TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30025971
Length (bp)1989
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30025971) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30025971) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30025971) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30025971) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025971

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025971h1SMcG0018059 PL08009B1H03smed_ncbi_20240424PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30025971h1SMcG0018059 dd_Smed_v4_3097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025971h1SMcG0018059 dd_Smed_v4_3097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025971h1SMcG0018059 dd_Smed_v4_3097_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 121.324 bits (303), Expect = 2.565e-28
Identity = 103/413 (24.94%), Postives = 190/413 (46.00%), Query Frame = 3
Query:  294 LKTYLNRSEKFCPGDSDYCKR--VLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEID----SIKNQVNEIKEIKEKINRNSR--RKLLSYFPKQMKFLKTFLVFTFYMLILNY-ATKIPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQ--KSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            LK +L+ S +F      YCK+  V+IN  N+        +      + CP  C    ++  +++EH+ +C    + CPF + GC   +    N++QH  S +  H  L+++ N   + +I     S++ + ++I+++ E I +  +  ++    F K   FL    VF  ++    +   ++  +  +++ ++N+  +      V+ +  KI     N+QR+   E    + + H +   KA++ +NE                W + ++  K+  A  G    IFS  F +   GY+L  +A  NG G+    +LS+Y  +M+G  D+ L WPF+  VT  +++Q  K N++      T+   PNS  + RP    NI  G P F++   LE  +   I D+ + LK  V L
Sbjct:  153 LKEHLSASCQFRKEKCLYCKKDVVVINLQNH------EENLCPEYPVFCPNNCAKIILK-TEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHIN-IHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIME-----TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          

HSP 2 Score: 86.2705 bits (212), Expect = 5.799e-17
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS-MNPGLIVDDKIAFRVTTEV 1925
             K+IW V ++   +++A  G  + IFS+ FY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ +    ++  F  D  P+  +  RP  E ++  G  +F++   L       I DD +  +V  ++
Sbjct:  404 GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIMETFKPD--PNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 121.324 bits (303), Expect = 2.565e-28
Identity = 103/413 (24.94%), Postives = 190/413 (46.00%), Query Frame = 3
Query:  294 LKTYLNRSEKFCPGDSDYCKR--VLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEID----SIKNQVNEIKEIKEKINRNSR--RKLLSYFPKQMKFLKTFLVFTFYMLILNY-ATKIPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQ--KSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            LK +L+ S +F      YCK+  V+IN  N+        +      + CP  C    ++  +++EH+ +C    + CPF + GC   +    N++QH  S +  H  L+++ N   + +I     S++ + ++I+++ E I +  +  ++    F K   FL    VF  ++    +   ++  +  +++ ++N+  +      V+ +  KI     N+QR+   E    + + H +   KA++ +NE                W + ++  K+  A  G    IFS  F +   GY+L  +A  NG G+    +LS+Y  +M+G  D+ L WPF+  VT  +++Q  K N++      T+   PNS  + RP    NI  G P F++   LE  +   I D+ + LK  V L
Sbjct:  153 LKEHLSASCQFRKEKCLYCKKDVVVINLQNH------EENLCPEYPVFCPNNCAKIILK-TEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHIN-IHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIME-----TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          

HSP 2 Score: 86.2705 bits (212), Expect = 5.799e-17
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS-MNPGLIVDDKIAFRVTTEV 1925
             K+IW V ++   +++A  G  + IFS+ FY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ +    ++  F  D  P+  +  RP  E ++  G  +F++   L       I DD +  +V  ++
Sbjct:  404 GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIMETFKPD--PNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 121.324 bits (303), Expect = 2.565e-28
Identity = 103/413 (24.94%), Postives = 190/413 (46.00%), Query Frame = 3
Query:  294 LKTYLNRSEKFCPGDSDYCKR--VLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEID----SIKNQVNEIKEIKEKINRNSR--RKLLSYFPKQMKFLKTFLVFTFYMLILNY-ATKIPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQ--KSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            LK +L+ S +F      YCK+  V+IN  N+        +      + CP  C    ++  +++EH+ +C    + CPF + GC   +    N++QH  S +  H  L+++ N   + +I     S++ + ++I+++ E I +  +  ++    F K   FL    VF  ++    +   ++  +  +++ ++N+  +      V+ +  KI     N+QR+   E    + + H +   KA++ +NE                W + ++  K+  A  G    IFS  F +   GY+L  +A  NG G+    +LS+Y  +M+G  D+ L WPF+  VT  +++Q  K N++      T+   PNS  + RP    NI  G P F++   LE  +   I D+ + LK  V L
Sbjct:  153 LKEHLSASCQFRKEKCLYCKKDVVVINLQNH------EENLCPEYPVFCPNNCAKIILK-TEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHIN-IHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIME-----TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          

HSP 2 Score: 86.2705 bits (212), Expect = 5.799e-17
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS-MNPGLIVDDKIAFRVTTEV 1925
             K+IW V ++   +++A  G  + IFS+ FY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ +    ++  F  D  P+  +  RP  E ++  G  +F++   L       I DD +  +V  ++
Sbjct:  404 GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIMETFKPD--PNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 105.145 bits (261), Expect = 3.940e-23
Identity = 84/356 (23.60%), Postives = 151/356 (42.42%), Query Frame = 3
Query:  390 DQPTNHRIA-RLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYAT-KIPIIRTILHNEE--NQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            D   +H +  +  L C + CG   I   + ++H++ C   R  C F  IGC E  +     ++H +  +  H ++L+      K  +    +  +E+ +  E + + +                    F   + +LN    ++ +       +   +Q  I    +KV+++   I    + +     LEQ++   E   A  +   F W I +F+ KR+ A +G++  IFS  F +   GY++  +   NG G     +LS++  +MKG ND  L WPF   VT  +++Q +N  H       D+   S  + RP    NI  G P F    ++E +   + D+ I +K  V L G
Sbjct:  174 DVKAHHEVCPKFPLTC-DGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLET-VEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKT------------------ATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIG---LKDLAMADLEQKVLEME---ASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDV--TSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG 500          

HSP 2 Score: 93.2041 bits (230), Expect = 2.545e-19
Identity = 47/147 (31.97%), Postives = 77/147 (52.38%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW + +F + R++A +G+   IFS  FY+ R GYKM L +Y NG  TG    +S++F ++KGP+D  L WP+   V   L+DQ+ N   V++ F  D+     +  RP  + ++  G   F    K+      + DD I  +   ++
Sbjct:  355 IWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQN-NREHVIDAFRPDVTSS--SFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 92.0485 bits (227), Expect = 6.603e-19
Identity = 101/459 (22.00%), Postives = 184/459 (40.09%), Query Frame = 3
Query:  171 LRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCP---------FINI----GCQENNLVVLNMKQHL-LSEIEVHS--------------SLLMQWNENTKNEIDSIKNQVN---EIKEIKEKINRNS-RRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNE----FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPN-GSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNI-GVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            ++ Y+ E +  +    +C IC   +  A  +PCG RFC  C+   +  +   CP D++      I  +N +F D      I  L +KCP       +EL  +E+H   C      CP          INI     C    +   N    +   + E+H               ++L++       ++D     +          EK+ RN   R L       M+ L   +     +    Y +++   +  +H  E ++   + +  + E+  K+  Q +   E   L++ I T E   AE+   +    + W I NF    +  +  K   I S  F + + GY+L  +      +      Y+S+++  M+G  D++L WPF+  +  +I++Q    V        D  P    + RPT  RN  G G+ +F+  + L  +T  I D+ ++++C+V
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQ--IRELTAKMETQSMYVSE---LKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRT-FIKDDTLLVRCEV 499          

HSP 2 Score: 57.3806 bits (137), Expect = 5.683e-8
Identity = 46/188 (24.47%), Postives = 86/188 (45.74%), Query Frame = 3
Query: 1374 ELETQTGLIVDNRIILKCKVHLDGKLANTLHENGNKI-IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELY---PNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNR---NRPFTEKSL-GFGFEKFISFEKLSMNPGLIVDDKIAFRV 1913
            ++ETQ+  + + +  ++    L+ K+A    +  N I IW + NF    K  +  K + I S  FY+ + GYK+ + L+   P          +S++   ++G +D  L WP++  +   ++DQ     A V +  ++++   P      RP   ++  GFG+  F+  E L      I DD +  R 
Sbjct:  319 KMETQSMYVSELKRTIR---TLEDKVAEIEAQQCNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCA--NYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSE---APVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQR-TFIKDDTLLVRC 497          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 81.6481 bits (200), Expect = 1.407e-16
Identity = 57/186 (30.65%), Postives = 92/186 (49.46%), Query Frame = 3
Query:  888 IVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVY-EIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEW-NRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHL 1439
            I  KIN Q+    + Y    +  +  ++  E + ++ T+ I         A   K +  I+S PF SH  GY++M  A P G G     Y S+++C+MKG  D+ L WPF+ +VTFSI++     + +K +   +M P  +E+  RP   RN   GF +F+   ++   T    D  I ++ KV L
Sbjct:  124 IRTKINIQQSAYVDKYVGMLQYMSIAESAFEKYGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEM-PEIQEFLERPEGLRNGTFGFQNFLPLAKV---TEFAADGDIFIQIKVLL 305          

HSP 2 Score: 64.3142 bits (155), Expect = 7.395e-11
Identity = 32/107 (29.91%), Postives = 54/107 (50.47%), Query Frame = 3
Query: 1548 IFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS 1868
            I+S+PFYSH  GYKM+    P G      E  S++  ++KG  DD LEWP++ +V F ++            + +++        RP   ++  FGF+ F+   K++
Sbjct:  183 IYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQEFLERPEGLRNGTFGFQNFLPLAKVT 289          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 78.5666 bits (192), Expect = 3.951e-15
Identity = 50/153 (32.68%), Postives = 73/153 (47.71%), Query Frame = 3
Query:  942 EQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRL-LTYDMLP-----NSKEWNRPTQFRNIGVGFPSFISFKELE 1382
            +  I ++ +T  EM   +  W I     +   AKSG    IFS PF+SH  GY++M  A   G G+     +S+Y+ ++KG  D  L WPF   +  S+++Q  N     R+ +TY + P     N K   RP   RN   G  SF S   L+
Sbjct:  247 QTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQ--NPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQ 397          

