV-GKTPPKDRTLIYIEHSQVNPTIYIVSASASVIGVIIATVFLAFNIKYRNQRYIKMSSPHLNNLIIVGCMMTYLSIIFLGLD-TTLSSVAAFPYICTARAWILMAGFSLSFGAMFSKTWRVHSIFTDLKLNKK-VIKDYQLFMVVGVLLAIDIAIITTWQIADPFYRETKQLEPLHHENIDDVLVIPENEY--CQSEHMTIFVSIIYAYKGLLLVFGAFLAWETRHVSIPALNDSKHIGFSVYNVFITCLAGAAISLVLSDRK-DLVFVLLSFFIIFCTTATLCLVFVPKLVEL 713          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Fly
Match: GABA-B-R2 (gene:FBgn0027575 transcript:FBtr0339154)

HSP 1 Score: 209.92 bits (533), Expect = 8.451e-56
Identity = 175/619 (28.27%), Postives = 296/619 (47.82%), Query Frame = 2
Query:  590 VVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQL-LSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNF-----SEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPE---FEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMN---SLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNL-KWCTQVN--NSEEVSG--YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPK 2395
            ++ G    +  +  A    ++ + Q+ Y   +  +  K  +   F+++PSE   N   + +L   NW  + T+ Y     Y +  +     L    + +     +  ++++ L  ++    RI++     +     F C  Y   MYG  YQW+      T+  N T D++ +  + A      I    +P    G         +  L  +     +E+S  +    D +WA  L+I          L + DY     E    E L NT     F G+TG V F  N +R + + I QFQ     K G Y     +L ++    + W  G  PPKD  LI  + + ++ +IY      + I + I+   +  NIK+R+ + I+MSS +LNNL+  G +M+YLSII +G   + ++ +    ++C AR W+LM  F   FG++FSKTWR+H IF+  K++KK VIKD  LF+++ +++ +DI ++  W++ D   +   Q+   + E +     I EN Y  C + +   F+ I+++ KG+LL+ G   AWETR V I  LNDSK +G ++Y V +       +  +L + + +  F +L+  II C+  TL LVFVPK
Sbjct:  105 MLFGAACTHVTDPIAKASKHWHLTQLSYA-DTHPMFTKDAFPNFFRVVPSENAFNAPRLALLKEFNWTRVGTV-YQNEPRYSLPHNHMVADLDAMEVEVVETQSFVNDVAESLKKLREKDVRIILGNFNEHFARKAF-CEAYKLDMYGRAYQWLIMATYSTDWWNVTQDSECSVEEIATALEGAILVDLLPLSTSGDITVAGITADEYLVEYDRLRGTEYSRFHGYTYDGIWAAALAIQYVAEKREDLLTHFDYRVKDWESVFLEALRNT----SFEGVTGPVRFY-NNERKANILINQFQLGQMEKIGEYHSQKSHLDLSLGKPVKWV-GKTPPKDRTLIYIEHSQVNPTIYIVSASASVIGVIIATVFLAFNIKYRNQRYIKMSSPHLNNLIIVGCMMTYLSIIFLGLD-TTLSSVAAFPYICTARAWILMAGFSLSFGAMFSKTWRVHSIFTDLKLNKK-VIKDYQLFMVVGVLLAIDIAIITTWQIADPFYRETKQLEPLHHENIDDVLVIPENEY--CQSEHMTIFVSIIYAYKGLLLVFGAFLAWETRHVSIPALNDSKHIGFSVYNVFITCLAGAAISLVLSDRK-DLVFVLLSFFIIFCTTATLCLVFVPK 709          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Fly
Match: GABA-B-R1 (gene:FBgn0260446 transcript:FBtr0304732)

HSP 1 Score: 201.83 bits (512), Expect = 7.066e-54
Identity = 158/623 (25.36%), Postives = 309/623 (49.60%), Query Frame = 2
Query:  671 YNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKEN-ISKQLDLIKTLK---SRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM---------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG--KKLFIDYIQNNMLK--------NFSEFSTENLLLMDSLWAIFLSINQT--RILFNSSLLNQDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFA--GIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV-----FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGVDVGQT 2437
            Y  +S  LS++ R+  LF+  PS  V N   I+++    W  +A L+       EV  S  + L N  +      V +++ +S   D ++ L+   +RI++      +      C +Y   +YG  + W            V L      CT++    A +  +   + ++NQ       G   + F   +   +++         + E   E  L  D++W++ L+ N+T  R+      L +D+  T  E  +++   M + +F G++G+V+F+  GDR++   I Q  +  + K G YD  L  L+ +N+  W  GG  P+D  ++   +  +   ++      +  GIF++ +L  II NI  +H ++I+ S    N +M  G+++  +S+I +G     ++   E   +C AR WLL   F   +G++FSK WR+H   +K+K   K  ++   L+ ++S ++ +D+V+L  W++ D L+   +    E+     T++I +      C ++ +  ++ +++  KG++L+ GL  A+ETR + ++ +NDS+ VGM+IY V+++  +  P+  M+  SQ + +F  +A A+I C F ++ L+FVPK +++ +H  D  ++
Sbjct:  132 YGASSPALSDRKRFPTLFRTHPSATVHNPTRIKLMKKFGWSRVAILQ----QAEEVFISTVEDLENRCMEAGVEIVTRQSFLSDPTDAVRNLRRQDARIIVGLF-YVVAARRVLCEMYKQQLYGRAHVWFFIGWYEDNWYEVNLKAEGITCTVEQMRIAAEGHLTTEALMWNQNNQTTISGMTAEEFRHRLNQALIEEGYDINHDRYPEGYQEAPLAYDAVWSVALAFNKTMERLTTGKKSL-RDFTYTDKEIADEIYAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMIDGKYEKLGYYDTQLDNLSWLNTEQWI-GGKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIFVAFAL--IIFNIWNKHRRVIQSSHPVCNTIMLFGVIICLISVILLGIDGRFVSP-EEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHRFTTKAKTDPKKKVEPWKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFPLEDPVS-TTDDIKIRPELEHCESQRNSMWLGLVYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVG-MVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIEVIRHPKDKAES 742          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Fly
Match: GABA-B-R1 (gene:FBgn0260446 transcript:FBtr0304731)

HSP 1 Score: 201.83 bits (512), Expect = 7.066e-54
Identity = 158/623 (25.36%), Postives = 309/623 (49.60%), Query Frame = 2
Query:  671 YNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKEN-ISKQLDLIKTLK---SRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM---------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG--KKLFIDYIQNNMLK--------NFSEFSTENLLLMDSLWAIFLSINQT--RILFNSSLLNQDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFA--GIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV-----FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGVDVGQT 2437
            Y  +S  LS++ R+  LF+  PS  V N   I+++    W  +A L+       EV  S  + L N  +      V +++ +S   D ++ L+   +RI++      +      C +Y   +YG  + W            V L      CT++    A +  +   + ++NQ       G   + F   +   +++         + E   E  L  D++W++ L+ N+T  R+      L +D+  T  E  +++   M + +F G++G+V+F+  GDR++   I Q  +  + K G YD  L  L+ +N+  W  GG  P+D  ++   +  +   ++      +  GIF++ +L  II NI  +H ++I+ S    N +M  G+++  +S+I +G     ++   E   +C AR WLL   F   +G++FSK WR+H   +K+K   K  ++   L+ ++S ++ +D+V+L  W++ D L+   +    E+     T++I +      C ++ +  ++ +++  KG++L+ GL  A+ETR + ++ +NDS+ VGM+IY V+++  +  P+  M+  SQ + +F  +A A+I C F ++ L+FVPK +++ +H  D  ++
Sbjct:  132 YGASSPALSDRKRFPTLFRTHPSATVHNPTRIKLMKKFGWSRVAILQ----QAEEVFISTVEDLENRCMEAGVEIVTRQSFLSDPTDAVRNLRRQDARIIVGLF-YVVAARRVLCEMYKQQLYGRAHVWFFIGWYEDNWYEVNLKAEGITCTVEQMRIAAEGHLTTEALMWNQNNQTTISGMTAEEFRHRLNQALIEEGYDINHDRYPEGYQEAPLAYDAVWSVALAFNKTMERLTTGKKSL-RDFTYTDKEIADEIYAAMNSTQFLGVSGVVAFSSQGDRIALTQIEQMIDGKYEKLGYYDTQLDNLSWLNTEQWI-GGKVPQDRTIVTHVLRTVSLPLFVCMCTISSCGIFVAFAL--IIFNIWNKHRRVIQSSHPVCNTIMLFGVIICLISVILLGIDGRFVSP-EEYPKICQARAWLLSTGFTLAYGAMFSKVWRVHRFTTKAKTDPKKKVEPWKLYTMVSGLLSIDLVILLSWQIFDPLQRYLETFPLEDPVS-TTDDIKIRPELEHCESQRNSMWLGLVYGFKGLILVFGLFLAYETRSIKVKQINDSRYVGMSIYNVVVLCLITAPVG-MVIASQQDASFAFVALAVIFCCFLSMLLIFVPKVIEVIRHPKDKAES 742          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Zebrafish
Match: gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:ZFIN;Acc:ZDB-GENE-060503-620])

HSP 1 Score: 236.498 bits (602), Expect = 3.302e-65
Identity = 188/664 (28.31%), Postives = 313/664 (47.14%), Query Frame = 2
Query:  473 HKAELEKFSFSIQYQQINT--NDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK---KLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLA----NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            H  E  ++SFS+  +  +T  ++ + LR   ++    P+  ++ G        I A+ +  + + Q+ +   +  L+++ +Y   F+ +PS+  +N A+++ L   NW  + TL  D     EV       L    I +     +  +    +  +K    RI+I     NL    F C  YN  MYG  YQW+       N     NSTNCT    + A +  I    E  +    +   G+   +   +Y +    K   E S  +    D +W I  ++ +   L      +  Y + + +  ++     + M    F G+TG V F  NG+RM  +   QFQ    +K G Y+     L + N+   F G  PPKD   +  +   I+  +Y        + + +    +  NIK R+ ++I+MSS  +NNL+  G ++SY SI   G   S ++   E + +C  R W+L++ +   FG++F+KTWR+H IF   KM KK +IKD  LF+I+  ++L+D+ +L  W++ D LK   +  + E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPKF+ +
Sbjct:   85 HIRESRQYSFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADRKKYPNFFRTVPSDNAVNPAVVKFLNFYNWSRVGTLTQDVQRFSEVRNDLTNELEKADIQIADTESFSNDPCVNVKKLKDNDVRIIIGQFDENLAAKVF-CCAYNLNMYGSKYQWIIPGWYQGNWWEQANSTNCTTRKLLTAMEGYISVDFEPLSAKQIKGISGRTPQEYEREYNRERDQKGV-ETSKFHGFAYDGIWVIAKTLTRVMELLRHKERHDMYHNFTVDDREVGKMVLDVMNETNFFGVTGQVMF-RNGERMGTIKFTQFQEGQEVKVGEYNAIADVLDLINNTIRFQGVEPPKDRTFVRLQRRQINVPLYSILSTITILGMLMGGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSD-KEFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLFIIVGGMLLIDLCILICWQIVDPLKRTVEEYSLEADPQGRDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKFVTM 742          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Zebrafish
Match: gabbr1b (gamma-aminobutyric acid (GABA) B receptor, 1b [Source:ZFIN;Acc:ZDB-GENE-060503-5])

HSP 1 Score: 190.66 bits (483), Expect = 1.253e-49
Identity = 170/665 (25.56%), Postives = 311/665 (46.77%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLL--SNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYN-QTI--PQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQT--------RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGIN----ESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T           Q +  +   IS++ +F+    ++  +  +K   +RI++           F C +Y   +YG  Y W        N   I + S NCT++    A +  +     + N +T+    +   ++     +     KN  E     E  L  D++WA+ L++N+T        R L + +  N+D  +      ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD     +T  +L W+      G  PP D  +++ K   + + ++ +  VFAG+ I + + C+  NI   + + I+ S   LNN+   G +M+  ++ P+G     I+G++    +   VC  R+WLL L F   +GS+F+K W +H +F+K    K     ++   L+  + +++++DI+ L IW++ D L    +    E   G + E I      C +     ++ +++  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L + Q + +F   + AII   + TL ++FVPK  ++   G
Sbjct:  217 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLYGKKYVWFLIGWYADNWFKIKDPSINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFLAQLMSKLGGKNPEETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNKDITA------EIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYD-----MTKGNLSWYGNDRWIGSGPPADQTVVIQKFRYLSQKLFVSVSVFAGLGILMGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLG-----IDGLHVRNSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKRKHLEPWKLYATVGVLLVIDILSLMIWQIVDPLHITVEKFTKEAPKGDVDELIEPLLQHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQ-DASFAFASLAIIFSVYITLVVLFVPKMRRLITRG 861          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Zebrafish
Match: gabbr1b (gamma-aminobutyric acid (GABA) B receptor, 1b [Source:ZFIN;Acc:ZDB-GENE-060503-5])

HSP 1 Score: 190.274 bits (482), Expect = 1.659e-49
Identity = 170/666 (25.53%), Postives = 311/666 (46.70%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLL--SNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYN-QTI--PQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQT--------RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGIN----ESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV---IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T           Q +  +   IS++ +F+    ++  +  +K   +RI++           F C +Y   +YG  Y W        N   I + S NCT++    A +  +     + N +T+    +   ++     +     KN  E     E  L  D++WA+ L++N+T        R L + +  N+D  +      ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD     +T  +L W+      G  PP D  +++ K   + + ++ +  VFAG+ I + + C+  NI   + + I+ S   LNN+   G +M+  ++ P+G     I+G++    +   VC  R+WLL L F   +GS+F+K W +H +F+K    K      ++   L+  + +++++DI+ L IW++ D L    +    E   G + E I      C +     ++ +++  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L + Q + +F   + AII   + TL ++FVPK  ++   G
Sbjct:  211 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLYGKKYVWFLIGWYADNWFKIKDPSINCTVEQMTEAVEGHVTTEIVMLNPETVRGASNLTSQEFLAQLMSKLGGKNPEETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNKDITA------EIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYD-----MTKGNLSWYGNDRWIGSGPPADQTVVIQKFRYLSQKLFVSVSVFAGLGILMGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLG-----IDGLHVRNSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKRKQHLEPWKLYATVGVLLVIDILSLMIWQIVDPLHITVEKFTKEAPKGDVDELIEPLLQHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQ-DASFAFASLAIIFSVYITLVVLFVPKMRRLITRG 856          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Zebrafish
Match: gabbr1a (gamma-aminobutyric acid (GABA) B receptor, 1a [Source:ZFIN;Acc:ZDB-GENE-030904-5])

HSP 1 Score: 183.341 bits (464), Expect = 5.886e-48
Identity = 166/662 (25.08%), Postives = 312/662 (47.13%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLL--SNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK-----KLFIDYIQNNML-KNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLN-QDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESK----WVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSE---EVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +    Y  +S  LSN+ R+   F+  PS  + N   +++     W  IAT++  T           + +  +N  IS++ +F+    ++  +  +K   +RI++           F C ++   +YG  Y W        N   I + + NCT++N   A +  I     + N   P+   G      + FI  + + +  KN  E     E  L  D++WA+ L++N+T     +     +D+   + E   ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD      T  +L W+      G  PP D   ++ +   + + ++ +  VFAG+ I + + C+  NI     + I+ S   LNN+   G V++  ++ P+G     I+G++  +     VC  R+WLL L F   +GS+F+K W +H +F+K    K+    ++   L+  +++++ +D++ L IW++ D L    +    E   E    + + +   C ++    ++ +++  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AII   + TL ++FVPK  ++   G
Sbjct:   18 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWEWTKIATIQQTTEVFTSTLDDLEERVKEANIEISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVFKEKLYGKKYVWFLIGWYADNWFKIKDPAINCTVENMTEAVEGHITTEIVMLN---PETVRGASNLTSQEFIAQLMSRLGGKNPEETGGFQEAPLAYDAVWALALALNKTVAPLRAKGWGLEDFNYNNKEITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDS-----TKGNLSWYGNDKWIGLSPPADQTKVIKEFRYLSQKLFVSVSVFAGLGILLGIVCLSFNIYNSSVRYIQNSQPYLNNMTAVGCVLALAAVFPLG-----IDGLHVRRSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLEPWKLYATVAVLLAIDVLSLLIWQIMDPLHITVEQFTKEAPKEDLDVLIQPLLEHCSSKKMNTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCMITAPVTMIL-SSQQDASFAFASLAIIFSVYITLVVLFVPKIRRLITRG 662          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Zebrafish
Match: gabbr1a (gamma-aminobutyric acid (GABA) B receptor, 1a [Source:ZFIN;Acc:ZDB-GENE-030904-5])

HSP 1 Score: 177.948 bits (450), Expect = 1.652e-45
Identity = 180/734 (24.52%), Postives = 333/734 (45.37%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLL--SNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK-----KLFIDYIQNNML-KNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLN-QDYLSTSPEF-EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESK----WVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSE---EVSGYITENIYVFCCAR--NSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            I  LF +S    GG+P       A  +     +N    + +Y L+                I Y  +   DP    +++   +    I +VL PG    + + A+    + +    Y  +S  LSN+ R+   F+  PS  + N   +++     W  IAT++  T           + +  +N  IS++ +F+    ++  +  +K   +RI++           F C ++   +YG  Y W        N   I + + NCT++N   A +  I     + N   P+   G      + FI  + + +  KN  E     E  L  D++WA+ L++N+T     +     +D+   + E   ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD      T  +L W+      G  PP D   ++ +   + + ++ +  VFAG+ I + + C+  NI     + I+ S   LNN+   G V++  ++ P+G     I+G++  +     VC  R+WLL L F   +GS+F+K W +H +F+K    K+    ++   L+  +++++ +D++ L IW++ D L    +    E   E    + + +   C ++  N+     +++  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AII   + TL ++FVPK  ++   G
Sbjct:  163 IGALFPMS----GGWPGGQACLPAAQMALDLVNNRSDILPDYELEL---------------IHYDSMC--DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWEWTKIATIQQTTEVFTSTLDDLEERVKEANIEISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVFKEKLYGKKYVWFLIGWYADNWFKIKDPAINCTVENMTEAVEGHITTEIVMLN---PETVRGASNLTSQEFIAQLMSRLGGKNPEETGGFQEAPLAYDAVWALALALNKTVAPLRAKGWGLEDFNYNNKEITAEIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDS-----TKGNLSWYGNDKWIGLSPPADQTKVIKEFRYLSQKLFVSVSVFAGLGILLGIVCLSFNIYNSSVRYIQNSQPYLNNMTAVGCVLALAAVFPLG-----IDGLHVRRSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLEPWKLYATVAVLLAIDVLSLLIWQIMDPLHITVEQFTKEAPKEDLDVLIQPLLEHCSSKKMNTWLGECVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCMITAPVTMIL-SSQQDASFAFASLAIIFSVYITLVVLFVPKIRRLITRG 858          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Xenopus
Match: gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:NCBI gene;Acc:548761])

HSP 1 Score: 228.024 bits (580), Expect = 3.266e-62
Identity = 180/640 (28.12%), Postives = 303/640 (47.34%), Query Frame = 2
Query:  530 NDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQT-RILFNSSLLN--QDYLSTSPEFEQL-ANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            ++ Q L+   ++    P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A+++ L    W+ + TL  D     EV       L + +I +     +  +    +  +K    RI+I     ++    F C  ++  MYG  YQW+      +      N++ C+  N + A +  I    E  +    +   G+       + N  +   E S  +    D +W I  ++++    L++S      QD+  T  +  ++  + M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD   I  +   I   +Y        I + ++ T +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G   S ++  N  + +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W++ D LK   +  N E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:   85 DNAQGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLKGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAIVKFLKHFKWKRVGTLTQDIQRFSEVRNDLTGELEDSAIQIADTESFSNDPCSSVKKLKGNDVRIIIGQFDEHMAAKVF-CCAFDEDMYGSKYQWIIPGWYQALWWQQANTSTCSTKNLLTAMEGYIGVDFEPLSTKQIKTISGRTPQQYEKEYNEKRAGVEPSKFHGYAYDGIWVIAKTLHRALEYLYSSKQRQRIQDFNYTDHKLGKIFLDAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDGKEVKVGEYNAVADSLELINDTIRFQGVEPPKDQTFIREERRQIYLPLYSILSTLTIIGMIMASTFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSA-NTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQIVDPLKRTVEEYNLEPDPAGRDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 719          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Xenopus
Match: gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:NCBI gene;Acc:548761])

HSP 1 Score: 226.868 bits (577), Expect = 1.154e-61
Identity = 180/640 (28.12%), Postives = 303/640 (47.34%), Query Frame = 2
Query:  530 NDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQT-RILFNSSLLN--QDYLSTSPEFEQL-ANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            ++ Q L+   ++    P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A+++ L    W+ + TL  D     EV       L + +I +     +  +    +  +K    RI+I     ++    F C  ++  MYG  YQW+      +      N++ C+  N + A +  I    E  +    +   G+       + N  +   E S  +    D +W I  ++++    L++S      QD+  T  +  ++  + M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD   I  +   I   +Y        I + ++ T +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G   S ++  N  + +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W++ D LK   +  N E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:  134 DNAQGLKAFYDAIKYGPNHLMVFGGVCPSVTSIIAESLKGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAIVKFLKHFKWKRVGTLTQDIQRFSEVRNDLTGELEDSAIQIADTESFSNDPCSSVKKLKGNDVRIIIGQFDEHMAAKVF-CCAFDEDMYGSKYQWIIPGWYQALWWQQANTSTCSTKNLLTAMEGYIGVDFEPLSTKQIKTISGRTPQQYEKEYNEKRAGVEPSKFHGYAYDGIWVIAKTLHRALEYLYSSKQRQRIQDFNYTDHKLGKIFLDAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDGKEVKVGEYNAVADSLELINDTIRFQGVEPPKDQTFIREERRQIYLPLYSILSTLTIIGMIMASTFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGLDGSFVSA-NTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQIVDPLKRTVEEYNLEPDPAGRDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 768          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 191.045 bits (484), Expect = 8.417e-50
Identity = 185/775 (23.87%), Postives = 350/775 (45.16%), Query Frame = 2
Query:  194 ICNGNKDPCACKMRHFSLGQQNNSHYNIE---RRFT*EMHLTMEAL-ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITNST-NCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG-----KKLFIDYIQNNMLKN--FSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFS-----KSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +C G ++    K+R     Q+N +  +++   R F         AL +  LF +S    GG+P     Q A  +     +N    +  Y L+  +  H ++ +    +    ++  NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T           + +    I +     +  + +  +  +K   +R+++           F C +Y   ++G  Y W        N   I +   NCT++    A +  +     + N   P++  G      + F++ ++  + +N   +    E  L  D++WA+ L++N+T    +      +  + + +   E++   M +  F G++G V F+ +G RM+   I Q Q   + K G YD +   L+  N+  W  GG PP D   ++     + + ++ +  V AG+ I +   C+  NI   H + I+ S  +LN++   G ++S  ++ P+G     ++G +   W    VC AR+WLL L F   +GS+F+K W IH  F+     K +  +   ++   L+  +SL++ LD++ L IW++ D L+   +    EE  G +   I      C +     ++ I++  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AI+  ++ TL ++FVPK  ++   G
Sbjct:   63 VCRGEREISGPKVRKC---QRNGTWTDMDKPSRCFRHPESSRKRALHVGALFPMS----GGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIH--HDSQCDPGQATRYLYELLYNDP---------------IKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAIPVKNLKRQDARVIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEMTQAVEGHVTTEIVMLN---PENTRGISNMTSQEFMEKLKKRLGENPEMTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWI-GGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLG-----LDGRHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKERRKQSQTLEPWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRG 802          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 188.348 bits (477), Expect = 9.106e-49
Identity = 175/728 (24.04%), Postives = 331/728 (45.47%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITNST-NCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG-----KKLFIDYIQNNMLKN--FSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFS-----KSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +  LF +S    GG+P     Q A  +     +N    +  Y L+  +  H ++ +    +    ++  NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T           + +    I +     +  + +  +  +K   +R+++           F C +Y   ++G  Y W        N   I +   NCT++    A +  +     + N   P++  G      + F++ ++  + +N   +    E  L  D++WA+ L++N+T    +      +  + + +   E++   M +  F G++G V F+ +G RM+   I Q Q   + K G YD +   L+  N+  W  GG PP D   ++     + + ++ +  V AG+ I +   C+  NI   H + I+ S  +LN++   G ++S  ++ P+G     ++G +   W    VC AR+WLL L F   +GS+F+K W IH  F+     K +  +   ++   L+  +SL++ LD++ L IW++ D L+   +    EE  G +   I      C +     ++ I++  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AI+  ++ TL ++FVPK  ++   G
Sbjct:  170 VGALFPMS----GGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIH--HDSQCDPGQATRYLYELLYNDP---------------IKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAIPVKNLKRQDARVIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEMTQAVEGHVTTEIVMLN---PENTRGISNMTSQEFMEKLKKRLGENPEMTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWI-GGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLG-----LDGRHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKERRKQSQTLEPWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRG 865          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Xenopus
Match: tonsl (tonsoku like, DNA repair protein [Source:Xenbase;Acc:XB-GENE-5939806])

HSP 1 Score: 187.963 bits (476), Expect = 1.058e-48
Identity = 175/728 (24.04%), Postives = 332/728 (45.60%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG-----KKLFIDYIQNNMLKN--FSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLT-MNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFS-----KSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            +  LF +S    GG+P     Q A  +     +N    +  Y L+  +  H ++ +    +    ++  NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T           + +    I +     +  + +  +  +K   +R+++           F C +Y   ++G  Y W        N   I + + NCT++    A +  +     + N   P++  G      + F++ ++  + +N   +    E  L  D++WA+ L++N+T    +      +  + + +   E++   M +  F G++G V F+ +G RM+   I Q Q   + K G YD +   L+  N+  W  GG PP D   ++     + + ++ +  V AG+ I +   C+  NI   H + I+ S  +LN++   G ++S  ++ P+G     ++G +   W    VC AR+WLL L F   +GS+F+K W IH  F+     K +  +   ++   L+  +SL++ LD++ L IW++ D L+   +    EE  G +   I      C +     ++ I++  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AI+  ++ TL ++FVPK  ++   G
Sbjct:  114 VGALFPMS----GGWPGGQACQPAAQMALEDVNNRRDILPEYELRLIH--HDSQCDPGQATRYLYELLYNDP---------------IKIMLMPGCSSVSTLVAEAARMWHLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFKKWGWTKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAIPVKNLKRQDARVIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIPDPAINCTVEEMTQAVEGHVTTEIVMLN---PENTRGISNMTSQEFMEKLKKRLGENPEMTGGLQEAPLAYDAIWALALALNKTAYELSKKGRRLEDFNYNNKMISEEIYRAMNSSSFDGVSGHVVFDASGSRMAWTLIEQLQGGVYKKIGYYDSTKDNLSWYNNDKWI-GGSPPADHTKVIITFRYVSQKLFISVSVLAGLGILLGFVCLSFNIYNSHVRYIQNSQPHLNDVTAAGCILSLAAVFPLG-----LDGRHIETWHFPLVCQARLWLLGLGFSLAYGSMFTKIWWIHTAFTKKDDKKERRKQSQTLEPWKLYTTVSLLLGLDVITLGIWQIVDPLQRSIEEFTKEEPRGDLDVLILPQLEHCSSLKMNTWLGIVYGSKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFSSLAIVFSAYITLVVLFVPKMRRLITRG 809          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Mouse
Match: Gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:MGI Symbol;Acc:MGI:2386030])

HSP 1 Score: 226.483 bits (576), Expect = 1.173e-61
Identity = 176/630 (27.94%), Postives = 297/630 (47.14%), Query Frame = 2
Query:  578 PRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM----------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQ---DYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A++++L    WR + TL  D     EV      +L    I +     +  +    +  +K    RI++    +N+    F C  +   M+G  YQW+            V +  NS+ C   + +AA +  I    E  +    +   GK       + N  ++    S  +    D +W I  ++ +     ++S  +Q   D+  T     ++  N M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD  +IL ++  I   +Y        + + ++   +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G    D + ++E  +  +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W+  D L+   +  + E        +I      C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:  124 PNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVF-CCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSRCLRRSLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNSKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 746          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Mouse
Match: Gabbr1 (gamma-aminobutyric acid (GABA) B receptor, 1 [Source:MGI Symbol;Acc:MGI:1860139])

HSP 1 Score: 202.216 bits (513), Expect = 7.415e-54
Identity = 180/722 (24.93%), Postives = 333/722 (46.12%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITN-------STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N       S NCT++    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G ++  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +DI+ L IW++ D L    +    EE    I  +I      C ++    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:   55 IGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 747          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Mouse
Match: Gabbr1 (gamma-aminobutyric acid (GABA) B receptor, 1 [Source:MGI Symbol;Acc:MGI:1860139])