HSP 2 Score: 77.411 bits (189), Expect = 9.325e-15
Identity = 49/155 (31.61%), Postives = 75/155 (48.39%), Query Frame = 3
Query: 1473 GNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRN-----RPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTE 1922
            G ++IW +    Q   +A+SG    IFS PF SHR GYKM+      G  +   + +S+Y  ++KG  D  LEWP+   +   L+DQ+      VN  T  + P     N     RP  E++  FG + F S   L++    + DDKI  ++  +
Sbjct:  262 GPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVN-ITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCS---LAILQNYVKDDKIYVQIDVD 412          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 88.5817 bits (218), Expect = 4.011e-18
Identity = 49/153 (32.03%), Postives = 78/153 (50.98%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQ--HTNYPAVVNKFTDDLLPDHPNRNRPFTEKS-LGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQK 1931
            ++W + +++    +A+    L++ S PFY+ + GYK+   ++ NG   G N  VS+Y +++ G +D  L+WP+  ++ F L +Q   +    V   F  D  P   N  RP  E   LGFGF +FIS E L   P  I  D +  RV  +  K
Sbjct:  333 LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPD--PTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVKVDPSK 482          

HSP 2 Score: 75.485 bits (184), Expect = 5.309e-14
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 3
Query: 1002 WTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPT-QFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            W I ++S K   A+     E+ S PF + + GY+L      NG+G  EN ++S+YI ++ G  D  L WPF  ++TF++  Q +         ++   P  + + RP+ +   +G GFP FIS + L ++   I  + + L+ KV
Sbjct:  335 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 88.1965 bits (217), Expect = 4.914e-18
Identity = 49/153 (32.03%), Postives = 78/153 (50.98%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQ--HTNYPAVVNKFTDDLLPDHPNRNRPFTEKS-LGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQK 1931
            ++W + +++    +A+    L++ S PFY+ + GYK+   ++ NG   G N  VS+Y +++ G +D  L+WP+  ++ F L +Q   +    V   F  D  P   N  RP  E   LGFGF +FIS E L   P  I  D +  RV  +  K
Sbjct:  324 LLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPD--PTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVKVDPSK 473          

HSP 2 Score: 76.2554 bits (186), Expect = 2.929e-14
Identity = 44/145 (30.34%), Postives = 75/145 (51.72%), Query Frame = 3
Query: 1002 WTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPT-QFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            W I ++S K   A+     E+ S PF + + GY+L      NG+G  EN ++S+YI ++ G  D  L WPF  ++TF++  Q +         ++   P  + + RP+ +   +G GFP FIS + L ++   I  + + L+ KV
Sbjct:  326 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRP-FIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 51.2174 bits (121), Expect = 2.627e-6
Identity = 68/347 (19.60%), Postives = 131/347 (37.75%), Query Frame = 3
Query:  219 KCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQME--EHIRICNNQRR------FCPFINIGCQENNLVVLN-MKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTF 1232
            +C IC   +     + CG RFC  CL  ++ ++ + CP D+   KR  ++ ++++F D  T   I +L+  CP +     +  + +E   H+  C  +R+       CPF  I C        N +++HL +++  H  L++Q  + T                ++    +        Y       +   +V T Y  I+    +     T L N + Q+ +   +  V+         R +N                          W I          ++    +++S    +  +GY+  F A  N      ++ LS+++ +M+  ND +L WPFK  +  
Sbjct:  103 ECAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMDN---KR--LSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQY----ANGVDEQIVQTMYQRIVVLEQRTREQETRLENMQKQLRLARQQAPVDP--------RYSN----------------------GTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYK--FCARLNIQPRKPHV-LSLHVHLMQSENDYHLDWPFKGRIKL 407          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 100.523 bits (249), Expect = 5.581e-22
Identity = 59/164 (35.98%), Postives = 89/164 (54.27%), Query Frame = 3
Query:  984 HQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKL 1451
            H     W + ++S K + AK    +E FS PF +H  GY+L   A  NG+G+ E  +LSIYI ++ G  DN L WPF   VTFSI++Q    +   + +  T++  PN K + +P   RN      +G G+P FIS +E++ +   I DN I LK  + +  K+
Sbjct:  306 HDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNSIFLKASIEIPQKI 468          

HSP 2 Score: 90.1225 bits (222), Expect = 1.426e-18
Identity = 49/159 (30.82%), Postives = 85/159 (53.46%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPD-------HPNRNR-PFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+HR GYK+ +  + NG  +G    +SIY +++ G +D+ LEWP+   V F ++DQ     +     T+   PD        P  +R    E +LGFG+ KFIS E++      I D+ I  + + E+ +K
Sbjct:  310 LIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASIEIPQK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 100.523 bits (249), Expect = 5.581e-22
Identity = 59/164 (35.98%), Postives = 89/164 (54.27%), Query Frame = 3
Query:  984 HQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKL 1451
            H     W + ++S K + AK    +E FS PF +H  GY+L   A  NG+G+ E  +LSIYI ++ G  DN L WPF   VTFSI++Q    +   + +  T++  PN K + +P   RN      +G G+P FIS +E++ +   I DN I LK  + +  K+
Sbjct:  306 HDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNSIFLKASIEIPQKI 468          

HSP 2 Score: 90.1225 bits (222), Expect = 1.426e-18
Identity = 49/159 (30.82%), Postives = 85/159 (53.46%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPD-------HPNRNR-PFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+HR GYK+ +  + NG  +G    +SIY +++ G +D+ LEWP+   V F ++DQ     +     T+   PD        P  +R    E +LGFG+ KFIS E++      I D+ I  + + E+ +K
Sbjct:  310 LIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASIEIPQK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: unm_sa808 (un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21])

HSP 1 Score: 95.1301 bits (235), Expect = 3.354e-21
Identity = 60/201 (29.85%), Postives = 94/201 (46.77%), Query Frame = 3
Query:  876 KVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMH-----------QNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            K+E + NK+           QLE+++   + T AEM               F W I +F+ KR++A +G+   +FS  F + + GY++  +   NG G     +LS++  +M+G +D  L WPF   VT  +++Q SN  H       D+   S  + RP    NI  G P F    +LE +   I D+ I +K  V L G
Sbjct:   93 KIEALSNKVR----------QLERQVGVKDLTVAEMEGRLREMSATTFDGVFIWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQ-SNREHIIDAFRPDI--TSSSFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVDLTG 280          

HSP 2 Score: 93.2041 bits (230), Expect = 1.369e-20
Identity = 48/147 (32.65%), Postives = 79/147 (53.74%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW + +FT+ R+DA +G+A  +FS  FY+ + GYKM L +Y NG  TG    +S++F +++G  D  L+WP+   V   L+DQ +N   +++ F  D+     +  RP +E ++  G   F    KL      I DD I  +   ++
Sbjct:  135 IWRISDFTKKRQDAIAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGMSDALLKWPFNQKVTLMLLDQ-SNREHIIDAFRPDITSS--SFQRPVSEMNIASGCPLFCPLAKLEGKNSYIRDDTIFIKAIVDL 278          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 98.5969 bits (244), Expect = 3.728e-21
Identity = 49/147 (33.33%), Postives = 80/147 (54.42%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW +  F++ R+DA +G+A  +FS  FYS + GYKM L LY NG  TG    +S++F ++KG +D  L+WP+   V   L+DQ+ N   +++ F  D+     +  RP +E ++  G   F    KL+     + DD I  +   ++
Sbjct:  386 IWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN-NREHIIDAFRPDV--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 529          

HSP 2 Score: 97.8265 bits (242), Expect = 6.590e-21
Identity = 86/346 (24.86%), Postives = 141/346 (40.75%), Query Frame = 3
Query:  444 CGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQ--HLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQM---------KFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINN-QRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            CG   I   + +EH + C   +  C F  IGC+    VV N KQ  H  + I  H  L++         + S++ +     E +E +     R      P               K        + +LN   +    R+ L  E         + K+E + NK+   +R       QL +   +  + +   +   F W I  FS +R++A +G+   +FS  F S + GY++  +   NG G     +LS++  +MKG  D  L WPF   VT  +++Q +N  H       D+  +S  + RP    NI  G P F    +L  ++  + D+ I +K  V L G
Sbjct:  203 CGKKKIPREKFQEHTKSCAKSKSACQFREIGCRA---VVDNCKQQEHEQTSIMEHLRLMLAL-------LSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVE----RSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDV--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDLTG 531          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 98.5969 bits (244), Expect = 3.728e-21
Identity = 49/147 (33.33%), Postives = 80/147 (54.42%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW +  F++ R+DA +G+A  +FS  FYS + GYKM L LY NG  TG    +S++F ++KG +D  L+WP+   V   L+DQ+ N   +++ F  D+     +  RP +E ++  G   F    KL+     + DD I  +   ++
Sbjct:  386 IWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQN-NREHIIDAFRPDV--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 529          