HSP 1 Score: 201.83 bits (512), Expect = 2.554e-53
Identity = 180/722 (24.93%), Postives = 333/722 (46.12%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITN-------STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N       S NCT++    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G ++  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +DI+ L IW++ D L    +    EE    I  +I      C ++    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:  171 IGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 863          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Mouse
Match: Gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:MGI Symbol;Acc:MGI:2386030])

HSP 1 Score: 92.0485 bits (227), Expect = 6.720e-21
Identity = 67/191 (35.08%), Postives = 95/191 (49.74%), Query Frame = 2
Query: 1835 RVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W+  D L+          V  Y  E                          L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:    2 RTWILTVGYTTAFGAMFAKTWRVHAIFKNVKMKKK-IIKDQKLLVIVGGMLLIDLCILICWQAVDPLR--------RTVERYSME--------------------------LFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 156          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 56.6102 bits (135), Expect = 1.607e-7
Identity = 75/358 (20.95%), Postives = 141/358 (39.39%), Query Frame = 2
Query:  560 NSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQL--DLIKTL-----KSRIVINFLPRNLKTNDFECSIYNNGMYGPLY-----QWMSNVLLITNSTNCTLDN-QIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTE----NLLLMDSLWAIFLSINQTRILFNSSLLNQDY----------LSTSPEFEQLANTMRTIR------------FAGLTG-MVSFNENGDRMSRVNIYQFQNKS-----FIKCGSYD 1498
            +SF +   I  V+GPG+   A    +L+  + IPQI Y+  S  LS+KT +    +++PS+     AM+ I+   NW  ++ +  + N      ++F+ + +   I +  ++    N  +Q    L+K L     K+R+V  F    +       ++   G+ G         W     +        +    I  +   + +  + Y +  P+  +    F ++ Q+        F+ E    N     SL      +  +++ F   ++N  Y          +S  P +  L + M+ I             F G++G M+ F+ENGD   R  I  F+        +I  GS+D
Sbjct:  134 SSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLRSHLPKARVVACFC-EGMTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNLRNPWFQEFWQHRFQCRLEGFAQENSKYNKTCNSSLTLRTHHVQDSKMGF---VINAIYSMAYGLHNMQMSLCPGYAGLCDAMKPIDGRKLLDSLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWD 487          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. UniProt/SwissProt
Match: sp|O75899|GABR2_HUMAN (Gamma-aminobutyric acid type B receptor subunit 2 OS=Homo sapiens OX=9606 GN=GABBR2 PE=1 SV=1)

HSP 1 Score: 229.18 bits (583), Expect = 9.833e-62
Identity = 178/630 (28.25%), Postives = 296/630 (46.98%), Query Frame = 2
Query:  578 PRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM----------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQ---DYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A++++L    W+ + TL  D     EV      +L    I +     +  +    +  +K    RI++    +N+    F C  Y   MYG  YQW+            V    NS+ C   N +AA +  I    E  +    +   GK       + N  ++    S  +    D +W I  ++ +     ++S  +Q   D+  T     ++  N M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD  +IL ++  I   +Y        + + ++   +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G    D + ++E  +  +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W+  D L+   +  + E        +I      C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:  125 PNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHYQWKRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVF-CCAYEENMYGSKYQWIIPGWYEPSWWEQVHTEANSSRCLRKNLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNNKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVEKYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 747          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. UniProt/SwissProt
Match: sp|O88871|GABR2_RAT (Gamma-aminobutyric acid type B receptor subunit 2 OS=Rattus norvegicus OX=10116 GN=Gabbr2 PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 6.056e-61
Identity = 176/630 (27.94%), Postives = 297/630 (47.14%), Query Frame = 2
Query:  578 PRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM----------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQ---DYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A++++L    WR + TL  D     EV      +L    I +     +  +    +  +K    RI++    +N+    F C  +   M+G  YQW+            V +  NS+ C   + +AA +  I    E  +    +   GK       + N  ++    S  +    D +W I  ++ +     ++S  +Q   D+  T     ++  N M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD  +IL ++  I   +Y        + + ++   +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G    D + ++E  +  +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W+  D L+   +  + E        +I      C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:  124 PNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVF-CCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSRCLRRSLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQFEREYNSKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGKIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 746          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. UniProt/SwissProt
Match: sp|Q80T41|GABR2_MOUSE (Gamma-aminobutyric acid type B receptor subunit 2 OS=Mus musculus OX=10090 GN=Gabbr2 PE=1 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 8.208e-61
Identity = 176/630 (27.94%), Postives = 297/630 (47.14%), Query Frame = 2
Query:  578 PRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM----------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQ---DYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            P   +V G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A++++L    WR + TL  D     EV      +L    I +     +  +    +  +K    RI++    +N+    F C  +   M+G  YQW+            V +  NS+ C   + +AA +  I    E  +    +   GK       + N  ++    S  +    D +W I  ++ +     ++S  +Q   D+  T     ++  N M    F G+TG V F  NG+RM  +   QFQ+   +K G Y+     L + N    F G  PPKD  +IL ++  I   +Y        + + ++   +  NIK R+ K+I+MSS  +NNL+  G ++SY SI   G    D + ++E  +  +C  R W+L + +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W+  D L+   +  + E        +I      C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:  124 PNHLMVFGGVCPSVTSIIAESLQGWNLVQLSFAATTPVLADKKKYPYFFRTVPSDNAVNPAILKLLKHFRWRRVGTLTQDVQRFSEVRNDLTGVLYGEDIEISDTESFSNDPCTSVKKLKGNDVRIILGQFDQNMAAKVF-CCAFEESMFGSKYQWIIPGWYEPAWWEQVHVEANSSRCLRRSLLAAMEGYIGVDFEPLSSKQIKTISGKTPQQYEREYNSKRSGVGPSKFHGYAYDGIWVIAKTLQRAMETLHASSRHQRIQDFNYTDHTLGRIILNAMNETNFFGVTGQVVF-RNGERMGTIKFTQFQDSREVKVGEYNAVADTLEIINDTIRFQGSEPPKDKTIILEQLRKISLPLYSILSALTILGMIMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGSFVSEKTFETLCTVRTWILTVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLVIVGGMLLIDLCILICWQAVDPLRRTVERYSMEPDPAGRDISIRPLLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITL 746          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. UniProt/SwissProt
Match: sp|Q9UBS5|GABR1_HUMAN (Gamma-aminobutyric acid type B receptor subunit 1 OS=Homo sapiens OX=9606 GN=GABBR1 PE=1 SV=1)

HSP 1 Score: 207.994 bits (528), Expect = 1.422e-54
Identity = 183/722 (25.35%), Postives = 335/722 (46.40%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N   I + S NCT+D    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G N+  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +D++ L IW++ D L    +    EE    I  +I      C +R    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:  172 IGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKIYDPSINCTVDEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRNQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDVLTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSRKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 864          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. UniProt/SwissProt
Match: sp|Q9WV18|GABR1_MOUSE (Gamma-aminobutyric acid type B receptor subunit 1 OS=Mus musculus OX=10090 GN=Gabbr1 PE=1 SV=1)

HSP 1 Score: 201.83 bits (512), Expect = 1.787e-52
Identity = 180/722 (24.93%), Postives = 333/722 (46.12%), Query Frame = 2
Query:  323 ISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHK---AELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITN-------STNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF--EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHK--KNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV---FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            I  LF +S    GG+P     Q A  +     ++    + +Y L+  +   K    +  K+ + + Y     NDP               I ++L PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +++     W+ IAT++  T           + +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N       S NCT++    A +      I  L+    ++I    +  + F++ +   + ++  E     E  L  D++WA+ L++N+T      S +  +  + + +   +Q+   M +  F G++G V F+ +G RM+   I Q Q  S+ K G YD +   L+ +    + GG PP D  L++     + + ++ +  V + + I +++ C+  NI   H + I+ S  NLNNL   G  ++  ++ P+G     I G ++  +VC AR+WLL L F   +GS+F+K W +H +F+K +  K  +  ++   L+  + L+V +DI+ L IW++ D L    +    EE    I  +I      C ++    ++ I +  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L +SQ + AF   + AI+  S+ TL ++FVPK  ++   G
Sbjct:  171 IGALFPMS----GGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLY-----NDP---------------IKIILMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVKLFEKWGWKKIATIQQTTEVFTSTLDDLEERVKEAGIEITFRQSFFSDPAVPVKNLKRQDARIIVGLFYETEARKVF-CEVYKERLFGKKYVWFLIGWYADNWFKTYDPSINCTVEEMTEAVEGHITTEIVMLNPANTRSISN--MTSQEFVEKLTKRLKRHPEETGGFQEAPLAYDAIWALALALNKTSGGGGRSGVRLEDFNYNNQTITDQIYRAMNSSSFEGVSGHVVFDASGSRMAWTLIEQLQGGSYKKIGYYDSTKDDLSWSKTDKWIGGSPPADQTLVIKTFRFLSQKLFISVSVLSSLGIVLAVVCLSFNIYNSHVRYIQNSQPNLNNLTAVGCSLALAAVFPLGLDGYHI-GRSQFPFVCQARLWLLGLGFSLGYGSMFTKIWWVHTVFTKKEEKKEWRKTLEPWKLYATVGLLVGMDILTLAIWQIVDPLHRTIETFAKEEPKEDIDVSILPQLEHCSSKKMNTWLGIFYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDAAFAFASLAIVFSSYITLVVLFVPKMRRLITRG 863          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. TrEMBL
Match: R7V2Y7 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_198653 PE=3 SV=1)

HSP 1 Score: 278.485 bits (711), Expect = 3.695e-78
Identity = 197/650 (30.31%), Postives = 337/650 (51.85%), Query Frame = 2
Query:  560 NSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM--SNVLLITN-------STNCTLDNQIAARQAAIYFLSEIYNQTIP------QDFIGKKLFIDYIQNNMLKNFSEFSTENLL--LMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPE--FEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM--NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIG-YSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEE----VSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGVDVG 2431
             +++  P   +++GP     AE+ A++   Y +PQ+ Y+  S  LSNK  Y    + + S  + N AM+++L    W+ +A L  DT    + S+  +Q+L+  + +  S   +  + + Q++ IK   ++I++ F      +    C  Y  G+YG  YQW+  S    I N          CT    + A +  IYF     +QT          +   +L   Y++    KN S  + + L     D++W   L++N +      S L  D  +   +    +L N   +  F G  G V+F+ENGD+++ V +YQ +N + +    Y      L +  N  F F GG PP DS  I+    GI +  +    + + I +   + CI  N+ +R+ ++I++SS  +N L+  G  +++ S++  G +S  D    + S W+C  R  LL+ +F   FG +F+KTWR+H++F+ + + +K ++KD HLF +I+ ++++D +LL +W L D  +W T VN  E     V G I  +    C + +++Y+  +L S K +LL+ G+ F WETRKV IE LNDSKQ+G+ IY V++++TV  PL  +L   QV+ ++ V + A+++C+FTTL+LVF P   K+  HG  V 
Sbjct:   55 RAYMQPPTKIMMIGPKYSEQAEVLAEIAAMYGVPQLSYSVTSPLLSNKKSYPYFARTVESTALQNPAMLKVLQHFGWKKVAKLTSDTVYPAKTSELMQQILNANNFTTMSTATFANDPTSQIEQIKVSGAKIILTFASSPKNSIRPLCQAYKQGVYGARYQWLHWSARHGILNQLDQKVAGDGCTHKQMVEAAEGLIYFGPVSVSQTPDYLRAGISGYTTPELEAKYLEYLTTKNVST-ARQALYTSAFDAVWTAALAMNSSL-----SYLPLDEFTYGDQTIARRLYNATISSDFYGAGGHVAFDENGDKLNDVFVYQVRNGTGLIIAKYCILTGDLILMPNQRFMFAGGKPPVDSDEIVDSFIGISRPFFVVITMISCIGVIYGVLCIAFNLVYRNNRLIKLSSPRINTLIGVGCCLAFTSVVCYGVHSVED----SHSDWICGGRTCLLVYAFTFAFGGMFTKTWRVHVLFTNTMISRK-IVKDAHLFAVIAGLLVVDTLLLIVWFLVDFPRW-TIVNVGETRDDNVPGIINRSFVYICSSAHAVYWSGVLCSYKALLLMFGIFFTWETRKVTIEALNDSKQIGLCIYNVMVLSTVTFPLVNLLSVDQVSISYGVFSVAVLLCTFTTLNLVFAP---KVATHGKRVA 689          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. TrEMBL
Match: C3Y433 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_84865 PE=4 SV=1)

HSP 1 Score: 271.552 bits (693), Expect = 2.273e-73
Identity = 197/667 (29.54%), Postives = 355/667 (53.22%), Query Frame = 2
Query:  551 QIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKS---RIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITN--------STNCTLDNQIAARQAAI-----YFLSE----IYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCG---SYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSG-----YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGVDVGQTIENFTSKQS 2464
             +I    + P + ++LGPG     ++ A+    + + Q+ ++  S  LS++  Y  LFK + ++ V N A I +L    W  +AT++   +    ++ +  +LL   +I+++S+  + ++++ QL  ++ LK+   RIVI  +  + +     C  YNNGMYG  Y W+ N  L  N        + +CT +      + +I     +F  E    I   + P D+   +  +DY +       ++ +    L  D+++A  L++N +     +    +D+         +    M    F G++G V F++ GDR+ R+ I Q Q+   ++ G   +Y+  + +       W  GG PP D +  +++   +   + YT +  AG+ +   L  +  N KFR  ++I+MSS  LNN +  G + +YL+II  G +  ++   N++ ++C ARVW++++ F   FGS+FSKTWR++ +F  +K+ KK VIKD HLF ++   +L+D+V L +WE+ D +    +    EE        Y+ E     C +   +Y++ I+++ KGIL+L G+  AWETRKV I  LNDSKQ+G+ +Y V++M+ V +P+  +LD+ Q++ +F VL+  II+C+ TTL+LVFVPK  +  +HG ++ ++ +  T K S
Sbjct:  148 HLIMKLFHEPTMIMILGPGGAV-VDLIAETAPIFNLIQLTFSTYSPALSDRQTYPFLFKTIQTDNVHNPARIALLQHFGWDKVATIQDTDDRFTTIASNLNELLGEANITVQSSGGFGKDVTSQLSQLENLKAVDARIVIALMAPH-QCRKLLCWAYNNGMYGSRYLWIFNGALRENWWKPRKSDTLDCTAEEIDQVMEYSISTEPSFFADEGEQGIAGYSSPNDYW--EAHVDYARLKYGAPEAKSTVYVPLAFDAVYAAALALNASAAELPAGRGLEDWSYEDSSMRSVFFRNMEKTNFLGVSGPVRFDKTGDRLGRIIIKQIQDGKAVEVGKFHAYEKKIIWSDTTPPKW-KGGQPPVDEVRKITREIRVSDGLLYTMVSLAGLGMIFCLLFLAFNFKFREKRVIKMSSPRLNNALILGCIFAYLAIILFGLT-ENVAESNQAFYMCKARVWIMVVGFTLAFGSMFSKTWRVYALFRHTKVEKK-VIKDFHLFAMVGSFLLMDVVFLMLWEVLDPITMQREKFPEEEDPNRNDVLYLPE--LRRCTSDYLMYWLGIIYASKGILILFGIFLAWETRKVQIPELNDSKQIGLCVYNVMIMSAVGVPIINLLDSQQLDISFAVLSVCIIVCTSTTLALVFVPKIWQGLRHGFEIQRSGKFLTRKGS 805          