HSP 2 Score: 97.8265 bits (242), Expect = 6.590e-21
Identity = 86/346 (24.86%), Postives = 141/346 (40.75%), Query Frame = 3
Query:  444 CGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQ--HLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQM---------KFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINN-QRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            CG   I   + +EH + C   +  C F  IGC+    VV N KQ  H  + I  H  L++         + S++ +     E +E +     R      P               K        + +LN   +    R+ L  E         + K+E + NK+   +R       QL +   +  + +   +   F W I  FS +R++A +G+   +FS  F S + GY++  +   NG G     +LS++  +MKG  D  L WPF   VT  +++Q +N  H       D+  +S  + RP    NI  G P F    +L  ++  + D+ I +K  V L G
Sbjct:  203 CGKKKIPREKFQEHTKSCAKSKSACQFREIGCRA---VVDNCKQQEHEQTSIMEHLRLMLAL-------LSSMRLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVE----RSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDV--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDLTG 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 100.138 bits (248), Expect = 1.249e-21
Identity = 57/158 (36.08%), Postives = 89/158 (56.33%), Query Frame = 3
Query: 1002 WTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKL 1451
            W I ++S K + AK    +E FS PF +H+ GY+L   A  NG+G+ E  YLS+YI ++ G  DN L WPF   VTFS+++Q    +   + +  T++  PN K + +PT  RN      +G G+P FIS +++  +   + DN I L+  V +  K+
Sbjct:  312 WKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKRN-YVRDNAIFLRASVEIPQKI 468          

HSP 2 Score: 91.6633 bits (226), Expect = 5.807e-19
Identity = 48/159 (30.19%), Postives = 84/159 (52.83%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPD-------HPNRNR-PFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+H+ GYK+ +  + NG  +G    +S+Y +++ G +D+ LEWP+   V F L+DQ     +     T+   PD        P  +R    E +LGFG+ KFIS E +      + D+ I  R + E+ +K
Sbjct:  310 LIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKR-NYVRDNAIFLRASVEIPQK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 98.5969 bits (244), Expect = 5.003e-21
Identity = 83/324 (25.62%), Postives = 143/324 (44.14%), Query Frame = 3
Query:  471 QMEEHIRICNNQRRFCPFINIGCQENNLVVL--NMKQHLL---SEIEVHSSLLMQWNENTKNE-----IDSIKNQVNEIKEIKEKINRN-----SRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKI---PIIRTILHNEENQISIYEFKTKVEEIVNKINNQRI--NNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE 1382
            Q+++H+  C      C F N GC   N++VL  ++  H L   +   V   L +Q N + K        D++K    E  +  +    N     S + L SY  K M     +L      L+    +++   PI+ T+   ++   ++  +K +++ +  +     +  +N++  Q+          +   +  +  W I ++  K+  A  G+   IFS  F +   GY+L  +A  NG G+ +  +LS+Y  +MKG  D+ LLWPFK  VT  +++Q     H   +   D  PNS  + RP    NI  G P F S  +LE
Sbjct:  199 QLDKHLCECPEAELQCTFSNYGC---NVMVLYHSLSVHFLYLCTFTSVSQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSM-----WLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHK-MQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLE 511          

HSP 2 Score: 91.2781 bits (225), Expect = 1.087e-18
Identity = 45/152 (29.61%), Postives = 80/152 (52.63%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS--MNPGLIVDDKIAFRVTTEV 1925
             K+IW + ++ + +++A  G+A+ IFS+ FY+   GY++    Y NG  +G    +S+YF ++KG  D  L WP+K  V   L+DQ      + + F  D  P+  +  RP +E ++  G  +F S  +L    N   I DD +  ++  ++
Sbjct:  383 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 532          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 96.2857 bits (238), Expect = 2.099e-20
Identity = 83/347 (23.92%), Postives = 147/347 (42.36%), Query Frame = 3
Query:  432 CPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVN------EIKEIKEKI-------------------NRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKI---PIIRTILHNEENQISIYEFKTKVEEIVNKINNQRI--NNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE 1382
            CP TC        ++++H+  C      C F N GC   N++V   K     +  +   +L   N N K E   +  Q N      +I+++ + +                   + +S + L SY  K M     +L      L+    +++   PI+ T+   ++   ++  +K +++ +  +     +  +N++  Q+          +   +  +  W I ++  K+  A  G+   IFS  F +   GY+L  +A  NG G+ +  +LS+Y  +MKG  D+ LLWPFK  VT  +++Q     H   +   D  PNS  + RP    NI  G P F S  +LE
Sbjct:  131 CPVTC-----PRAELDKHLCECPEAELQCTFSNYGC---NVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLGLQQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSM-----WLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHK-MQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLE 461          

HSP 2 Score: 90.5077 bits (223), Expect = 1.477e-18
Identity = 45/152 (29.61%), Postives = 80/152 (52.63%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS--MNPGLIVDDKIAFRVTTEV 1925
             K+IW + ++ + +++A  G+A+ IFS+ FY+   GY++    Y NG  +G    +S+YF ++KG  D  L WP+K  V   L+DQ      + + F  D  P+  +  RP +E ++  G  +F S  +L    N   I DD +  ++  ++
Sbjct:  333 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 482          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 96.2857 bits (238), Expect = 2.623e-20
Identity = 107/481 (22.25%), Postives = 184/481 (38.25%), Query Frame = 3
Query:  219 KCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEK-FCPGD-----------SDYCKRVLINF----DNNVFCD---------QPTNHRIARLRLKCPETCGDDFI--ELN------------------------------------QMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNE---------IDSIKNQVNEIKEIKEKINR----------------NSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKI---PIIRTILHNEENQISIYEFKTKVEEIVNKINNQRI--NNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE 1382
            KC  C  ++ N   + CG RFC  C+   +  SE   CP D            + CKR ++N      N+  CD         +     +  + L   + C D  I  EL                                     Q+++H+  C      C F N GC   N++V   K     +  +   +L   N N K E         +D  ++Q+ ++ +  +   +                +S + L SY  K M     +L      L+    +++   PI+ T+   ++   ++  +K +++ +  +     +  +N++  Q+          +   +  +  W I ++  K+  A  G+   IFS  F +   GY+L  +A  NG G+ +  +LS+Y  +MKG  D+ LLWPFK  VT  +++Q     H   +   D  PNS  + RP    NI  G P F S  +LE
Sbjct:   43 KCASCHLVLHNPHQTGCGHRFCEKCISNLIELSETPQCPIDMENIKSHEIFKDNCCKREVLNLLVYCKNSPACDVKVMLGRYQEHLGQCLYEMTLCSNDGCHDQMIRKELKGHLESECKLRQEACIYCKQTMSFNHENNYKKIFFSFQLDKHLCECPEAELQCTFSNYGC---NVMVKRGKVKEHEDTFLRDHMLYVLNRNMKLEEQVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSSTKTLASYIDKSM-----WLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLSTLEAYKDRIDNLDGQFKKHDVLLSNHK-MQMTSNEERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLE 512          

HSP 2 Score: 90.8929 bits (224), Expect = 1.624e-18
Identity = 45/152 (29.61%), Postives = 80/152 (52.63%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS--MNPGLIVDDKIAFRVTTEV 1925
             K+IW + ++ + +++A  G+A+ IFS+ FY+   GY++    Y NG  +G    +S+YF ++KG  D  L WP+K  V   L+DQ      + + F  D  P+  +  RP +E ++  G  +F S  +L    N   I DD +  ++  ++
Sbjct:  384 GKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHITDVFRAD--PNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVVDL 533          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 95.5153 bits (236), Expect = 3.610e-20
Identity = 50/147 (34.01%), Postives = 80/147 (54.42%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW +  F + R+DA +G+   +FS PFY+++ GYKM L +Y NG  TG N  +S++F ++KG +D  L WP+   V   L+DQ+ N   V++ F  D+     +  RP +E ++  G   F    KL      + DD I  +V  ++
Sbjct:  308 IWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQN-NREHVIDAFRPDV--SSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDL 451          

HSP 2 Score: 93.5893 bits (231), Expect = 1.459e-19
Identity = 55/170 (32.35%), Postives = 87/170 (51.18%), Query Frame = 3
Query:  936 QLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            +LE  +  SE +    +   F W I  F  KR++A +G+   +FS PF +++ GY++  +   NG G   N +LS++  +MKG+ND  L WPF   VT  +++Q +N  H       D+  +S  + RP    NI  G P F    +LE +   + D+ I +K  V L G
Sbjct:  290 ELETRMQESELS---TYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDV--SSSSFQRPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIVDLTG 453          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 110.153 bits (274), Expect = 8.887e-25
Identity = 82/365 (22.47%), Postives = 162/365 (44.38%), Query Frame = 3
Query:  426 LKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATK-------IPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            + CP  C    I   ++ EH+ +C    + CPF + GC        N+ +H  + ++ H  L+++ N   +  ++++      +  ++ K    +    + +    M   +    F +   + ++  K       +  +  I++ + +++ +      V+ +  +I     ++QR+   EG   + + H +   KA++++NE                W + ++  K+  A  G    +FS PF +   GY+L  +A  NG G+ +  +LS+Y  +M+G  D+ L WPF+  VT  +++Q     H   + T+   PNS  + RP    NI  G P F+S   LE ++   I D+ + LK  V L
Sbjct:  193 VSCPNRCVQT-IPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRG-NLLEHERAALQDHMLLVLEKNYQLEQRVNAL------LSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIH-KAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHI--VETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          