HSP 2 Score: 110.538 bits (275), Expect = 7.072e-21
Identity = 52/120 (43.33%), Postives = 85/120 (70.83%), Query Frame = 2
Query: 2105 CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGVDVGQTIENFTSKQS 2464
            C +   +Y++ I+++ KGIL+L G+  AWETRKV I  LNDSKQ+G+ +Y V++M+ V +P+  +LD+ Q++ +F VL+  II+C+ TTL+LVFVPK  +  +HG ++ ++ +  T K S
Sbjct:  884 CTSDYLMYWLGIIYASKGILILFGIFLAWETRKVQIPELNDSKQIGLCVYNVMIMSAVGVPIINLLDSQQLDISFAVLSVCIIVCTSTTLALVFVPKIWQGLRHGFEIQRSGKFLTRKGS 1003          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. TrEMBL
Match: A0A267DHX9 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010243g1 PE=3 SV=1)

HSP 1 Score: 256.914 bits (655), Expect = 2.918e-70
Identity = 191/713 (26.79%), Postives = 344/713 (48.25%), Query Frame = 2
Query:  398 NILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQF-------------------LRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLIT-----NSTNCTLDNQI-AARQAAIYFLSE---IYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENL-LLMDSLWAIFLSINQT-RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWL----LMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTD-----NLKWCTQVNNSEEVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            ++  L ++ E   +    L   N    A+ E + F++ Y   N  +  F                   +R+  + ++  P   ++ GP     A + A++   Y +P+I  +  S  LSNK +Y    ++  S  +  + ++QIL   NW  +  L  D + +Y  S    ++LS Y+I+L +  VY  + S  L  +K    RI +      ++T  FEC I   GM GP Y W+   +  T         C   +Q+ A  + ++YF ++   I N+T       ++L+ D++Q+N   +    S  +L + +D++    L++N+T R    S+ L+ D    SP  +QL + +R + F G TG V  + NGDR++   +YQ +N   +    ++     +  +    F G  PP+D   ++     + ++     L    I ++I+L+ ++ N  +RH ++I+MSS N+NNL+  G ++SY S          ++ +  S     A  WL    L   +   +G++ +KTWR+H+IF+   M + + IKD  L  +   +V+LD++L  +W L D     N+K+   V + ++  G +  N+   C +     ++      KG LL  G+ FAWETR VHIE LNDSK++G+ +Y  ++M  + + + ++L  S++N  F ++   II+C  T + +VF  K L + QHG
Sbjct:   12 SVWLLSTAAERPVVHTLVLCSENSTRSADPEYYKFALDYLNNNLTELNFSFKLKAEYKCGLGALQGSAVRKFADGYLTPPNKALMFGPAFSNQAVVLANVAQYYFLPEISASTPSPALSNKDKYFYFSRVSMSHSLFLDGVVQILKRYNWSIVGLLTSDYDGVYATSVHLEKMLSLYNITLAARGVYSTDPSAALRRMKDRDVRIFLVVRAARVETVKFECLIEQFGMVGPKYFWIQLGMTQTFDPPKEPGQCDSPDQLKAGAENSVYFKADLVVIGNETGMGSAASRELYRDFLQSNSHLDTDTVSISDLGVRIDAVLTAALALNRTLRKYAYSTELDLD---ESPFKDQLLSEIRAVDFEGFTGRVKLDGNGDRLANAVVYQIRNFEPVAVAFFNTYDNIIDWSEELQFSGEGPPEDKPKVVKNQQVVSRTNAIVMLCLCSICVAITLSFMVANFHYRHIRMIKMSSPNINNLIGIGCILSYASCT--------VSAVGSSWLQDTAACWLQSVSLCFGYSIAYGAMLAKTWRVHVIFATRNMRRVS-IKDHQLAAVPLALVVLDVILFTVWALVDPMELINVKYAV-VESIQK--GSVEVNMAQTCHSNFLTIWLVTFVGYKGFLLAFGIFFAWETRAVHIESLNDSKKIGICVYNTMVMGALGVVMAFVLPASELNLRFLLINGCIIVCCTTAVVIVFGSKILLLVQHG 709          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. TrEMBL
Match: V3YZP5 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_133032 PE=4 SV=1)

HSP 1 Score: 245.743 bits (626), Expect = 2.077e-66
Identity = 190/710 (26.76%), Postives = 355/710 (50.00%), Query Frame = 2
Query:  353 LFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGP-----LYQWMSNVLLITNSTN--CTLDNQIAARQAAIYFLSEIY---------NQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTE-NLLLMDSLWAIFLSINQT--RILFNSSLLN-QDYLSTSPEFEQ-LANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSL------KYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSE--EVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPK 2395
            + G FP D ++         Y     A+IA   ++  N+ H   L  +  ++ Y     +  Q ++ + ++  + P   +++G G    +E +A   + + + Q+ Y   S  LS+K R+   F+    + V+N A I I     W  ++T+         V+++  +L+   ++++  + ++ ++   Q+  +    +RI++     + K     C  Y  G+YG      L  W  +    T   N  CT++   AA +  I  +  IY         +   P++F         I NN   N + F  + + L  D++WAI L +N+T   +  N +  N  D+  T  EF   L   M+ + F G+ G + F+EN D +S + I + Q       G Y+P+L      ++L    + W  GG+PPKDS ++  +   +  SIY  F   +GI + +++  ++ NI +R+A++++MSS  LNNL+  G ++ Y+++    Y+ ++    N S  +C A+++L+ + F   FG+LF+KTWR+H+IF+ +   KK ++KD+ L  ++  +  +++V+L +W +   +   T     E  EV  Y     Y  C + N +Y+   LF I+GIL+L+G   AWETRKV IE LNDSK +G+ IY V++++ + + + + L ++ +N  + + +A +++ +  T  L+FVPK
Sbjct:   22 ILGLFPFDGIAWRGG-----YGMLTSAEIA---IEHVNK-HDYILPGYRLNLIYNNTMCDPGQGIKVMYDNLYSPPTKLLIIGAGCSPVSEATAQASHLWNLVQMSYVSLSPSLSDKLRFPFFFRTTAPDVVVNPARIDIFKQFGWSQVSTIHQSFELFSTVTENLNELMKEANLTIVRSEIFTQDPEVQVKNLMENDARIIVGGFYAD-KARKIFCEAYKEGLYGSKVVWILVGWYDDDWWKTPDPNVDCTVEELSAAVEGYIA-IDHIYLNPKNTPSISGVTPEEF-------QTIFNNRTNNENIFGKKLSPLAYDTIWAIALGLNETIEDLARNDTQKNLTDFTYTDSEFGHILLENMKKVNFQGIKGPIYFDENHDAVSLLRIVRIQGGVKETIGIYNPTLTTDVKIEWLPETPVVW-AGGLPPKDSTIVYYETVVLSFSIYVAFCCISGIGMVLAIVFLMFNIMYRNARVVKMSSPRLNNLILIGCILIYITVFL--YNTTE----NHSSLICQAKIFLMTVGFSLAFGALFAKTWRVHVIFTNATKQKK-IVKDIQLVFMVLGLTSINLVVLIVWAILHPIIVVTNDLPKEVNEVDDYEIRKDYSACTSENEIYYTGTLFGIQGILMLLGAFLAWETRKVKIEALNDSKLIGVCIYNVVVLSILGVTVSFALGDN-INLRYSLDSAVVLLATTVTECLIFVPK 704          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. TrEMBL
Match: A0A1S3M5K6 (gamma-aminobutyric acid type B receptor subunit 2-like isoform X2 OS=Salmo salar OX=8030 GN=LOC106570447 PE=3 SV=1)

HSP 1 Score: 241.121 bits (614), Expect = 6.697e-64
Identity = 185/655 (28.24%), Postives = 307/655 (46.87%), Query Frame = 2
Query:  491 KFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK--KLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSL---LNQDYLSTSPEFEQLA-NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            KFS   +      ++ + LR   ++    P+  ++ G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A+++ L   NW  + TL  D     EV       L    I +     +  +    +  +K    RI+I     NL +  F C  YN  MYG  YQW+       N     NSTNCT    + A +  I    E  +    +   G+  K +       + +   E S  +    D +W I  ++ +   L        ++ ++     E  +L  + M    F G+TG V F  NG+RM  +   QFQ    +K G Y+     L + N+   F G  PPKD   +  +   I+  +Y    V   + + ++   +  NIK R+ ++I+MSS  +NNL+  G ++SY SI   G   + ++   E + +C  R W+L++ +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W++ D LK   +  + E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPKF+ +
Sbjct:   93 KFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADKKKYPNFFRTVPSDNAVNPAVVKFLNFYNWSRVGTLTQDVQRFSEVRNDLTNELEKADIQIADTESFSNDPCVNVKKLKDNDVRIIIGQFDENLASKVF-CCAYNLNMYGSKYQWIIPGWYQGNWWEQANSTNCTTRKLLTAMEGYIAVDFEPLSAKQIKGISGRTPKEYEREYSKELQQKGVEPSKYHGFAYDGIWVIAKTLTRVMDLLQHKERQDMHHNFTVDDREVGKLVLDVMNETNFYGVTGQVMF-RNGERMGTIKFTQFQEGQEVKVGEYNAIADVLDLINNTMRFQGVEPPKDRTFVRLQRRNINVPLYSILSVITILGMLMAGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYSSIFLFGLDGALVSD-KEFEALCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLIIVGGMLLIDLCILICWQIVDPLKRTVEEYSLEADPQGQDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKFITM 742          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Cavefish
Match: gabbr2 (gamma-aminobutyric acid (GABA) B receptor, 2 [Source:ZFIN;Acc:ZDB-GENE-060503-620])

HSP 1 Score: 238.424 bits (607), Expect = 3.771e-66
Identity = 183/650 (28.15%), Postives = 305/650 (46.92%), Query Frame = 2
Query:  515 QQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK---KLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLA----NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYL-TMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            Q    ++ + LR   ++    P+  ++ G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A+++ L   NW  + TL  D     EV       L    I +     +  +    +  +K    RI+I     NL +  F C  YN  MYG  YQW+       N     NSTNCT    + A +  I    E  +    Q   G+   +  ++Y +    K   E S  +    D +W I  ++++   L         Y + + +  ++     + M    F G+TG V F  NG+RM  +   QFQ    +K G Y+     L  +N+   F G  PPKD   +  ++  I+  +Y        + + ++   +  NIK R+ ++I+MSS  +NNL+  G ++SY SI   G    D   ++E   + +C  R W+L++ +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W++ D LK   +  + E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:   49 QHTFCDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADKKKYPNFFRTVPSDNAVNPAVVKFLNHYNWSRVGTLTQDVQRFSEVRNDLTSELEKADIQIADTESFSNDPCGNVQKLKDNDVRIIIGQFDENLASKVF-CCAYNKNMYGSKYQWIIPGWYQGNWWEQANSTNCTTKKLLTAMEGYISVDFEPLSAKRTQGISGRTPQEYELEYTREREQKGV-EASKFHGFAYDGIWVIARTLSRVMELLKQKQRQDVYHNQTVDDREVGKMVLDVMNETNFFGVTGQVMF-RNGERMGTIKFTQFQEGQEVKVGEYNAIADILDVINNTIRFQGVEPPKDRTFVRLQLRHINVPLYSILSTITILGMLMAGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGTFVSEKVFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLIIVGGMLLIDLCILICWQIVDPLKRTVEEYSLEADPQGQDIAIRPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITM 690          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Cavefish
Match: gabbr1a (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103038203])

HSP 1 Score: 185.652 bits (470), Expect = 1.824e-48
Identity = 165/661 (24.96%), Postives = 311/661 (47.05%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLL--SNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG-----KKLFIDYIQNNML-KNFSEFS--TENLLLMDSLWAIFLSINQT--------RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSG---YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +    Y  +S  LSN+ R+   F+  PS  + N   +++    NW  IAT++  T           Q +  +   IS++ +F+    ++  +  +K   +RI++           F C +Y   ++G  Y W        N   I + + NCT++    A +  +     + N   P+   G      + FI  + + +  KN  E     E  L  D++WA+ L++N+T        R L + +  N+D  +      ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD S   L+      + G  PP D  +++ +   + + ++ +  VFAG+ I + + C+  NI   + + I+ S   LNN+   G V++  ++ P+G    D + ++ S++  VC  R+WLL L F   +GS+F+K W +H +F+K    K+    +    L+  +  ++ +D++ L IW++ D L    +    E        + + +   C ++    ++ ++F  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AI+   + TL ++FVPK  ++   G
Sbjct:   44 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWNWSKIATIQQTTEVFTSTLDDLEQRVKEAQIEISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLFGKKYVWFLIGWYADNWFKIKDPAINCTVEQMTEAVEGHVTTEIVMLN---PETVRGASNLTSQEFIAQLMSRLGGKNPEETGGFQEAPLAYDAVWALALALNKTVAPLRAKGRRLEDFNYNNKDITA------EIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSSKGNLSWYGNDKWIGAGPPADQTMVIDQYRYLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNITAVGCVLALAAVFPLGI---DGHHVHRSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLDPWKLYATVGGLLAIDVLSLMIWQIIDPLHVTVEQFTKEAPKADLDVLIQPLLEHCSSKKINTWLGVVFGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRG 688          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Cavefish
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103033827])