HSP 2 Score: 92.8189 bits (229), Expect = 3.227e-19
Identity = 45/152 (29.61%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1473 GNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGL-IVDDKIAFRVTTEV 1925
              K+IW V ++   +++A  G  + +FS+PFY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ      +V  F  D  P+  +  RP  E ++  G  +F+S   L  +    I DD +  +V  ++
Sbjct:  397 SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 110.153 bits (274), Expect = 8.887e-25
Identity = 82/365 (22.47%), Postives = 162/365 (44.38%), Query Frame = 3
Query:  426 LKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATK-------IPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            + CP  C    I   ++ EH+ +C    + CPF + GC        N+ +H  + ++ H  L+++ N   +  ++++      +  ++ K    +    + +    M   +    F +   + ++  K       +  +  I++ + +++ +      V+ +  +I     ++QR+   EG   + + H +   KA++++NE                W + ++  K+  A  G    +FS PF +   GY+L  +A  NG G+ +  +LS+Y  +M+G  D+ L WPF+  VT  +++Q     H   + T+   PNS  + RP    NI  G P F+S   LE ++   I D+ + LK  V L
Sbjct:  193 VSCPNRCVQT-IPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRG-NLLEHERAALQDHMLLVLEKNYQLEQRVNAL------LSSLERKKKMAAADSAIQHATNPMSRFQDIFSFLYRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIH-KAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHI--VETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          

HSP 2 Score: 92.8189 bits (229), Expect = 3.227e-19
Identity = 45/152 (29.61%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1473 GNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGL-IVDDKIAFRVTTEV 1925
              K+IW V ++   +++A  G  + +FS+PFY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ      +V  F  D  P+  +  RP  E ++  G  +F+S   L  +    I DD +  +V  ++
Sbjct:  397 SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 546          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 108.997 bits (271), Expect = 1.397e-24
Identity = 96/401 (23.94%), Postives = 160/401 (39.90%), Query Frame = 3
Query:  315 SEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLK-CP------ETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLM------QWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQ-----------NEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            +E+ CP  S  C+           C  P +H    +  + CP      + CG   I     ++H+R C+  R  C F  +GC E  +   N++ H L  +  H +LL+      Q +  T N++     Q  +I E K                           F   + +LN   +   +     + ++++     + K+E + NK+           QLE+ I   +   A++ Q             F W I +F+ KR+ A +G+   IFS  F +   GY++  +   NG G     +LS++  +MKG ND  L WPF   VT  +++  +N  H       D+   S  + RP    NI  G P F    ++E +   + D+ I +K  V L G
Sbjct:  152 TEQECPKRSLSCQH----------CRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEM-VETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQK------------------------IATFENIVCVLNREVERVAVTAEACSRQHRLD----QDKIEALSNKVQ----------QLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDV--TSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG 500          

HSP 2 Score: 98.2117 bits (243), Expect = 4.997e-21
Identity = 48/147 (32.65%), Postives = 79/147 (53.74%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW + +FT+ R++A +G+   IFS  FY+ R GYKM L +Y NG  TG    +S++F ++KGP+D  L+WP+   V   L+D H N   V++ F  D+     +  RP ++ ++  G   F    K+      + DD I  +   ++
Sbjct:  355 IWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLD-HNNREHVIDAFRPDVTSS--SFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 108.227 bits (269), Expect = 2.335e-24
Identity = 96/401 (23.94%), Postives = 160/401 (39.90%), Query Frame = 3
Query:  315 SEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLK-CP------ETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLM------QWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQ-----------NEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            +E+ CP  S  C+           C  P +H    +  + CP      + CG   I     ++H+R C+  R  C F  +GC E  +   N++ H L  +  H +LL+      Q +  T N++     Q  +I E K                           F   + +LN   +   +     + ++++     + K+E + NK+           QLE+ I   +   A++ Q             F W I +F+ KR+ A +G+   IFS  F +   GY++  +   NG G     +LS++  +MKG ND  L WPF   VT  +++  +N  H       D+   S  + RP    NI  G P F    ++E +   + D+ I +K  V L G
Sbjct:  159 TEQECPKRSLSCQH----------CRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEM-VETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQK------------------------IATFENIVCVLNREVERVAVTAEACSRQHRLD----QDKIEALSNKVQ----------QLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDV--TSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG 507          

HSP 2 Score: 98.2117 bits (243), Expect = 5.345e-21
Identity = 48/147 (32.65%), Postives = 79/147 (53.74%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW + +FT+ R++A +G+   IFS  FY+ R GYKM L +Y NG  TG    +S++F ++KGP+D  L+WP+   V   L+D H N   V++ F  D+     +  RP ++ ++  G   F    K+      + DD I  +   ++
Sbjct:  362 IWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLD-HNNREHVIDAFRPDVTSS--SFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 505          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 92.8189 bits (229), Expect = 1.267e-20
Identity = 61/224 (27.23%), Postives = 108/224 (48.21%), Query Frame = 3
Query:  828 ILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            I++ + +++ +      V+ +  +I     ++QR+   EG   + + H +   KA++++NE                W + ++  K+  A  G    +FS PF +   GY+L  +A  NG G+ +  +LS+Y  +M+G  D+ L WPF+  VT  +++Q     H   + T+   PNS  + RP    NI  G P F+S   LE ++   I D+ + LK  V L
Sbjct:   24 IVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIH-KAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHI--VETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          

HSP 2 Score: 90.5077 bits (223), Expect = 8.707e-20
Identity = 45/151 (29.80%), Postives = 79/151 (52.32%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGL-IVDDKIAFRVTTEV 1925
             K+IW V ++   +++A  G  + +FS+PFY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ      +V  F  D  P+  +  RP  E ++  G  +F+S   L  +    I DD +  +V  ++
Sbjct:   96 GKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 244          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 121.324 bits (303), Expect = 1.232e-27
Identity = 103/413 (24.94%), Postives = 190/413 (46.00%), Query Frame = 3
Query:  294 LKTYLNRSEKFCPGDSDYCKR--VLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEID----SIKNQVNEIKEIKEKINRNSR--RKLLSYFPKQMKFLKTFLVFTFYMLILNY-ATKIPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQ--KSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            LK +L+ S +F      YCK+  V+IN  N+        +      + CP  C    ++  +++EH+ +C    + CPF + GC   +    N++QH  S +  H  L+++ N   + +I     S++ + ++I+++ E I +  +  ++    F K   FL    VF  ++    +   ++  +  +++ ++N+  +      V+ +  KI     N+QR+   E    + + H +   KA++ +NE                W + ++  K+  A  G    IFS  F +   GY+L  +A  NG G+    +LS+Y  +M+G  D+ L WPF+  VT  +++Q  K N++      T+   PNS  + RP    NI  G P F++   LE  +   I D+ + LK  V L
Sbjct:  153 LKEHLSASCQFRKEKCLYCKKDVVVINLQNH------EENLCPEYPVFCPNNCAKIILK-TEVDEHLAVCPEAEQDCPFKHYGCAVTD-KRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHIDKSAWLEAQVHQLLQMVNQQQNKFDLRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHIN-IHKAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIME-----TFKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          

HSP 2 Score: 86.2705 bits (212), Expect = 2.785e-16
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLS-MNPGLIVDDKIAFRVTTEV 1925
             K+IW V ++   +++A  G  + IFS+ FY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ +    ++  F  D  P+  +  RP  E ++  G  +F++   L       I DD +  +V  ++
Sbjct:  404 GKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQ-SGKKNIMETFKPD--PNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAVDL 551          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 4.232e-25
Identity = 86/365 (23.56%), Postives = 168/365 (46.03%), Query Frame = 3
Query:  426 LKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEID----SIKNQVNEIKEIKEKINRNSR--RKLLSYFPKQMKFLKTFLVFTFYMLILNY-ATKIPIIRTILHNEENQISIYEFKTKVEEIVNKI-----NNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELE-TQTGLIVDNRIILKCKVHL 1439
            + CP  C    I   ++ EH+ +C    + CPF + GC        N+ +H  + ++ H  L+++ N   +  I     S++ + ++I+++ E + +  +  ++    F +   FL      T +     +   ++  +  I++ + +++ +      V+ +  +I     ++QR+   EG   + + H +   KA++++NE                W + ++  K+  A  G    +FS PF +   GY+L  +A  NG G+ +  +LS+Y  +M+G  D+ L WPF+  VT  +++Q     H   + T+   PNS  + RP    NI  G P F+S   LE ++   I D+ + LK  V L
Sbjct:  193 VSCPNRCVQT-IPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRG-NLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEKELKQFTQMFGRNGTFLSNVQALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHIN-IHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHI--VETFKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 552          

HSP 2 Score: 92.8189 bits (229), Expect = 2.075e-18
Identity = 45/152 (29.61%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1473 GNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGL-IVDDKIAFRVTTEV 1925
              K+IW V ++   +++A  G  + +FS+PFY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ      +V  F  D  P+  +  RP  E ++  G  +F+S   L  +    I DD +  +V  ++
Sbjct:  403 SGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVETFKAD--PNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAVDL 552          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|P39429|TRAF2_MOUSE (TNF receptor-associated factor 2 OS=Mus musculus OX=10090 GN=Traf2 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 9.772e-24
Identity = 96/401 (23.94%), Postives = 160/401 (39.90%), Query Frame = 3
Query:  315 SEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLK-CP------ETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLM------QWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQ-----------NEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            +E+ CP  S  C+           C  P +H    +  + CP      + CG   I     ++H+R C+  R  C F  +GC E  +   N++ H L  +  H +LL+      Q +  T N++     Q  +I E K                           F   + +LN   +   +     + ++++     + K+E + NK+           QLE+ I   +   A++ Q             F W I +F+ KR+ A +G+   IFS  F +   GY++  +   NG G     +LS++  +MKG ND  L WPF   VT  +++  +N  H       D+   S  + RP    NI  G P F    ++E +   + D+ I +K  V L G
Sbjct:  152 TEQECPKRSLSCQH----------CRAPCSHVDLEVHYEVCPKFPLTCDGCGKKKIPRETFQDHVRACSKCRVLCRFHTVGCSEM-VETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQK------------------------IATFENIVCVLNREVERVAVTAEACSRQHRLD----QDKIEALSNKVQ----------QLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDV--TSSSFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG 500          