HSP 1 Score: 185.652 bits (470), Expect = 2.270e-48
Identity = 166/667 (24.89%), Postives = 307/667 (46.03%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK-----KLFIDYIQNNMLKNFSEFST----ENLLLMDSLWAIFLSINQT--------RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSG---YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T           Q +    I +     +  + +  +  +K   +RI++           F C +Y   +YG  + W        N   I + S NCT++    A +  +     + N   P+   G      + F+  + N  L   S   T    E  L  D++WA+ L++N+T        R L + +  N+D  +      ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD     +T  +L W+      G  PP D  +++ +   + + ++ +  VFAG+ I + + C+  NI   + + I+ S   LNN+   G +M+  ++ P+G     ++G++  K     VC  R+WLL L F   +GS+F+K W +H +F+K    K     ++   L+  + +++++D++ L IW++ D L    +    E   G    + E +   C +     ++ +++  KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  +L + Q + +F   + AI+   + TL ++FVPK  ++   G
Sbjct:   87 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWGWTKIATIQQTTEVFTSTLDDLEQRVKEAGIEISVRQSFLTDPAVAVKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLYGKKHVWFLIGWYADNWFKIKDPSINCTVEQMTEAVEGHVTTEIVMLN---PETVRGASNLTSQEFLAQL-NVTLGGKSPEETGGFQEAPLAYDAVWALALALNKTVGPLKAKGRRLEDFNYNNKDITA------EIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYD-----MTKGNLSWYGNDKWIGAGPPADQTMVILEYRFLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNMTAVGCMMALAAVFPLG-----LDGLHVHKSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKDKRKHLEPWKLYATVGVLLVIDVLSLMIWQIVDPLHITVEKFTREAPKGDQDVLIEPLLEHCSSEKMNTWLGVVYGYKGLLLLLGIFLAYETKSVSTEKINDHRAVGMAIYNVSVLCMITAPVTMILSSKQ-DASFAFASLAIVFSVYITLVVLFVPKMRRLITRG 731          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Cavefish
Match: gabbr1a (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103038203])

HSP 1 Score: 183.726 bits (465), Expect = 8.189e-48
Identity = 166/656 (25.30%), Postives = 305/656 (46.49%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK-----KLFIDYIQNNML-KNFSEFS--TENLLLMDSLWAIFLSINQT--------RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +    Y  +S  LSN+ R+   F+  PS  + N   +++    NW  IAT++  T           Q +    I +     +  + +  +  +K   +RI++           F C +Y   ++G  Y W        N   I + + NCT++    A +  +     + N   P+   G      + FI  + + +  KN  E     E  L  D++WA+ L++N+T        R L + +  N+D  +      ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD S   L+      + G  PP D  +++ +   + + ++ +  VFAG+ I + + C+  NI   + + I+ S   LNN+   G V++  ++ P+G    D + ++ S++  VC  R+WLL L F   +GS+F+K W +H +F+K    K+    +    L+  +  ++ +D++ L IW++ D L    +V+       +IT+     C     L    ++F  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AI+   + TL ++FVPK  ++   G
Sbjct:   99 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWNWSKIATIQQTTEVFTSTLDDLEQRVKEAQIEISVRQSFLTDPAVAVKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLFGKKYVWFLIGWYADNWFKIKDPAINCTVEQMTEAVEGHVTTEIVMLN---PETVRGASNLTSQEFIAQLMSRLGGKNPEETGGFQEAPLAYDAVWALALALNKTVAPLRAKGRRLEDFNYNNKDITA------EIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSSKGNLSWYGNDKWIGAGPPADQTMVIDQYRYLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNITAVGCVLALAAVFPLGI---DGHHVHRSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLDPWKLYATVGGLLAIDVLSLMIWQIIDPLHVTVEVS-------FITK--LKSCLITKLLRKCGVVFGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRG 731          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Cavefish
Match: gabbr1a (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:103038203])

HSP 1 Score: 184.496 bits (467), Expect = 9.338e-48
Identity = 165/661 (24.96%), Postives = 311/661 (47.05%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLL--SNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK-----KLFIDYIQNNML-KNFSEFS--TENLLLMDSLWAIFLSINQT--------RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSG---YITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            DP    +++   +    I +VL PG    + + A+    + +    Y  +S  LSN+ R+   F+  PS  + N   +++    NW  IAT++  T           Q +  +   IS++ +F+    ++  +  +K   +RI++           F C +Y   ++G  Y W        N   I + + NCT++    A +  +     + N   P+   G      + FI  + + +  KN  E     E  L  D++WA+ L++N+T        R L + +  N+D  +      ++   + T  F G++G V F+  G RM+   I Q Q  S+ K G YD S   L+      + G  PP D  +++ +   + + ++ +  VFAG+ I + + C+  NI   + + I+ S   LNN+   G V++  ++ P+G    D + ++ S++  VC  R+WLL L F   +GS+F+K W +H +F+K    K+    +    L+  +  ++ +D++ L IW++ D L    +    E        + + +   C ++    ++ ++F  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AI+   + TL ++FVPK  ++   G
Sbjct:  218 DPGEATKLLYDLLYTEPIKIVLMPGCSSVSTLVAEAARMWNLIVFSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVRLFQKWNWSKIATIQQTTEVFTSTLDDLEQRVKEAQIEISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLFGKKYVWFLIGWYADNWFKIKDPAINCTVEQMTEAVEGHVTTEIVMLN---PETVRGASNLTSQEFIAQLMSRLGGKNPEETGGFQEAPLAYDAVWALALALNKTVAPLRAKGRRLEDFNYNNKDITA------EIYRALNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDSSKGNLSWYGNDKWIGAGPPADQTMVIDQYRYLSQKLFVSVSVFAGLGILLGIVCLTFNIYNSNVRYIQNSQPYLNNITAVGCVLALAAVFPLGI---DGHHVHRSQFPVVCQFRLWLLGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLDPWKLYATVGGLLAIDVLSLMIWQIIDPLHVTVEQFTKEAPKADLDVLIQPLLEHCSSKKINTWLGVVFGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFASLAIVFSVYITLVVLFVPKMRRLITRG 862          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007580.1 (pep scaffold:Pmarinus_7.0:GL479777:49246:63453:-1 gene:ENSPMAG00000006844.1 transcript:ENSPMAT00000007580.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 166.777 bits (421), Expect = 3.114e-44
Identity = 127/426 (29.81%), Postives = 229/426 (53.76%), Query Frame = 2
Query: 1184 FIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQT-RILFNSSLLNQDY-LSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESK--WVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV------IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENI--YVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG 2419
            FI  +  N+ K   E     E  L  D++WA+ L++N+T + L    +  +D+  S +    ++   + +  F G++G V F+ +G RM+   I Q Q+  ++K G YD +   L+  +   + GG PP D   ++ +   + + ++ +  V AGI I     C++ NI  R+ + I+ S  NLNNL   G +++   ++P+G    D   I+ES+  ++C  RVWLL + F   +GS+F+K W +H +F+K K  KK +      ++   L++  ++++ +D V + IW+L D L+   +    E + G   E +     C +R    ++ I+++ KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  M+ + Q + +F   A A+I  S+ TL ++FVPK  ++   G
Sbjct:   69 FISRLVKNLTKTPEETGGFQEAPLAYDAIWALALALNKTAQELAKKGMRLEDFNYSDNTITNEIYKALNSSSFDGVSGHVVFDASGARMAWTLIEQLQDGKYVKIGYYDSNNNNLSWLNTDRWIGGSPPPDRTKVVIQFRYLSQKLFISLSVLAGIGIIFGCVCLVFNIYNRNVRYIQNSQPNLNNLTALGCILTLAVVLPLGL---DGLHISESQFPFICQVRVWLLSIGFGMGYGSMFTKIWWVHTLFTK-KDDKKEMRQLNPQLEQWKLYVTAAVLIFIDAVTILIWQLVDPLQRTVEGFGKENLVGDDVEILPQLEHCSSRKMTTWLGIVYTYKGLLLLLGIFLAYETKSVSTEKINDHRSVGMAIYNVSVLCMITAPVA-MIVSKQQDASFAFAALAVIFSSYITLIVLFVPKMRRLITRG 489          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007583.1 (pep scaffold:Pmarinus_7.0:GL479777:50633:55489:-1 gene:ENSPMAG00000006844.1 transcript:ENSPMAT00000007583.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 133.65 bits (335), Expect = 4.456e-35
Identity = 93/291 (31.96%), Postives = 166/291 (57.04%), Query Frame = 2
Query: 1544 GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF-----CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPK 2395
            GG PP D   ++ +   + + ++ +  V AGI I     C++ NI  R+ + I+ S  NLNNL   G +++   ++P+G    D   I+ES++  +C  RVWLL + F   +GS+F+K W +H +F+K K  KK  ++   L++  ++++ +D V + IW+L D L+       + EV   + +++ +      C +R    ++ I+++ KG+LLL+G+  A+ET+ V  E +ND + VGMAIY V ++  +  P+  M+ + Q + +F   A A+I  S+ TL ++FVPK
Sbjct:    1 GGSPPPDRTKVVIQFRYLSQKLFISLSVLAGIGIIFGCVCLVFNIYNRNVRYIQNSQPNLNNLTALGCILTLAVVLPLGL---DGLHISESQFPFICQVRVWLLSIGFGMGYGSMFTKIWWVHTLFTK-KDDKKEQLEQWKLYVTAAVLIFIDAVTILIWQLVDPLQ------RTVEVENLVGDDVEILPQLEHCSSRKMTTWLGIVYTYKGLLLLLGIFLAYETKSVSTEKINDHRSVGMAIYNVSVLCMITAPVA-MIVSKQQDASFAFAALAVIFSSYITLIVLFVPK 280          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Sea Lamprey
Match: GABBR2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:HGNC Symbol;Acc:HGNC:4507])

HSP 1 Score: 120.939 bits (302), Expect = 1.307e-29
Identity = 100/388 (25.77%), Postives = 171/388 (44.07%), Query Frame = 2
Query:  662 QIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM-----SNVLLITNSTNCTLDNQIAARQAAIYF----LSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILF--NSSLLN--QDYLSTSPEFEQ-LANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIG 1780
            Q+ +   +  LS+K +Y   F+ +PS+  +N A+++ L    W+ + TL  D     EV     + L    I +     +  +    +  +KT   RI++      +    F C  YN GMYG  YQW+      +         C   N + A +  IY     LS    +TI      ++   +Y     +   +  S  +    D +W I   +N+T  L   + SL+   + +  T+    Q L + +    F G+TG V F  NG+R+  +   QFQ+   +K G Y+     L + NS   F G  PP D  ++ SK+  +   +Y    V   + + ++   +  NIK R+ K+I+MSS  +NNL+  G ++SY++I   G
Sbjct:    1 QLSFAATTPVLSDKKKYPNFFRTVPSDNAVNPAIVRFLQHYKWQRVGTLAQDVQRFSEVHNDLTKELDKAGIQIAETQSFSNDPCVNVQNLKTSDVRIILGQFDEEMAAKVF-CCAYNEGMYGSKYQWVIPGWYGSRWWEHTQQQCPQKNLLIAMENCIYVDFMPLSTRPVRTI-SGLTPQQYEEEYYHMLGVSEVAPHSKFHGYAYDGIWVIAQVLNRTIELLEADKSLIASIESFSYTNQRIGQILLDALNETNFLGVTGQVLF-RNGERLGTIEFMQFQSTERVKVGEYNAVPDTLELINSTMRFQGPDPPWDRTIVQSKLREVYLPLYSILSVLTCLGMFMASAFLFFNIKNRNQKLIKMSSPYMNNLIILGGMLSYMTIFLFG 385          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004054.1 (pep scaffold:Pmarinus_7.0:GL487958:4015:7652:1 gene:ENSPMAG00000003710.1 transcript:ENSPMAT00000004054.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 1.278e-11
Identity = 35/90 (38.89%), Postives = 53/90 (58.89%), Query Frame = 2
Query: 2138 ILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            I+++ KG+L++ G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  +  +A   I  S  TL LVF+PK + +
Sbjct:   30 IVYAYKGLLMVFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQYCTVALVTIFSSTITLCLVFMPKLIAM 118          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002289.1 (pep scaffold:Pmarinus_7.0:GL476972:10669:15547:1 gene:ENSPMAG00000002086.1 transcript:ENSPMAT00000002289.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.3066 bits (142), Expect = 5.245e-11
Identity = 30/112 (26.79%), Postives = 56/112 (50.00%), Query Frame = 2
Query: 1544 GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGS 1879
            GG PP D   ++ +   + + +Y +  V A + I + L C+  N+  R  + ++ S   LNN+   G V++  ++ P+G     I+ +    +VC  RVWL+ + F   + S
Sbjct:    2 GGSPPPDRTKVVEQFRYLSQGLYISVCVLATVGIILGLLCLSFNVYNRQIRYVQNSKPGLNNMTVVGCVLALSAVFPLGLDGLHIS-MATFPFVCQLRVWLISMGFSLAYSS 112          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Nematostella
Match: EDO47111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB3])

HSP 1 Score: 229.18 bits (583), Expect = 1.474e-64
Identity = 172/621 (27.70%), Postives = 303/621 (48.79%), Query Frame = 2
Query:  593 VLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM--------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEF---STENLLL---MDSLWAIFLSINQT--RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMN-SLFWFPGGVPPKDSIL-ILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYI-TENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFT-TLSLVFVPK 2395
            +LGP      ++ A++  ++ + Q+ Y   +S LSNK +Y  L++ +  +   N A + +L    WR + TL  D      V     Q L +++IS+ S   + +   + L+ IK   +RI+I     +     F C  Y  GMYG  Y W+           L   +  +CT D   +A     YF  +  N     +   K           LK FS +    T NL +    DS+W I L++N T  ++   +  L+Q           L  +  ++ F G+TGM+ F++ G+R   V I Q Q    +  G YDP+   +  N +L  + G  PP D ++  LS++  +  S+ +  +V   I I ++   +  N+++R+   I++SS NLNN++  G ++ Y+SII +      ++  + +  +C A  +LL + +    G++FSKTWR+H IF+K K  KK V +D  L  ++ L++ +D+V+  +W   D L +  Q +      G +     Y  C +++S  ++ I+   KG++LL+G   +WETRKV +  LNDS+ VGM++Y +++   +  PL  ++   +   +F  L +  +    + +L L+FVPK
Sbjct:   78 LLGPACSAVTKVVAEVAWHWSLLQVSYASTASDLSNKEKYPLLYRTVQPDSAFNSARVSVLEFYGWRRVGTLRQDDFVFSSVMSELHQSLEDHNISVVSPETFSKEPRRHLEAIKDQDARIIIGMFYEDAARRVF-CEAYKLGMYGSQYVWILLDWADNHQWWLTPDDDVDCTADQMASAVTG--YFSIDSVN----LERTDKPGISGLTSKEFLKEFSRYHPNGTANLYVPYAFDSMWMIALALNNTAGQLHRQNKSLDQFCYGDHEMARLLQRSTESLVFRGVTGMIEFSKKGERKQPVWINQLQEWRPVHVGLYDPANNKIMQNTTLPIWQGDGPPSDGLVHYLSRVEHVTMSLLWVTIVLGMIGILLASGFLCFNVRYRNHSYIKLSSPNLNNVIIVGAILIYMSIILVAMDGRTVSPASLTH-ICTATSYLLGIGYSLAVGAMFSKTWRVHQIFNKVK-PKKKVFQDSELIGLVVLMIAVDLVVFSLWAGVDPLTYRLQQSGEAIREGDVMVTPFYESCHSKHSTTWLYIIMGYKGLILLVGCFISWETRKVKVRALNDSRFVGMSVYNIVLAVVIGGPLTLLIGGDR--DSFVALYSFFVFFPTSISLCLLFVPK 687          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Nematostella
Match: EDO47553 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM77])

HSP 1 Score: 202.601 bits (514), Expect = 1.707e-55
Identity = 172/666 (25.83%), Postives = 315/666 (47.30%), Query Frame = 2
Query:  359 GGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG------KKLFIDYIQN--NMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEF------EQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHA-----RVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKK-NVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGY----ITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIM 2266
            GGF +   +   +N   +Y + E A      LQ  N+  ++ L+     +  +    +D   ++ ++        + +++GPG   +AE  A     + + Q+ Y   + +LS+KT +   +++   E V N A++ +L    W  +A ++ D     +VS+  + LL   +ISL     +  N    +  +K   +RI+I  L    K     CS + +G YG    W+       +   +     C+     +A    I F   I + +  +   G       KL++   +N    + +++ +        D++W + L++N+T  L   S L     +   ++      E  A T    RF G++G V+F +NGDR+S + I QFQ+   I+ G +D +     ++ +     G PP    + +++I  I+  ++ T    A   I +S   +ILNIK R    IRMSS  LNN +  G +M Y  +I  G        ++ES  V H+     R+WLL   +   FG++F KTWR++ IF+  K+ K+   + D HL  +++L++ +D++ L +W+  D LK  T++ N +  +G     I   +++ C   + L ++  L++ KG+L++ GL  AWETR V    LNDS+ +G+++Y V++
Sbjct:   12 GGFIDLNTTNGGWNSGGVYPAIELA------LQHINQ-DQSLLQGIKLELVIKDSRCSDAYAIKTLVEHITADHTVVMLIGPGCSIAAEPIAIAGKFWNLVQVAYAAGTPRLSDKTLFPLFYRVNAPETVANLAIVAMLKKFKWSRVAIVKEDVAVFNDVSEGLQLLLRRENISLIGANSFITNPDNVITDLKQKDARIII-VLTYEGKCRKLMCSAFRHGFYGKHIVWLLRGWYVEDWSKVVTDVTCSPQEVQSAHGNYIAFEEVILSTSTEKTINGLTPDQLNKLYLRQARNISYPINSYAAYG------YDAMWVVALALNRTNTLLKESGLTLHNFTYDNKYIASIINESTAKT----RFFGMSGEVAFLDNGDRISSMWIEQFQDDGEIRVGVFDATHGDTGVDRI----NGSPPPSEPVTITEIVLIEMPLFVTMATIACAGIFLSTLFLILNIKNRQRTFIRMSSPYLNNFIIAGSIMCYTCVILFGVDVF----LDESDHVIHSAICSFRLWLLSCGYTLAFGTMFIKTWRVYKIFTNHKLDKQLGRLHDRHLVCMLALMLSVDLLFLSVWQAVDGLK--TEIRNVQTENGRNKITILMPVFLACTCTHKLIWLGCLYTYKGLLMIFGLFLAWETRNVSYPALNDSRYIGLSVYNVVI 649          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Nematostella
Match: EDO49051 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHX2])

HSP 1 Score: 199.134 bits (505), Expect = 7.775e-54
Identity = 166/666 (24.92%), Postives = 331/666 (49.70%), Query Frame = 2
Query:  485 LEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIH---VVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSK-SFRQLLSNYSISLKSNF--VYKENISK----QLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM-----SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTEN---LLLMDSLWAIFLSINQT-RILFNSSLLNQDYLSTSPEFEQL-ANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNS---LFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW--VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDN-LKWCTQVNNSEEVSGYITENIYV-FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAF-YVLAAAI-IICSFTTLSLVFVPK 2395
            L+ +   ++++         +RQ+++  + +P      +++G G     E +A++ + + + QI ++  S  LS + RY  LF+   +E + N A I IL    W+ +AT+ Y    ++ ++    R++L       K+NF  +  EN++K    Q+  +K   +RI+I      +    F C  Y  GMYG  Y W+     S+       T+CT   QI         + E    T P+  I ++   +  +    +  +   T N   +   D++WA+  ++++   +L     + +D+         L  + ++ + + G++G + FN  GDR+    + Q Q    +K G+YD     L ++    L W  G +P  D +++  K+  +  S++    +F  I I ++L  +  NI +R  + IRMSS  +N++   G ++ Y + +  G    D   ++E ++  +C  ++W L + F   +G++FSKTWR+H+IF + ++ +++ I+D  L+ I+  ++ +D  LL  W++ +  ++    +   ++ +G+     Y+ +C   + + +  ++ + KG+LL++G   AWETR V I  LNDS+ +G+++Y V++   V +P+  ++ +    P F Y L A + IIC+  TL L+F+PK
Sbjct:   65 LQDYELHMEWRDTKCKRGYGIRQLVD-LLELPSDKSPIMLIGGGCSVGTEATAEVSHFWNLIQIAFSANSMYLSEQDRYPLLFRTCYTESIGNPARIAILKRYGWKNVATV-YQNEGLFTLTAIHLREMLD------KNNFTVISSENLAKDPTFQILNLKQKDARIIIGMFYSAMARKVF-CRAYKEGMYGARYLWLIPGWFSDQWWNITDTDCT-PAQIKLAAGNYIAIMESTWSTDPRLTINRQTAAELTERYFKRVDATPYTRNEYSVFGYDAVWAVAQTLDKAIPVLRAQGRMLEDFRFNDSSMSALFKSILQGLHYQGMSGEIMFNSKGDRIGSAIVKQLQGDREVKIGTYDSIHGTLILDGPSKLIWQDGAIP-VDRMVVKLKLVSVSASLFIVITLFCSIGILLALGFLAFNIHYRERRFIRMSSPRMNSITVIGCIIIYFAALLSGL---DGKYLSEDQYSTLCQVKLWTLSVGFTLAYGAMFSKTWRVHVIFLR-RIERRS-IRDHQLYGIVIALLAVDTALLAAWQVLNPFIRAIKYLPIEKDENGFEAVRPYIEYCSCDHVMEWKGVILAYKGLLLILGAFLAWETRNVTIPALNDSRNIGVSVYTVVLSCVVGLPVVLVVKDM---PDFTYGLGACVCIICTTITLCLMFIPK 711          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Nematostella
Match: EDO46609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPP5])

HSP 1 Score: 197.593 bits (501), Expect = 1.167e-52
Identity = 186/644 (28.88%), Postives = 320/644 (49.69%), Query Frame = 2
Query:  545 LRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSF--RQLL-SNYSISLKSNFVYKEN--ISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMS----NVLLI------TNSTNCTLDNQIAARQA----AIYFLSEIYNQTIPQDFIGKKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFN--SSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFN-ENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV----FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAA-AIIICSFTTLSLVFVPK 2395
            ++ + N  +  P   +++GP    +    A+   N+ + QI Y   S    N  +Y   ++++PS E  ++A +  +    W  +A +   +  ++ ++ S   ++L+ +N S+     F  KE+  +S Q++ +K + SRI+I    +N     F C  Y +G+YGP Y W+     + LLI       N  +C+ +    A Q     A   L +  N TI    +    FI  +Q    K+     T      DS+W+  +++++     N      N +  + +  F ++   +  I F G+TG V F+ E+ +R+  V I Q QN+S++  G +      L +     + GG PPKD  L + ++      +     + AGI   +S+  +  N+  R  + I+MSS  LNN +  G ++ Y S++  G     +  +    + C+AR  +L + F   FG++FSKTWR+H IF+ +K  KK  I+D+HLF I++ +V++DI  L IW   D+LK  T++   ++      + IY+     C   +  YF+ +L++ KGILLL GL  AWETR V I  LNDSK +GM++Y V+ ++ +   +   LD +    A Y + +  +IIC+  TL LVFVPK
Sbjct:  129 VKALFNFIMQPPNKVMLIGPARTDALMPVAEAAVNWNLLQISYASLSPMFGNNRKYRNTYRIVPSSESNSKAKVSFIKNFGWERVAIIHEYSAEMFSLTASILVKELVQNNISVIAVEGFQQKEDTDVSFQINKLKNMDSRIIIGEFSKNGAQKVF-CEAYKHGIYGPRYVWIVFGHLDPLLILEIQPHVNHVSCSREELKEALQGVFATAQLDLRQDDNTTISG--MTATQFIRTMQAEKKKS----ETYTSFAFDSVWSAAVTLDEASKTSNIHPDKFNYNGTAHASGFRRI---LEGINFEGVTGPVRFSGESRERVGTVMIMQLQNESWVTIGQHFTYSDSLDLFHKIEWQGGRPPKDRTLEIEELLLNPLPLIVVTWLLAGIGALLSIFFLYFNVVHRGNRSIKMSSPQLNNFIILGCLLCYASVVLFGLDGRFLT-LERYGFSCNARTTVLSIGFSLSFGAMFSKTWRVHKIFTAAKTLKKMAIRDIHLFGIVAALVIIDIWYLSIWFGFDSLK-ATKIRFDDQARKE-HDKIYIPVLYQCTCTHKTYFLAVLYAYKGILLLFGLFLAWETRNVTIPALNDSKYIGMSVYNVVTLSCIGAIVTTALDGTIHYQAPYAITSLCLIICTTATLLLVFVPK 759          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Nematostella
Match: EDO38317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SD79])

HSP 1 Score: 169.474 bits (428), Expect = 8.348e-44
Identity = 163/585 (27.86%), Postives = 261/585 (44.62%), Query Frame = 2
Query:  599 GPGTQYSAEISADLINNYK--IP-----------QIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVY--KENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNV--------LLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIG------KKLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQT--RILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM--NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXW----ELTDNLKWCTQVNNSEEVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVG 2242
            G G   +AEI+  LINN K  +P           Q+  +   S LS+   Y   F+ +PS   + +  + +    +W  IA L Y+ +   + ++  R+ L++ +I++ S   Y   ++   Q+  +K L  R+V  FL     T    C IY +G+YG  Y W+ N              S  CT      A +  I     ++     Q   G      +K++  + Q + L+     S    L  D+ W + L++N +   +  NSSL N  Y+S S   + +   +  I F G TG+V    NGDR     I+Q Q  S      ++      T+     F +  G PP D + I+ ++    +  +     FA   I +SL  +  NIKFR  + I+MSS NLNNL+  G V++Y+S++        ++G   S  +C  RV+ L + F   FG++FSK WR+H I  K ++ K+  IKD+HL  ++ +++ +DI++L  W     LT + KW  +                                  K +LLL GL   WETRKV I  LNDS+ +G
Sbjct:   43 GRGIPVAAEIAFGLINNRKDILPGYEFMLLANDTQVSASATHSDLSSSKSYPYFFRTIPSLGAMRKTFLTLARRFHWTRIAILFYNRDMQAQAARELREELTDNNITILSYGSYFDGDDADTQIKHLKALDVRVVFGFLQL---TTSVICKIYRHGLYGRKYAWVINTPDNKTTWWRRTYPSLPCTEAQIYKAAEYTISLDDMLFGMDTDQGVSGLTTEEFQKMYTLHSQYHGLRT----SLYGALAFDAAWLMALALNSSAQELGPNSSLENFHYMSESMS-DVIKRNLLKIEFVGATGVVHLKSNGDRYGNFEIFQVQGNSIKLIAKHETLSSNFTLLPGQDFVWRDGRPPLDHVTIVPQLVEFSRVGFILVCAFASCGILMSLGFLYFNIKFREKRFIKMSSPNLNNLIIVGCVLAYVSVVLFC-----VDGDKLSDLICQVRVFTLDIGFTLAFGAMFSKAWRVHKITRKLRL-KRRYIKDVHLVAMVMIMLSIDIIILVTWLQMDPLTRDYKWLNR----------------------------------KVLLLLFGLFLVWETRKVKITELNDSQHIG 579          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Medaka
Match: gabbr2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:NCBI gene;Acc:101162936])

HSP 1 Score: 236.884 bits (603), Expect = 1.888e-65
Identity = 185/665 (27.82%), Postives = 314/665 (47.22%), Query Frame = 2
Query:  473 HKAELEKFSFSIQYQQINT--NDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK--KLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLA----NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            H  E  K+SFS+  +  +T  ++ + LR   ++    P+  ++ G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A+++ L  +NW  + TL  D     EV       L    I +     +  +    +  +K    RI+I     NL +  F C  YN  M+G  YQW+       N     N+TNCT    + A +  I    E  +    +   G+  K +       + +   E S  +    D +W I  ++ + R L         Y + + +  ++     + M    F G+TG V F  NG+RM  +   QFQ    +K G Y+     L + N+   F G  PPKD  ++  +   I+  +Y        + + ++   +  NIK R+ ++I+MSS  +NNL+  G ++SY SI   G    D   ++E   + +C  R W+L++ +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W++ D L+   +  + E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:   77 HIRESRKYSFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADKKKYPNFFRTVPSDNAVNPAVVKFLNYHNWTRVGTLTQDVQRFSEVRNDLTNELEKAEIQIADTESFSNDPCVNVKKLKDNDVRIIIGQFDENLASKVF-CCAYNLNMFGSKYQWIIPGWYQGNWWEQANNTNCTTKKLLTAMEGYISVDFEPLSSRPIKGISGRTPKEYEREYSGELQQKGVESSKFHGFAYDGIWVIAKTLTRVRELLRIKQRQNIYHNFTVDDREVGKMVLDVMNETNFYGVTGQVMF-RNGERMGTIKFNQFQEGREVKVGEYNAIADVLDLINNAIKFQGVEPPKDRTIVRPQRRHINVPLYSILSTITILGMLMAGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGGFVSERVFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLIIVGGMLLIDLCILICWQIVDPLRRTVEEYSLEADPQGRDLAILPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITM 734          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Medaka
Match: gabbr2 (gamma-aminobutyric acid type B receptor subunit 2 [Source:NCBI gene;Acc:101162936])