HSP 2 Score: 98.2117 bits (243), Expect = 3.495e-20
Identity = 48/147 (32.65%), Postives = 79/147 (53.74%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW + +FT+ R++A +G+   IFS  FY+ R GYKM L +Y NG  TG    +S++F ++KGP+D  L+WP+   V   L+D H N   V++ F  D+     +  RP ++ ++  G   F    K+      + DD I  +   ++
Sbjct:  355 IWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLD-HNNREHVIDAFRPDVTSS--SFQRPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.892e-22
Identity = 84/356 (23.60%), Postives = 151/356 (42.42%), Query Frame = 3
Query:  390 DQPTNHRIA-RLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYAT-KIPIIRTILHNEE--NQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            D   +H +  +  L C + CG   I   + ++H++ C   R  C F  IGC E  +     ++H +  +  H ++L+      K  +    +  +E+ +  E + + +                    F   + +LN    ++ +       +   +Q  I    +KV+++   I    + +     LEQ++   E   A  +   F W I +F+ KR+ A +G++  IFS  F +   GY++  +   NG G     +LS++  +MKG ND  L WPF   VT  +++Q +N  H       D+   S  + RP    NI  G P F    ++E +   + D+ I +K  V L G
Sbjct:  174 DVKAHHEVCPKFPLTC-DGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLET-VEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKT------------------ATFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIG---LKDLAMADLEQKVLEME---ASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDV--TSSSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTG 500          

HSP 2 Score: 93.2041 bits (230), Expect = 1.222e-18
Identity = 47/147 (31.97%), Postives = 77/147 (52.38%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW + +F + R++A +G+   IFS  FY+ R GYKM L +Y NG  TG    +S++F ++KGP+D  L WP+   V   L+DQ+ N   V++ F  D+     +  RP  + ++  G   F    K+      + DD I  +   ++
Sbjct:  355 IWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQN-NREHVIDAFRPDVTSS--SFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDL 498          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6IWL4|TRAF6_DANRE (TNF receptor-associated factor 6 OS=Danio rerio OX=7955 GN=traf6 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 3.588e-20
Identity = 102/485 (21.03%), Postives = 211/485 (43.51%), Query Frame = 3
Query:  174 RNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVL---NMKQHLLSEI----EVHSSLLMQWNENTKN------------EIDSIKNQV------NEIKE----------IKEKINRNSRRKLLSYFPK-QMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQIS------------IYEFKTKVEEIVNKI--NNQRINNY---------EGYQLEQEIHTSEKT----KAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQAD-PNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNI-GVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            + Y+ E +  +    +C IC   + +A  +PCG RFC  C++  +  + + CP D++      +  +  +F D      I  L +KC      + +EL Q+E+H+  C      CP     CQE+  +     +  QH L  I    +   S +    +N +             E++ I++Q+      + +K            +EK+ RN   + +  F +  M+++  FL        LN  T +P     L +++   S            +   +  V E+  ++   +Q+I            +  +L +++ + E++    +A+ +Q  + W + NFS+   N ++G+   + S PF +   GY+L  +      S    + ++S+++  M+G  D+ L WP +  +  ++++Q     H + + T    P+ + + RPT  RN  G G+ +F+  + L  Q G + ++ ++++C+V
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCP----QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFL----RSQTLNNCT-MPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETK---PDLQAFQRPTVMRNPKGFGYVTFLHLQALR-QRGFVKEDVLLVRCEV 520          

HSP 2 Score: 62.3882 bits (150), Expect = 7.567e-9
Identity = 36/145 (24.83%), Postives = 70/145 (48.28%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTG-INEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSL-GFGFEKFISFEKLSMNPGLIVDDKIAFRV 1913
            +W V+NF+   ++ ++G+ + + S PFY+ R GYK+ L L+    +    +  +S++   ++G  D +L WP +  +   ++DQ      +    T    PD     RP   ++  GFG+  F+  + L    G + +D +  R 
Sbjct:  378 VWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIEVMETK---PDLQAFQRPTVMRNPKGFGYVTFLHLQALRQR-GFVKEDVLLVRC 518          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 170.244 bits (430), Expect = 1.567e-42
Identity = 134/473 (28.33%), Postives = 228/473 (48.20%), Query Frame = 3
Query:  147 RFENVWRILRNYNFE-VNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEI----DSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIR----TILHNEENQI-----SIYEFKTKVE------EIVNK--INNQRIN-NYEGYQLEQEIHTSEKTKAEMHQN-------------EFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLY-----LSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLP-NSKEWNRPTQFRN-IGVGFPSFISFKELETQTGLIVDNRIILKCKVH 1436
            + +NV  +L  YN + V+  ++ DL C +C K+M +AC S CGC +C  C++ YL+++  +CPGD   CK   +N + +VF +   + RI+R+ +KCP    +   EL +++EH+  C  +   CP + IGC+E  L+   M +HL  ++  H+ L+M +    K+EI    ++ K  ++ +KE+        ++ L      QM+FL   L     M IL  +  I  ++    T+L ++E+++      I  F+ ++E      E+V    I NQ  +   E + ++  I ++ + +     N             +F W I  +S KR       V +++SD F SH   + L             NLY     L ++  IMKG  D+ L WP +  VT SII Q S   H   +  YD    N K ++RP   RN   +G  S + +  ++    ++V++ II+ C VH
Sbjct:    5 KLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEV-----LRVQKALNDEKTAQMEFLIEELRNKDNM-ILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLNKLCPNVDMDFMWRIEEYSKKRRT-----VTDVYSDSFQSHNYKFCL-------------NLYIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVVH 453          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2B4SJ65 (TNF receptor-associated factor 4 OS=Stylophora pistillata OX=50429 GN=Traf4 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.282e-33
Identity = 111/433 (25.64%), Postives = 191/433 (44.11%), Query Frame = 3
Query:  177 NYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTI------LHNEENQISIYEFKTKVEEIV-------NKINNQRINNY----EGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWN--RPTQFRNIGVGFPSFISFKELETQTGLIVDNRII 1418
             Y+++  SEI  D  C IC   + NA  + CG RFC DCL  +  R+   CP D     R  ++ D +VF D+ +  RI    +KCP+ C        Q    +R     ++ CP++ + C  +N     M ++L+ E   H+++  QW          +  Q  + K                 +PK  + +       F +   N   ++     +       H  E+  S   F  K   ++       NK   +++++     E   L+      E  K++M    F W +  F +    AK G+  E+ SDPF + + GY+L    +PNG G+  N +LS ++ +M+G +D  L WPF   VTF++++Q+ ++   + ++ +    N+K  N  RPT   N G G+  F+S ++L T+  L+ D   I
Sbjct:   13 GYDYDFVSEIDEDFICQICHLPLRNAVLTRCGHRFCVDCLNEHFRRNSPNCPLD-----REKLDKDKDVFPDKASQRRILSYLIKCPDKC--------QWVGELRDVEGHKKKCPYVIVQCPNHN-CHERMARNLVEE---HAAVTCQWR--------MVSCQFCQKK-----------------YPKAEEHIHCETCHMFPLNCSNGCEQVVPREQVERRNLETHIHEDTTSHLGFACKKLAVLQQEFNKENKTLKKQLDDVKKENENLLLKASAQEKEMQKSKMETPTFVWKVTGFDDILRQAKHGRNNEMDSDPFYTGKYGYKLKLSVNPNGDGSGRNTHLSAFVIVMRGEHDGILPWPFNHKVTFTLVDQQESLDERENVVMH-FRANTKLENFARPTAEENPGRGYARFVSHEKLRTRRYLVDDTLFI 402          

HSP 2 Score: 85.5001 bits (210), Expect = 6.115e-14
Identity = 48/146 (32.88%), Postives = 79/146 (54.11%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPA---VVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRV 1913
            +W V  F  + + A+ G+  ++ S+PFY+ + GYK+ L + PNG  +G N  +S +  +++G HD  L WP+   V F L+DQ  +      VV  F  +   +  N  RP  E++ G G+ +F+S EKL      +VDD +  +V
Sbjct:  262 VWKVTGFDDILRQAKHGRNNEMDSDPFYTGKYGYKLKLSVNPNGDGSGRNTHLSAFVIVMRGEHDGILPWPFNHKVTFTLVDQQESLDERENVVMHFRANTKLE--NFARPTAEENPGRGYARFVSHEKLRTR-RYLVDDTLFIQV 404          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 1.310e-32
Identity = 64/177 (36.16%), Postives = 105/177 (59.32%), Query Frame = 3
Query:  153 ENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKE 683
            E + R+L  YNFEV   +  +LKC +CK +++NAC S CGCRFCS C+  Y++R   +CPG +  CK   +   +N+  D   N +IA++R+KCPE     + EL  +EEH+R+C  + + CPF  +GC +  +V+ ++  HL +    HS L++    N +N+   +  +  E++E
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELRE 180          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3M6TEQ9 (Uncharacterized protein (Fragment) OS=Pocillopora damicornis OX=46731 GN=pdam_00013439 PE=4 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.935e-31
Identity = 118/441 (26.76%), Postives = 205/441 (46.49%), Query Frame = 3
Query:  177 NYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKF-CPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWN--------ENTKNEIDSIKNQVNEIKEIK-----EKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVN-------KINNQRINNY--EGYQLEQEIHTSEKT--KAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWN--RPTQFRNIGVGFPSFISFKELETQTGLIVDNRII 1418
             Y+++  +E+  D  C IC+  + NA  + CG RFC DCL  +  R +   CP D     R  ++ D ++F D+ +  RI    +KCP  C        Q E  +R   N ++ CP+  + C  +N  V  + ++L   IE H ++  QW         E      + I N+   +  +      E++    R ++L +   + +   T +   F+ L  N   +   + T  H  E+  +   F  K   ++        K   +++++   E   L  ++   EK   K++M    F W I  F +    AK G+  +I SDPF + + GY+L    +PNG G+  N +LS ++ +M+G +D  L WPF   VTF++I+Q+ ++   ++ +T     N+K  N  RPT   N G G+  F+S ++L+T+  L+ D   I
Sbjct:   21 GYDYDFVTELDEDFVCQICQLPLRNAVLTRCGHRFCHDCLNEHFKRIQHPNCPLD-----RTRLDKDKDIFPDKASERRILSYFVKCPNRC--------QWEGELRDVENHQQICPYEVVQCPSSNCRVF-LARNL---IEEHVAVSCQWRIVSCQFCPEKYPKAEEDIHNETCPMFPLNCSNGCEQVV--PREQMLKHLETECRL--TPVSCPFHDLGCNMKVERRNLET--HVREDTTTHLSFACKKLALLQQEFDEEKKTLKKQLDDLKKENNNLLLKVSAQEKEMHKSQMETPMFVWKITGFGDILHQAKVGRNNKIDSDPFYTGKYGYKLKLSVNPNGDGSGRNTHLSAFVIVMRGEHDAILPWPFNQKVTFTLIDQQESL-DERQNVTMLFRANTKLENFARPTAEENPGRGYARFMSHEKLKTRRYLVDDTLFI 437          