HSP 1 Score: 236.884 bits (603), Expect = 2.230e-65
Identity = 185/665 (27.82%), Postives = 314/665 (47.22%), Query Frame = 2
Query:  473 HKAELEKFSFSIQYQQINT--NDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM------SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK--KLFIDYIQNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLA----NTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTM-NSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINES--KWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYVF---CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            H  E  K+SFS+  +  +T  ++ + LR   ++    P+  ++ G        I A+ +  + + Q+ +   +  L++K +Y   F+ +PS+  +N A+++ L  +NW  + TL  D     EV       L    I +     +  +    +  +K    RI+I     NL +  F C  YN  M+G  YQW+       N     N+TNCT    + A +  I    E  +    +   G+  K +       + +   E S  +    D +W I  ++ + R L         Y + + +  ++     + M    F G+TG V F  NG+RM  +   QFQ    +K G Y+     L + N+   F G  PPKD  ++  +   I+  +Y        + + ++   +  NIK R+ ++I+MSS  +NNL+  G ++SY SI   G    D   ++E   + +C  R W+L++ +   FG++F+KTWR+H IF   KM KK +IKD  L +I+  ++L+D+ +L  W++ D L+   +  + E         I  F   C   +   ++ I+++ KG+L+L G   AWETR V I  LNDSK +GM++Y V +M  +   + + L   Q N  F ++A  II CS  TL LVFVPK + +
Sbjct:   86 HIRESRKYSFSLITKIYDTECDNAKGLRAFFDAICYGPKHLMIFGGVCPSVTSIIAESLEGWNLVQLSFAATTPVLADKKKYPNFFRTVPSDNAVNPAVVKFLNYHNWTRVGTLTQDVQRFSEVRNDLTNELEKAEIQIADTESFSNDPCVNVKKLKDNDVRIIIGQFDENLASKVF-CCAYNLNMFGSKYQWIIPGWYQGNWWEQANNTNCTTKKLLTAMEGYISVDFEPLSSRPIKGISGRTPKEYEREYSGELQQKGVESSKFHGFAYDGIWVIAKTLTRVRELLRIKQRQNIYHNFTVDDREVGKMVLDVMNETNFYGVTGQVMF-RNGERMGTIKFNQFQEGREVKVGEYNAIADVLDLINNAIKFQGVEPPKDRTIVRPQRRHINVPLYSILSTITILGMLMAGAFLFFNIKNRNHRLIKMSSPYMNNLIILGGMLSYASIFLFGL---DGGFVSERVFETLCTVRTWILIVGYTTAFGAMFAKTWRVHAIFKNVKM-KKKIIKDQKLLIIVGGMLLIDLCILICWQIVDPLRRTVEEYSLEADPQGRDLAILPFLEHCENTHMTIWLGIVYAYKGLLMLFGCFLAWETRNVSIPALNDSKYIGMSVYNVGIMCIIGAAVSF-LTRDQPNVQFCIVALVIIFCSTITLCLVFVPKLITM 743          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Medaka
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:101172346])

HSP 1 Score: 181.03 bits (458), Expect = 7.561e-47
Identity = 169/680 (24.85%), Postives = 312/680 (45.88%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSF--RQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYN-QTI--PQDFIGKKLFIDYIQNNMLKNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLL--------NQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSE---EVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHG---VDVGQTIENFTS 2455
            DP    +++   +    I VVL PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T            R   +   IS++ +F+    ++  +  +K   +RI++           F C +Y   +YG  Y W        N   I + S NCTL+    A +  +     + N +T+        ++     +     KN  E     E  L  D++WA+ L++N+T     +           N+D  S      ++   M T  F G++G V F+  G RM+   I Q Q  S+ K G YD      T  +L W+      G  PP D  +++ +   + + ++ +  VFA + I + + C+  NI     + I+ S   LNN+   G +M+  ++ P+G     I+G++  +     VC  R+WL+ L F   +GS+F+K W +H +F+K    K+    +    L+  + +++ +D++LL IW++ D L    +    E   E    + + +   C +     ++ +++  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AII   + TL ++F+PK  ++   G    D  +T+++ +S
Sbjct:   81 DPGEATKLLYDLLYTEPIKVVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEERTKEAGIDISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLYGKKYVWFLIGWYADNWFKIKDPSINCTLEQMSEAVEGHVTTEIVMLNPETVRGASKLTSQEFLTQLMSKLGGKNPEETGGFQEAPLAYDAVWALALALNKTVGPLKARGYRLEDFNYNNRDITS------EIYRAMNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDS-----TKGNLSWYGNDKWIGQGPPADQTVVIEEFRYLSQRLFVSMSVFAVVGILLGIVCLTFNIYNSRVRYIQNSQPYLNNMTAVGCMMALAAVFPLG-----IDGLHVHRRHFPVVCQFRLWLIGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLDSWKLYATVGVLLSVDVLLLMIWQIVDPLHVTVEKFTREAPKEDLDVLIQPLLEHCSSEKMTTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFASLAIIFSVYITLVVLFIPKMRRLITRGEWQSDAQETVKSGSS 740          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Medaka
Match: gabbr1b (gamma-aminobutyric acid type B receptor subunit 1 [Source:NCBI gene;Acc:101172346])

HSP 1 Score: 177.948 bits (450), Expect = 7.279e-46
Identity = 167/660 (25.30%), Postives = 304/660 (46.06%), Query Frame = 2
Query:  533 DPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSF--RQLLSNYSISLKSNFVYKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQW------MSNVLLITN-STNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGK-----KLFIDYIQNNML-KNFSEFS--TENLLLMDSLWAIFLSINQTRILFNSSLL--------NQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFP-----GGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNV--IKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSE---EVSGYITENIYVFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPK 2395
            DP    +++   +    I VVL PG    + + A+    + +  + Y  +S  LSN+ R+   F+  PS  + N   +Q+     W  IAT++  T            R   +   IS++ +F+    ++  +  +K   +RI++           F C +Y   +YG  Y W        N   I + S NCTL+    A +  +     + N   P+   G      + F+  + + +  KN  E     E  L  D++WA+ L++N+T     +           N+D  S      ++   M T  F G++G V F+  G RM+   I Q Q  S+ K G YD      T  +L W+      G  PP D  +++ +   + + ++ +  VFA + I + + C+  NI     + I+ S   LNN+   G +M+  ++ P+G     I+G++  +     VC  R+WL+ L F   +GS+F+K W +H +F+K    K+    +    L+  + +++ +D++LL IW++ D L    +    E   E    + + +   C +     ++ +++  KG+LLL+G+  A+ET+ +  E +ND + VGMAIY V ++  +  P+  +L +SQ + +F   + AII   + TL ++F+PK
Sbjct:   81 DPGEATKLLYDLLYTEPIKVVLMPGCSSVSTLVAEAARMWNLIVLSYGSSSPALSNRQRFPTFFRTHPSATLHNPTRVQLFQKWKWTKIATIQQTTEVFTSTLDDLEERTKEAGIDISVRQSFLTDPAVA--VKNLKRQDARIIVGLFYETEARKVF-CEVYKEKLYGKKYVWFLIGWYADNWFKIKDPSINCTLEQMSEAVEGHVTTEIVMLN---PETVRGASKLTSQEFLTQLMSKLGGKNPEETGGFQEAPLAYDAVWALALALNKTVGPLKARGYRLEDFNYNNRDITS------EIYRAMNTSSFEGVSGHVVFDAQGSRMAWTLIEQLQGGSYKKIGYYDS-----TKGNLSWYGNDKWIGQGPPADQTVVIEEFRYLSQRLFVSMSVFAVVGILLGIVCLTFNIYNSRVRYIQNSQPYLNNMTAVGCMMALAAVFPLG-----IDGLHVHRRHFPVVCQFRLWLIGLGFSLAYGSMFTKIWWVHTVFTKKDEKKEKRKHLDSWKLYATVGVLLSVDVLLLMIWQIVDPLHVTVEKFTREAPKEDLDVLIQPLLEHCSSEKMTTWLGVVYGYKGLLLLLGIFLAYETKSISTEKINDHRAVGMAIYNVAVLCLITAPVTMIL-SSQQDASFAFASLAIIFSVYITLVVLFIPK 717          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Medaka
Match: gpr156 (G protein-coupled receptor 156 [Source:NCBI gene;Acc:101160698])

HSP 1 Score: 104.76 bits (260), Expect = 1.401e-22
Identity = 78/271 (28.78%), Postives = 143/271 (52.77%), Query Frame = 2
Query: 1622 LVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEV-SGYITENIYVF--CCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKIWQHGVD 2425
            L+  GIF++     +   ++FR+ +I++MSS NLN L  CG V++Y+S           +    S ++  AR+W L L    +FG +  KTWR++ +F++    K+ +I+D+ L  ++ L++++D+++L  W LTD ++    V     V  G ++ ++     C +  S  ++ I+   KG LLL G + A  T  V    +N S  +  A+ +V + + V++P+   L  +  N  + V+A AI IC+  T  ++FVP+  +  Q   D
Sbjct:   68 LLSCGIFLAFCF--LFFTVRFRNNRIVKMSSPNLNVLTLCGSVLTYISGFLFAVEDHTHSPGGTSSYILQARIWTLCLGSTLVFGPILGKTWRLYRVFTQRVPDKRVIIRDIQLIGMVFLLLMVDVMVLTGWNLTDPVRCSRSVAAVMTVMQGDVSSSLSQLDACSSVYSDVWIIIIAVQKGCLLLYGTYLAGLTSNVSHTPVNQSPTIITAVTLVTLSSAVVVPVSTSL-QAWPNLVYAVVAGAIFICTLATNCMLFVPQLTQCRQFEED 335          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Planmine SMEST
Match: SMESG000005548.1 (SMESG000005548.1)

HSP 1 Score: 355.91 bits (912), Expect = 4.191e-118
Identity = 176/176 (100.00%), Postives = 176/176 (100.00%), Query Frame = 2
Query:  311 MEALISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEV 838
            MEALISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEV
Sbjct:    1 MEALISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANYTLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEV 176          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Planmine SMEST
Match: SMESG000005545.1 (SMESG000005545.1)

HSP 1 Score: 273.863 bits (699), Expect = 2.532e-87
Identity = 134/134 (100.00%), Postives = 134/134 (100.00%), Query Frame = 2
Query: 1208 MLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSI 1609
            MLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSI
Sbjct:    1 MLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSI 134          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Planmine SMEST
Match: SMESG000005545.1 (SMESG000005545.1)

HSP 1 Score: 245.743 bits (626), Expect = 6.019e-77
Identity = 119/119 (100.00%), Postives = 119/119 (100.00%), Query Frame = 2
Query: 1253 MDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSI 1609
            MDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSI
Sbjct:    1 MDSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYDPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSI 119          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Planmine SMEST
Match: SMESG000049232.1 (SMESG000049232.1)

HSP 1 Score: 180.259 bits (456), Expect = 9.007e-47
Identity = 185/678 (27.29%), Postives = 318/678 (46.90%), Query Frame = 2
Query:  485 LEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYK-------ENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQ--NNMLKNFSEFSTENLLLM------------------DSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSY-DPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV-----FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            L K    + Y       P+   Q +N   +  +I+++ G G        +++ + + I QI Y+     LS+K +Y  L + + S+   N A I +L   NW  +  L  D  S    S +   L++ + +       YK        + +K L  +K L  RI++    + L   +  C  Y  G+ G  Y W     +I        ++     QA         N+ I   +      +DY+Q  +   K+ S  +      M                  D++W I L++N+        LL++      PEF             G+TG    ++ G+R   VN+ Q+ N ++   G + D       MN    +P G  P D   I+ K   I+  IY  F+      I  +   + +NIKFR  + I+MSS N+NN++  G V+SY+S+I +G S +    + ESK+    +C  + W L L F   FG++FSKTWR+H IF+   ++KK VI+D  L  ++  ++LLD+V+L +  + D ++   ++ NS E+S  I  NI +     FC +     ++ ++++ KG+LL IG    WETR+V+I  LNDSK +G+++Y+V++M      +  ++ +S ++  F ++A+ II+ +  TLSLVF+PK ++I
Sbjct:   67 LAKKKLKVVYTVTECKMPRATEQFLNLMNSSVKINIIFGCGCYELTGALSEISSYWNITQITYSDTDFTLSSKNKYPNLIRTVVSDYCFNFASIAMLKRFNWTRVGILYQDEVSYLRTSSN--ALVNAHLVHEMEKKGYKPYSFGFFNDPTKGLVNLKRLNVRIIMGIFQQRL-NEEVLCKAYTEGLIGRNYVW-----IIFGQGQTFFESSKEDVQAKC-------NKKIVYQY---HFVLDYLQIWSENKKSVSNLTPNEYSAMITGSSSSNTTTIFHAYAFDAVWGIALALNE-----RERLLDRSEKLVIPEF------------FGITGPFKISK-GERNCLVNVRQYINGNYNYIGYFNDIEDDLHLMNDTLIWPHGQIPSDRSKIVRKWKSINIIIYVIFIAITSCGIVFAFILMGINIKFRKHRYIKMSSPNMNNIIIIGSVLSYVSVIILGTSRTI---VGESKFAMRVICSMKAWTLCLGFTLSFGAMFSKTWRVHQIFTNISLNKK-VIRDSKLIGMVCFLLLLDVVILSLQTIIDPVQ--LKIQNSTEIS--IELNIEIIYFWEFCSSEKQSIWVGVIYAHKGLLLAIGCFLVWETRQVNIPALNDSKHIGLSVYMVVIMCASGAAVNAVIQDS-IDFNFIIIASFIILSTTITLSLVFLPKLIQI 699          
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Planmine SMEST
Match: SMESG000049232.1 (SMESG000049232.1)