HSP 2 Score: 81.2629 bits (199), Expect = 1.787e-12
Identity = 47/146 (32.19%), Postives = 77/146 (52.74%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPA---VVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRV 1913
            +W +  F  +   A+ G+  +I S+PFY+ + GYK+ L + PNG  +G N  +S +  +++G HD  L WP+   V F L+DQ  +      V   F  +   +  N  RP  E++ G G+ +F+S EKL      +VDD +  +V
Sbjct:  297 VWKITGFGDILHQAKVGRNNKIDSDPFYTGKYGYKLKLSVNPNGDGSGRNTHLSAFVIVMRGEHDAILPWPFNQKVTFTLIDQQESLDERQNVTMLFRANTKLE--NFARPTAEENPGRGYARFMSHEKLKTR-RYLVDDTLFIQV 439          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A485MBY1 (TNF receptor-associated factor OS=Lynx pardinus OX=191816 GN=LYPA_23C013043 PE=3 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 7.634e-30
Identity = 118/463 (25.49%), Postives = 212/463 (45.79%), Query Frame = 3
Query:  219 KCTICKKIMINACNSPCGCRFCSDCLKTY--LNRSEKFCPGDSDY-----------CKRVLINFDNNVFC-DQPT-NHRIARLRLK------CPE---TCGDDFIEL---NQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEID----SIKNQVNEIKEIKEKINRNSR--RKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEI--------VNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNE--------------FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELET-QTGLIVDNRIILKCKVHL 1439
            KC  C  ++ N   + CG RFC  C+ +   LN +   CP D +            CKR ++N    V+C + P+ N +I   R +      CPE   +C +  +++   ++++EH+ +C    + CPF + GC   +    N+ +H  S +  H  L+++ N   + +I     S++ + ++I+++ E + +  +  ++      K   FL    +     LI   A     +R +L     Q + ++ +  VE I        + + N+QR+   EG   + + H +   KA++++NE                W + ++  K+  A  G    IFS PF +   GY+L  +A  NG G+ +  +LS+Y  +M+G  D+ L WPF+  VT  +++Q     H   + T+   PNS  + RP    NI  G P F++   LE+ +   I D+ + LK  V L
Sbjct:   44 KCAFCHSVLHNPHQTGCGHRFCQHCILSLRELN-AVPLCPVDKEVIKSQEVFKDNCCKREVLNL--YVYCKNAPSCNAKIILGRYQNHEENLCPEYPVSCPNKCLQMIPRSEVDEHLAVCPEAEQDCPFKHYGCTVKDKRG-NLLEHEHSALRDHMLLVLEKNFQLEEQISDLYKSLEQKESKIQQLAETVKKFEKEFKQFAQLLGKNGSFLSN--IQALASLIDKSAWLEAQVRQLLQVANQQQNKFDLRPLVEAIDTVKQKITLLETNDQRLVVLEGETNKHDAHIN-IHKAQLNKNEERFKLLEGACYNGKLIWKVTDYKTKKREALDGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHI--METFKADPNSSSFKRPDGEMNIASGCPRFVAHSTLESAKNTYIKDDTVFLKVAVDL 497          

HSP 2 Score: 93.2041 bits (230), Expect = 4.000e-16
Identity = 45/151 (29.80%), Postives = 79/151 (52.32%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKL-SMNPGLIVDDKIAFRVTTEV 1925
             K+IW V ++   +++A  G  + IFS+PFY+ R GY++    Y NG  +G    +S+YF +++G  D  L+WP++  V   L+DQ      ++  F  D  P+  +  RP  E ++  G  +F++   L S     I DD +  +V  ++
Sbjct:  349 GKLIWKVTDYKTKKREALDGHTVSIFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIMETFKAD--PNSSSFKRPDGEMNIASGCPRFVAHSTLESAKNTYIKDDTVFLKVAVDL 497          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 104.375 bits (259), Expect = 4.710e-23
Identity = 82/367 (22.34%), Postives = 166/367 (45.23%), Query Frame = 3
Query:  426 LKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKN----QVNEIKE-------IKEKINR------------NSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKI--NNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELET--QTGLIVDNRIILKCKVHLDG 1445
            ++CP  C    ++ +++++H   C  Q   C +   GC   N     +K H  +E   H  LL++ N     ++D ++     Q  E+KE       +K ++++              +R+L+S   +++K L+  L             ++  +R  L +   Q+++ +   +    + +   ++ R+ +    QL+      ++ ++  +  +  W +H++  K+E   +     + S PF +  +GY+L  +    G G     +LS+Y+ +M+G  D+ L WPF+ NVT ++++Q  N  H     T D+  N+  + RPT   N  +GFP FI+  +LE       + D+ + +K KV   G
Sbjct:  195 VQCPNKC-IHLVKRHKLKDHADECPEQETDCIYKKYGCTVRNKRG-QVKVHEQTEFNHHVLLLLESNSKLIKQVDQLQQDFAAQQGELKERNLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLT------KEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKEAGTA-----LNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNN--FRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVDTTG 546          

HSP 2 Score: 84.7297 bits (208), Expect = 9.507e-17
Identity = 47/152 (30.92%), Postives = 75/152 (49.34%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSM--NPGLIVDDKIAFRVTTEV 1925
             K+IW V ++    +  ++G AL   S PFY+  +GYK+   +Y  G  T     +S+Y  +++G  D  L WP++ NV   ++DQ  N   V   FT DL  +  N  RP +E +   GF +FI+   L    N   + DD +  +V  + 
Sbjct:  400 GKLIWKVHDY---HRKKEAGTALN--SPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASN--NFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVDT 544          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 102.834 bits (255), Expect = 1.190e-22
Identity = 93/394 (23.60%), Postives = 160/394 (40.61%), Query Frame = 3
Query:  318 EKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIA-RLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQH----------------LLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINN-QRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            E+ C   +  CK   + F    F D   +  I  +  ++C + CG   I   +  EH + C   +  C F  IGC+    VV N KQH                +LS + V S    +W E++   +     +  E                     ++M  L+  +       +LN   +  ++R      + Q+     + K+E + NK+   +R       QL +      + +   +   F W I +FS +R++A +G+   +FS  F S + GY++  +   NG G     +LS++  +M+G  D  L WPF   VT  +++Q +N  H       D+  +S  + RP    NI  G P F    +L  ++  + D+ I +K  V L G
Sbjct:  161 ERECEARTLNCKYCKVTFS---FKDIKAHDEICQKFPMQCKD-CGKKKIPREKFAEHSKSCAKSKSACQFSEIGCRA---VVDNGKQHEHEQSSIIEHLRLMLAVLSTVRVRSDGPGEWQEDSGLGL----YRGPEDAAPPGAHAAAHNAAGGPGVQQKMTALENIVC------VLNREVERTVLRLEALTRQQQLD----QEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDI--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDLTG 530          

HSP 2 Score: 98.2117 bits (243), Expect = 3.724e-21
Identity = 47/147 (31.97%), Postives = 81/147 (55.10%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            +W + +F++ R+DA +G+A  +FS  FYS + GYKM L LY NG  TG    +S++F +++G +D  L+WP+   V   L+DQ+ N   +++ F  D+     +  RP +E ++  G   F    KL+     + DD I  +   ++
Sbjct:  385 VWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQN-NREHIIDAFRPDI--SSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIVDL 528          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 101.293 bits (251), Expect = 3.236e-22
Identity = 59/164 (35.98%), Postives = 89/164 (54.27%), Query Frame = 3
Query:  984 HQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKL 1451
            H     W ++++S K + AK    +E FS PF +H  GY+L   A  NG+G+ E  +LSIYI ++ G  DN L WPF   VTFSI++Q    +   + +  T++  PN K + +P+  RN      +G G+P FIS  E+  +   I DN I LK  + +  K+
Sbjct:  306 HDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIRKRN-YIRDNAIFLKASIEIPQKI 468          

HSP 2 Score: 89.3521 bits (220), Expect = 2.363e-18
Identity = 48/159 (30.19%), Postives = 86/159 (54.09%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPD-------HPNRNR-PFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+HR GYK+ +  + NG  +G    +SIY +++ G +D+ LEWP+   V F ++DQ     +     T+   PD        P+ +R    E +LGFG+ KFIS +++      I D+ I  + + E+ +K
Sbjct:  310 LIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIRKR-NYIRDNAIFLKASIEIPQK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 94.7449 bits (234), Expect = 4.374e-20
Identity = 100/460 (21.74%), Postives = 202/460 (43.91%), Query Frame = 3
Query:  174 RNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNEN---------TKNEIDSIKNQVN---EIKEIKEKINRNSRRKLLSYFPK-QMKFLKTFLV-FTFYMLILNY------------ATKIPIIRTILHNEENQI--SIYEFKTKVEEIVNKINNQRINN----YEGYQLEQEIHTSEKT----KAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQ---ADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNI-GVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            + Y+ + +  +    +C IC   + +A  +PCG RFC+ C++  +  + + CP D++      +  ++ +F D      I  L ++C      + +EL  +E HI  C      CP     CQE+ +    +++H+  E            EN         +  + D +K  V     I   +EK+ RN     +  F +  M+++   L   T   LI ++            A+  P      + E  Q+  ++ E ++++    +K+    I N     +  +L +++ + E++    +A+ +Q  + W +  FS    N ++G    + S PF +   GY+L  +     PN        Y+S+++  M+G  D+ L WP +  +  ++++Q     H + + T    P+ + + RPT  RN  G G+ +F+  + L  Q G + D+ ++++C+V
Sbjct:   54 QGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE------VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCP----QCQES-VWKSELEEHINQECSHRLITCPDCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSN--YISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETK---PDLQAFQRPTVQRNPKGFGYVTFMQLQALH-QRGFVRDDVLMVRCEV 496          

HSP 2 Score: 63.929 bits (154), Expect = 2.733e-10
Identity = 37/144 (25.69%), Postives = 69/144 (47.92%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTG-INEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSL-GFGFEKFISFEKLSMNPGLIVDDKIAFR 1910
            +W ++ F+   ++ ++G  + + S PFY+ R GYK+ L L+    N    +  +S++   ++G  D +L WP +  +   ++DQ      V    T    PD     RP  +++  GFG+  F+  + L    G + DD +  R
Sbjct:  354 VWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETK---PDLQAFQRPTVQRNPKGFGYVTFMQLQALHQR-GFVRDDVLMVR 493          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 93.9745 bits (232), Expect = 9.637e-20
Identity = 102/479 (21.29%), Postives = 208/479 (43.42%), Query Frame = 3
Query:  174 RNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCP-------------FINIGCQENNLVVLNMKQHLL-SEIEVHSSLLMQWN--------ENTKNEI------DSIKNQVN---EIKEIKEKINRNSRRKLLSYFPK-QMKFLKTFLV-FTFYMLILNY------------ATKIPIIRTILHNEENQI--SIYEFKTKVEEIVNKINNQRINN----YEGYQLEQEIHTSEKT----KAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQ---ADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNI-GVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            + Y+ + +  +    +C IC   + +A  +PCG RFC+ C++  +  + + CP D++      +  ++ +F D      I  L ++C      + +EL  +E HI  C      CP              IN  C    +   +  ++++ +E + H  L +  N        E  +N++      D +K  V     I   +EK+ RN     +  F +  M+++   L   T   LI ++            A+  P      + E  Q+  ++ E ++++    +K+    I N     +  +L +++ + E++    +A+ +Q  + W +  FS    N ++G    + S PF +   GY+L  +     PN        Y+S+++  M+G  D+ L WP +  +  ++++Q     H + + T    P+ + + RPT  RN  G G+ +F+  + L  Q G + D+ ++++C+V
Sbjct:   54 QGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVDNE------VLTEDQLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQFHEQLCLFANTVCEYCNMELIRNQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSN--YISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETK---PDLQAFQRPTVQRNPKGFGYVTFMQLQALH-QRGFVRDDVLMVRCEV 520          

HSP 2 Score: 64.3142 bits (155), Expect = 2.065e-10
Identity = 37/145 (25.52%), Postives = 69/145 (47.59%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTG-INEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSL-GFGFEKFISFEKLSMNPGLIVDDKIAFRV 1913
            +W ++ F+   ++ ++G  + + S PFY+ R GYK+ L L+    N    +  +S++   ++G  D +L WP +  +   ++DQ      V    T    PD     RP  +++  GFG+  F+  + L    G + DD +  R 
Sbjct:  378 VWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETK---PDLQAFQRPTVQRNPKGFGYVTFMQLQALHQR-GFVRDDVLMVRC 518          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.775 bits (286), Expect = 1.319e-27
Identity = 86/395 (21.77%), Postives = 168/395 (42.53%), Query Frame = 3
Query:  300 TYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRR--KLLSYFPKQMKFLKTFLVFTFYMLI--------LNYATKIP-------IIRTILHNEENQISIYEFK----TKVEEIVNKINNQRINNYEGYQLEQEIHTSEKT----KAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDN 1409
            T L      CP  +++CK        ++  ++      A+  L CP  C +  I   ++ +H+  C    + C F  +GC        ++++H  S +  H +L++  N   + +   ++  + +   + E + +   +  + LS++        T L  T  ML         L+ A + P        +R  +     ++   E         EE  + ++ QR+  ++G      + T+E+     +   +  +  W I +++ +++ A SG+   ++S PF +   GY++  +A  NG G     +LS++  +M+G  D  L WPF+  VT S+++Q +   H     T D  P S  + RP    N+  G P F+S   LE  + L+ D 
Sbjct:   20 TRLAAHRASCPHRAEFCKYCSAAVTCSLL-ERHHKEECAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRLGSTLEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCH-MHEQRLTMHDGL-----LDTAERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPD--PASGSFRRPDGDMNVASGCPLFVSHVALEGSSYLVDDT 405          

HSP 2 Score: 97.0561 bits (240), Expect = 9.007e-22
Identity = 45/149 (30.20%), Postives = 80/149 (53.69%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTE 1922
             K++W ++++ + +++A SG+ L ++S+PFY+   GYKM    Y NG   G    +S++F +++G +D  LEWP++  V   L+DQ      + + FT D  P   +  RP  + ++  G   F+S   L      +VDD +  RV  +
Sbjct:  268 GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDTFTPD--PASGSFRRPDGDMNVASGCPLFVSHVALE-GSSYLVDDTVFVRVVVD 413          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.834 bits (255), Expect = 2.120e-23
Identity = 84/377 (22.28%), Postives = 165/377 (43.77%), Query Frame = 3
Query:  408 RIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSR---RKLLSYFPKQMK-------FLKTFLVFTFYMLILNYATKIPIIRTILHN------EENQISIYEFKTKVEEI-------VNKINNQRINNYEGY--QLEQEIHTSEKTKAEM-----------HQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILK 1424
            R  R  + CP  C +  I   ++  H+ IC  ++  C F   GC+     +  +K+H     + H SL+   + N + ++  +++Q+ E     + +    R   ++L+S      K         +   V T  +L L  + +    R   H+      +    +++E  T+V  I        +     R+   +    + + ++   +   AEM           +  +  W I +++ ++++A SG+   ++S PF +   GY++  +A  NG G     +LS++  +M+G  D  L WPF+  VT ++++Q +    ++R L  T+   P S  + RPT   NI  G P F+S   LE+ +  + D+ I +K
Sbjct:   97 RCPRYPIPCPNKCEEQSIAREELVSHLGICPYKQAECFFSQFGCKYKG-TLQGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKELISVGQTASKNESVLCVVQRMLAVQTERLLRLQESMQ-GTTRRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGA----ARRQLSDTFKPDPASSSFRRPTSDMNIASGCPLFVSHVALESAS-YLQDDTIFIK 466          

HSP 2 Score: 92.0485 bits (227), Expect = 6.389e-20
Identity = 42/150 (28.00%), Postives = 79/150 (52.67%), Query Frame = 3
Query: 1476 NKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
             K++W ++++ + ++DA SG+ L ++S+PFY+   GY+M    Y NG   G    +S++F +++G +D  L WP++  V   L+DQ      + + F  D  P   +  RP ++ ++  G   F+S   L  +   + DD I  +V  + 
Sbjct:  325 GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDTFKPD--PASSSFRRPTSDMNIASGCPLFVSHVALE-SASYLQDDTIFIKVVVDT 471          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 60.4622 bits (145), Expect = 8.483e-10
Identity = 72/362 (19.89%), Postives = 152/362 (41.99%), Query Frame = 3
Query:  444 CGDDFIELNQMEEHIRI-CNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKF-LKTFLVF----TFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTS-EKTKAEMHQNEFTWTIHNFSNKRENA-KSGKVYE---------IFSDPFLSHENGYQLMFQAD-------PNGSGNYENL------YLSIYICIMKGSNDNNLLWPFKLNVTFSIINQ-KSNMVHSKRLLTYDMLPNSKEWNRPTQFRNI-GVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            C  + I   Q+  H+ + C   +  C F  +GC E  +V   +  H+    +VH  LL        N +  ++ QV +  +       ++    LS+        ++T        +      + A ++  +R I    E ++ +   +  + E+  K +NQ+    E  +L + +     ++++ +    FTW +  FS        SG   +         + S  F +   GY+L  +         P G+ +   L      +L++++ +++G  D+ L WPFK  +  S+++Q + + VH   ++  D  P    + RP+  RN  G G+ +F+    L  ++  + D+ ++++C+V
Sbjct:  215 CQQELIR-EQLGPHLEVDCQQAQVPCTFSPLGC-EAQMVRSLLAAHMHEHTQVHMRLL-------ANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQ--IRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDSVHVTEMMDAD--PQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRS-YLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 112.849 bits (281), Expect = 2.334e-26
Identity = 107/421 (25.42%), Postives = 179/421 (42.52%), Query Frame = 3
Query:  327 CPGDSDYCKRVLINFD--------------NNVFC--DQPTNHRIARLR------LKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVN------------------EIKEIKEKIN-RNSRRKLLSYFPKQMK--FLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTK------------AEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILK 1424
            C   SD C  +++ F                 V+C  D P    I  L+      ++CP  CG   IE  ++  H R C N    C F  +GC    +  + +++H    +  H  LL +     +  +  ++NQ+                   E  ++KE+ N +N+R  ++       K    + ++ F    L+     +  + +  +  + N+  +     ++E   +   N    N    QLE  I T  KTK            A  +   F W I  F+ +   AKSG    I+S PF +H  GY+L  +  PNG G+  + YLSI+I +M+G  D+ L WPF+  +T ++I+Q + M  S+   T+D  P S  + RPT+  N+  G P F S   L T+ G + +N + +K
Sbjct:  106 CIHASDGCGEIMLRFQLAKHVEKECPFRLITCVYCQNDVPERTLIEHLKKCPAFPIECPNECGVKRIERKKLSAHTRECPNALTDCRFSPLGCT-YKVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSI-TIHKTKLFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDNGMNISE---TFDPDPCSISFQRPTRNINVASGCPRFCSQTVLRTR-GYMNENCVFVK 520          