HSP 1 Score: 180.259 bits (456), Expect = 1.099e-46
Identity = 185/678 (27.29%), Postives = 318/678 (46.90%), Query Frame = 2
Query:  485 LEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVLGPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEVINEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFVYK-------ENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWMSNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYIQ--NNMLKNFSEFSTENLLLM------------------DSLWAIFLSINQTRILFNSSLLNQDYLSTSPEFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSY-DPSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFISISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDINGINESKW----VCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVIKDXXXXXXXXXXXXXXXXXXXXWELTDNLKWCTQVNNSEEVSGYITENIYV-----FCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMAIYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKFLKI 2407
            L K    + Y       P+   Q +N   +  +I+++ G G        +++ + + I QI Y+     LS+K +Y  L + + S+   N A I +L   NW  +  L  D  S    S +   L++ + +       YK        + +K L  +K L  RI++    + L   +  C  Y  G+ G  Y W     +I        ++     QA         N+ I   +      +DY+Q  +   K+ S  +      M                  D++W I L++N+        LL++      PEF             G+TG    ++ G+R   VN+ Q+ N ++   G + D       MN    +P G  P D   I+ K   I+  IY  F+      I  +   + +NIKFR  + I+MSS N+NN++  G V+SY+S+I +G S +    + ESK+    +C  + W L L F   FG++FSKTWR+H IF+   ++KK VI+D  L  ++  ++LLD+V+L +  + D ++   ++ NS E+S  I  NI +     FC +     ++ ++++ KG+LL IG    WETR+V+I  LNDSK +G+++Y+V++M      +  ++ +S ++  F ++A+ II+ +  TLSLVF+PK ++I
Sbjct:   75 LAKKKLKVVYTVTECKMPRATEQFLNLMNSSVKINIIFGCGCYELTGALSEISSYWNITQITYSDTDFTLSSKNKYPNLIRTVVSDYCFNFASIAMLKRFNWTRVGILYQDEVSYLRTSSN--ALVNAHLVHEMEKKGYKPYSFGFFNDPTKGLVNLKRLNVRIIMGIFQQRL-NEEVLCKAYTEGLIGRNYVW-----IIFGQGQTFFESSKEDVQAKC-------NKKIVYQY---HFVLDYLQIWSENKKSVSNLTPNEYSAMITGSSSSNTTTIFHAYAFDAVWGIALALNE-----RERLLDRSEKLVIPEF------------FGITGPFKISK-GERNCLVNVRQYINGNYNYIGYFNDIEDDLHLMNDTLIWPHGQIPSDRSKIVRKWKSINIIIYVIFIAITSCGIVFAFILMGINIKFRKHRYIKMSSPNMNNIIIIGSVLSYVSVIILGTSRTI---VGESKFAMRVICSMKAWTLCLGFTLSFGAMFSKTWRVHQIFTNISLNKK-VIRDSKLIGMVCFLLLLDVVILSLQTIIDPVQ--LKIQNSTEIS--IELNIEIIYFWEFCSSEKQSIWVGVIYAHKGLLLAIGCFLVWETRQVNIPALNDSKHIGLSVYMVVIMCASGAAVNAVIQDS-IDFNFIIIASFIILSTTITLSLVFLPKLIQI 707          
The following BLAST results are available for this feature:
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABBR22.048e-6228.25gamma-aminobutyric acid type B receptor subunit 2 ... [more]
GABBR18.078e-5624.80gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR11.011e-5524.80gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR11.011e-5524.80gamma-aminobutyric acid type B receptor subunit 1 ... [more]
GABBR11.011e-5524.80gamma-aminobutyric acid type B receptor subunit 1 ... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gbb-28.636e-5123.95Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
gbb-15.542e-4725.23Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-12.895e-4524.81Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-14.018e-3325.20Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gbb-11.113e-2524.62Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GABA-B-R22.257e-5628.09gene:FBgn0027575 transcript:FBtr0084167[more]
GABA-B-R22.637e-5628.09gene:FBgn0027575 transcript:FBtr0084168[more]
GABA-B-R28.451e-5628.27gene:FBgn0027575 transcript:FBtr0339154[more]
GABA-B-R17.066e-5425.36gene:FBgn0260446 transcript:FBtr0304732[more]
GABA-B-R17.066e-5425.36gene:FBgn0260446 transcript:FBtr0304731[more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr23.302e-6528.31gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
gabbr1b1.253e-4925.56gamma-aminobutyric acid (GABA) B receptor, 1b [Sou... [more]
gabbr1b1.659e-4925.53gamma-aminobutyric acid (GABA) B receptor, 1b [Sou... [more]
gabbr1a5.886e-4825.08gamma-aminobutyric acid (GABA) B receptor, 1a [Sou... [more]
gabbr1a1.652e-4524.52gamma-aminobutyric acid (GABA) B receptor, 1a [Sou... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr23.266e-6228.13gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
gabbr21.154e-6128.13gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
tonsl8.417e-5023.87tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
tonsl9.106e-4924.04tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
tonsl1.058e-4824.04tonsoku like, DNA repair protein [Source:Xenbase;A... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gabbr21.173e-6127.94gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
Gabbr17.415e-5424.93gamma-aminobutyric acid (GABA) B receptor, 1 [Sour... [more]
Gabbr12.554e-5324.93gamma-aminobutyric acid (GABA) B receptor, 1 [Sour... [more]
Gabbr26.720e-2135.08gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
Grm51.607e-720.95glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O75899|GABR2_HUMAN9.833e-6228.25Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
sp|O88871|GABR2_RAT6.056e-6127.94Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
sp|Q80T41|GABR2_MOUSE8.208e-6127.94Gamma-aminobutyric acid type B receptor subunit 2 ... [more]
sp|Q9UBS5|GABR1_HUMAN1.422e-5425.35Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
sp|Q9WV18|GABR1_MOUSE1.787e-5224.93Gamma-aminobutyric acid type B receptor subunit 1 ... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R7V2Y73.695e-7830.31G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
C3Y4332.273e-7329.54Uncharacterized protein OS=Branchiostoma floridae ... [more]
A0A267DHX92.918e-7026.79G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
V3YZP52.077e-6626.76G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
A0A1S3M5K66.697e-6428.24gamma-aminobutyric acid type B receptor subunit 2-... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr23.771e-6628.15gamma-aminobutyric acid (GABA) B receptor, 2 [Sour... [more]
gabbr1a1.824e-4824.96gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1b2.270e-4824.89gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1a8.189e-4825.30gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1a9.338e-4824.96gamma-aminobutyric acid type B receptor subunit 1 ... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007580.13.114e-4429.81pep scaffold:Pmarinus_7.0:GL479777:49246:63453:-1 ... [more]
ENSPMAT00000007583.14.456e-3531.96pep scaffold:Pmarinus_7.0:GL479777:50633:55489:-1 ... [more]
GABBR21.307e-2925.77gamma-aminobutyric acid type B receptor subunit 2 ... [more]
ENSPMAT00000004054.11.278e-1138.89pep scaffold:Pmarinus_7.0:GL487958:4015:7652:1 gen... [more]
ENSPMAT00000002289.15.245e-1126.79pep scaffold:Pmarinus_7.0:GL476972:10669:15547:1 g... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471111.474e-6427.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO475531.707e-5525.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490517.775e-5424.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466091.167e-5228.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO383178.348e-4427.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gabbr21.888e-6527.82gamma-aminobutyric acid type B receptor subunit 2 ... [more]
gabbr22.230e-6527.82gamma-aminobutyric acid type B receptor subunit 2 ... [more]
gabbr1b7.561e-4724.85gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gabbr1b7.279e-4625.30gamma-aminobutyric acid type B receptor subunit 1 ... [more]
gpr1561.401e-2228.78G protein-coupled receptor 156 [Source:NCBI gene;A... [more]
back to top
BLAST of Gamma-aminobutyric acid type B receptor subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005548.14.191e-118100.00SMESG000005548.1[more]
SMESG000005545.12.532e-87100.00SMESG000005545.1[more]
SMESG000005545.16.019e-77100.00SMESG000005545.1[more]
SMESG000049232.19.007e-4727.29SMESG000049232.1[more]
SMESG000049232.11.099e-4627.29SMESG000049232.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025983 ID=SMED30025983|Name=Gamma-aminobutyric acid type B receptor subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2533bp
TGATTTTTAGCTACGTTTATTTTTCCTTTTTCCTTTATTCTTGGATTTTC
CGAGGAATCGAGCCCTCACGGATAGTGTCCACTACCACTGACACTCACTA
CAAGAACTTTCAGATTCAACTCCCAAACAAAATACATGAAATCGGAAGTA
TTACAGTTATGGAATTTTATTTTTTAAATGCAAATGCGTTGAAATATGCA
ATGGAAACAAAGATCCGTGCGCATGCAAAATGCGACATTTCTCATTGGGT
CAACAGAACAACTCACATTACAATATAGAGAGGCGCTTTACTTAAGAAAT
GCATTTGACAATGGAGGCATTAATATCACAATTGTTCTCCATATCCATAA
TGTTGTTCGGAGGATTCCCGGAGGACACTTTAAGTCAGAATGCTTTCAAC
ATTCTCTTTCTTTATTCGTCTAATGAGGAGGCTCAGATTGCTAATTACAC
TTTGCAATTCTTCAATGAATTCCACAAAGCAGAACTGGAGAAATTTTCTT
TTTCCATCCAATATCAACAAATAAATACTAATGACCCCCAGTTTTTGAGA
CAGATAATAAACAGTTTCATTAATGTTCCACGAATTCACGTAGTACTGGG
TCCAGGGACTCAATATTCTGCAGAAATATCAGCAGATTTAATCAATAACT
ACAAGATTCCACAAATTGGTTATAATTGGGCATCTTCAAAATTAAGCAAT
AAAACTCGATACAGTCAGCTATTCAAGCTGCTTCCATCTGAAGAGGTTAT
CAACGAAGCAATGATCCAAATTCTCTTTCTAAACAATTGGAGAACAATTG
CAACTTTAGAATACGACACAAATAGCATTTATGAGGTTTCAAAATCTTTT
CGTCAATTACTTAGCAATTACAGCATCTCACTGAAGAGCAATTTCGTGTA
TAAAGAAAACATTTCCAAGCAATTAGATCTTATAAAGACTTTGAAAAGTA
GAATAGTGATTAACTTTTTACCAAGAAATCTGAAAACTAACGACTTTGAA
TGCAGCATATATAATAATGGCATGTACGGACCCTTATACCAATGGATGTC
CAACGTGTTACTGATAACCAATTCAACTAATTGTACTCTCGATAATCAAA
TTGCCGCCCGACAGGCAGCCATATATTTTCTCAGCGAAATTTACAATCAA
ACAATACCCCAGGATTTCATTGGAAAGAAGCTATTCATTGACTATATCCA
AAACAATATGCTGAAAAATTTCTCTGAATTTAGCACTGAAAATTTATTAT
TAATGGATTCTTTGTGGGCAATTTTTCTGAGTATCAACCAAACAAGAATT
TTATTCAACAGTTCTCTTTTGAATCAGGATTATTTGTCAACGTCCCCCGA
GTTCGAACAGTTGGCAAACACCATGAGGACAATAAGATTTGCGGGACTGA
CAGGTATGGTATCATTCAATGAAAATGGTGACAGGATGTCAAGAGTAAAT
ATTTATCAATTTCAAAATAAATCATTCATAAAATGCGGATCTTACGATCC
ATCGTTGAAATATTTGACGATGAATTCACTGTTTTGGTTTCCAGGCGGAG
TTCCTCCAAAGGACAGCATTTTGATCCTGTCGAAAATAAACGGCATTGAC
AAATCAATTTATTATACTTTCTTGGTCTTTGCTGGAATTTTCATATCTAT
AAGCCTAACATGCATCATCTTGAACATTAAATTCAGGCACGCAAAAATTA
TCAGAATGTCATCCTCAAATTTAAATAATTTAATGACTTGCGGGATCGTC
ATGTCATACCTGTCAATTATACCAATTGGGTATTCGCCAAGTGATATCAA
CGGAATTAATGAGTCCAAGTGGGTTTGCCATGCACGAGTGTGGCTGCTCA
TGCTCTCATTCGATTGCATATTCGGCAGTCTGTTTTCTAAAACCTGGAGA
ATTCATATGATCTTCTCTAAATCTAAAATGCATAAAAAGAATGTGATTAA
AGATTTACACCTGTTTCTGATAATTTCCCTAATAGTACTGTTGGATATTG
TCTTACTGTTTATCTGGGAACTGACAGACAATTTGAAATGGTGCACCCAA
GTAAATAATTCGGAAGAAGTCAGTGGATATATTACAGAGAACATCTATGT
TTTTTGTTGTGCTAGGAATAGCTTGTATTTTATGCCAATTTTATTTTCCA
TAAAAGGAATATTACTGTTGATTGGATTACACTTTGCTTGGGAAACTAGG
AAGGTACATATTGAGATATTAAATGATTCAAAGCAAGTGGGAATGGCTAT
TTATATAGTTATAATGATGGCTACCGTCATTATCCCTCTGGAATATATGC
TTGATAACAGTCAAGTAAACCCTGCATTTTACGTCTTAGCTGCTGCAATT
ATCATTTGTAGTTTCACGACTTTGTCGTTAGTCTTCGTCCCTAAATTTCT
GAAAATATGGCAACATGGCGTCGATGTCGGGCAAACAATCGAAAACTTTA
CGTCCAAGCAATCTTGAACATGTTTCGCTAAGTCGCTTAGATGAATTGTG
TTCTTCTAATCTCATTTTATTTAGTATTTAGGC
back to top

protein sequence of SMED30025983-orf-1

>SMED30025983-orf-1 ID=SMED30025983-orf-1|Name=SMED30025983-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=723bp
MHLTMEALISQLFSISIMLFGGFPEDTLSQNAFNILFLYSSNEEAQIANY
TLQFFNEFHKAELEKFSFSIQYQQINTNDPQFLRQIINSFINVPRIHVVL
GPGTQYSAEISADLINNYKIPQIGYNWASSKLSNKTRYSQLFKLLPSEEV
INEAMIQILFLNNWRTIATLEYDTNSIYEVSKSFRQLLSNYSISLKSNFV
YKENISKQLDLIKTLKSRIVINFLPRNLKTNDFECSIYNNGMYGPLYQWM
SNVLLITNSTNCTLDNQIAARQAAIYFLSEIYNQTIPQDFIGKKLFIDYI
QNNMLKNFSEFSTENLLLMDSLWAIFLSINQTRILFNSSLLNQDYLSTSP
EFEQLANTMRTIRFAGLTGMVSFNENGDRMSRVNIYQFQNKSFIKCGSYD
PSLKYLTMNSLFWFPGGVPPKDSILILSKINGIDKSIYYTFLVFAGIFIS
ISLTCIILNIKFRHAKIIRMSSSNLNNLMTCGIVMSYLSIIPIGYSPSDI
NGINESKWVCHARVWLLMLSFDCIFGSLFSKTWRIHMIFSKSKMHKKNVI
KDLHLFLIISLIVLLDIVLLFIWELTDNLKWCTQVNNSEEVSGYITENIY
VFCCARNSLYFMPILFSIKGILLLIGLHFAWETRKVHIEILNDSKQVGMA
IYIVIMMATVIIPLEYMLDNSQVNPAFYVLAAAIIICSFTTLSLVFVPKF
LKIWQHGVDVGQTIENFTSKQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR011528NERD
IPR001828ANF_lig-bd_rcpt
IPR017978GPCR_3_C
IPR028082Peripla_BP_I
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
GO:0004965G-protein coupled GABA receptor activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005887integral component of plasma membrane
GO:0016020membrane
GO:0030054cell junction
GO:0038039G-protein coupled receptor heterodimeric complex
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
GO:0007194negative regulation of adenylate cyclase activity
GO:0007214gamma-aminobutyric acid signaling pathway
GO:0007268chemical synaptic transmission