HSP 2 Score: 81.6481 bits (200), Expect = 2.833e-16
Identity = 40/123 (32.52%), Postives = 66/123 (53.66%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFIS 1853
            +W +  FT+   +A+SG A  I+S PFY+HR GYK+   L+PNG  +  +  +SI+  +++G +D  L WP++  +   L+DQ  N   +   F  D  P   +  RP    ++  G  +F S
Sbjct:  383 LWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQ-DNGMNISETFDPD--PCSISFQRPTRNINVASGCPRFCS 502          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 99.3673 bits (246), Expect = 4.982e-22
Identity = 112/473 (23.68%), Postives = 200/473 (42.28%), Query Frame = 3
Query:  177 NYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNR-SEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLIL-----------------NYATKIPII----------RTILHN---EENQISIY-----EFKTKVEEIVNKINNQRINNYEGYQLEQ---EIHTSEKTKAEMHQ--------NE-----FTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNS--KEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
             Y+ E    ++ +  C IC   +     + CG RFC +CL     R S   CP D     R  ++   +VF D+     I    +KCP        EL  +E H R C+ +   C   N  C    L  +++ +HLL E +    +     + +   +     Q    +    K+   S     +  P+ M   +  LV   + LI+                 N   K P++          R  L +   EE Q ++      +F  +V EI N++ +Q ++      L     ++  S  + A+ H+        NE     F W I +F++    AK G    + S+PF + +NGY+L     PNG+ + +N ++S ++ I +G  D  L WPF   +  ++++QK N++  +R +   ++PN   + ++RP    N G G  +F+S ++L T+   +VD  + ++ +V
Sbjct:   10 GYDSEFVIAVAEEYTCRICHLPLRVPVQTKCGHRFCKECLDEASRRKSRAECPMD-----REPLDLKKDVFLDKAAERTILSFLVKCPCKGCKWEAELRDLEAHARNCDYELVTCS--NPMCSA-QLPRMDVDEHLLVECDWRLIVCEYCGDESPYCL-----QKAHARNCDYKLVTCSNPMCSAQLPR-MDVDEHLLVECDWRLIVCEYCGDESPYCLQKDHSNQCDKFPVLCPNDCGTQITREKLRDHQSEECQFAVVPCAFRDFGCEV-EIQNRLMDQHLDTNIQSHLNMTCNQLLLSRDSGAQFHELQQGLGRVNELLKMRFVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKENVLQ-RRNVEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKLWTEN-YVVDGTLFMQVEV 465          

HSP 2 Score: 79.337 bits (194), Expect = 1.098e-15
Identity = 43/131 (32.82%), Postives = 70/131 (53.44%), Query Frame = 3
Query: 1479 KIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHP--NRNRPFTEKSLGFGFEKFISFEKL 1865
            + +W + +F    + A+ G  +++ SEPF++ +NGYK+   LYPNG  +G N  +S +  I +G +D  L WP+   +   L+DQ  N     N     ++P+    N +RP T  + G G   F+S EKL
Sbjct:  319 RFVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKENVLQRRN-VEKTIIPNPSLENFHRPKTVSNNGRGSATFVSHEKL 448          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 94.7449 bits (234), Expect = 2.100e-20
Identity = 92/411 (22.38%), Postives = 171/411 (41.61%), Query Frame = 3
Query:  294 LKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEH-IRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRN--SRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINN-----------------QRINNYEGYQLE-QEIHTSEKT------KAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            L+ +L R E F P D  YC + +              H +      CP  CG + I  +++  H   IC      C F   GC         ++ H   +  VH +LL+   +N +     +  +++++++ + K       +R+ L+   + ++  +  L       +     ++  ++  +  +E + +I E   ++  I N+ +                  +R  +   +QL   +I  +E        +A  +   + W I  ++ + +   SGK   I+S PF     GY+   +  PNG G  +  +LS++  +M+G  D  L WPF+  VTF +++Q  + VH     T+   P S  + RPT   NI  G P FIS   L+T+   + D+ + +K  V   G
Sbjct:  128 LEAHLERCE-FKPSDCQYCLQRIPAASMEDHLQTCEKHPVV-----CPH-CGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKG-TREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKL-NVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ--DRVHDIG-DTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRA-YVRDDTMFIKIAVDTTG 525          

HSP 2 Score: 84.3445 bits (207), Expect = 4.041e-17
Identity = 45/149 (30.20%), Postives = 73/149 (48.99%), Query Frame = 3
Query: 1485 IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRN--RPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            IW +  +T+  ++  SGK   I+S PFY  R GYK    +YPNG   G    +S++F +++G  D  L WP++  V F+L+DQ       V+   D   PD  + +  RP +  ++  G   FIS   L      + DD +  ++  + 
Sbjct:  381 IWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDR-----VHDIGDTFRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTR-AYVRDDTMFIKIAVDT 523          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 94.3597 bits (233), Expect = 2.243e-20
Identity = 106/466 (22.75%), Postives = 189/466 (40.56%), Query Frame = 3
Query:  231 CKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKC---PETCGDDFIELNQMEEHIRICNNQRRFCPFINIG---------------CQ---------ENNLVVLNMKQHL-----------------LSEIEVHSSLL-----MQWNENTKNEIDSIKNQVNEIKEIKEK-------------INRNSRRKLLSYFPKQMKFLKT------FLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILK 1424
            C+ I+ +A  + CG R+CS C+   L+R     P   D C   +   +   F D+  +  I  L + C   P  C  +  EL   + H   C      C     G               CQ         E  +VV  MK+H                  L  +EVHS+       ++     +N ++ +++  + IK+++++             I+ N   + +    +++  ++        LV   +  +     ++  +   L   ++ I   E + ++ +    + N  I +     LE+ ++T + T  +   +   W I N +NKR  A SG+V   +S  F +  +GY++  +   NG G   N ++S++  IM+G  D  L WPF+  VT  +++Q  N+ H       D  P+S  + RP    NI  G P F S ++L TQ   I D+ + LK
Sbjct:   27 CRLIVKDAVQTACGHRYCSPCISPLLSRG----PIQCDVCGSTITKPET--FRDKFADREILELHVHCVNQPHGCPWEG-ELRHRQNHHTKCEFNPISCVHPECGKKLSVAKLPEHLQNECQYREETCSYCEQPVVVARMKEHHEKTCPSYPVNCPKCSKELIRVEVHSTPFTREPRLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIAD-----LEERLNTLQGTTFD---SVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQ-DNVEHVIDAFRPD--PSSSSFQRPRAEMNIASGCPLFCSHEQL-TQHAYIRDDTMFLK 473          

HSP 2 Score: 85.5001 bits (210), Expect = 1.259e-17
Identity = 46/147 (31.29%), Postives = 75/147 (51.02%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTE 1922
            ++W + N    R +A SG+    +S  F++  +GYKM   +Y NG   G N  VS++F I++G  D  L WP++  V   L+DQ  N   V++ F  D  P   +  RP  E ++  G   F S E+L+ +   I DD +  ++  +
Sbjct:  335 LLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQ-DNVEHVIDAFRPD--PSSSSFQRPRAEMNIASGCPLFCSHEQLTQH-AYIRDDTMFLKIIVD 477          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 93.5893 bits (231), Expect = 3.838e-20
Identity = 108/465 (23.23%), Postives = 197/465 (42.37%), Query Frame = 3
Query:  126 PSSMESI-RFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCP--------------FINIGCQENNLVVLNMKQHL-LSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKI-NRN---------SRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDML--PNSKEWNRPTQFRN-IGVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            P+S+  I ++    R+   Y+   +  +    +C IC   + +   +PCG RFC +C++  +  +   CP D+       +  DN  F  +     I   RLK    C      L ++EEH++ C      CP                   C   ++   + K  + +S+IE H       + N  NE  ++  +    K   E   NR+         S ++  S+ P++    +  L         N   ++ ++ +   +E  Q   Y  + KVE+ V   +++RI       +  E    E  +  +    F W + NF   RE + +G    I S PF +   GY++  + + NG       ++S++I +M+G  D  L WPF   +T SI++Q S+ + S+R ++  ++  PN   + RPT  RN  G G+  F    +L T+   I +N I+++ ++
Sbjct:   25 PASLPFINQYGGPQRLEEGYDEFFDPPLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPKCPVDNTPLSERELYRDN--FAKREMMSFIVWCRLKKERGCTWKGA-LKELEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVTISKIEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKSSKEQASHGPQEHTPHEAELRREALFQSANMQREVDMLGS-RGDEYRQFLAY-LERKVED-VKTSSDRRIAELTHKLMRLETREIE-LEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQ-SDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQL-TEGQYIKNNSILVRIQI 480          

HSP 2 Score: 78.9518 bits (193), Expect = 1.626e-15
Identity = 43/151 (28.48%), Postives = 78/151 (51.66%), Query Frame = 3
Query: 1428 KVHLDGKLANTLHENGNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNR---NRPFTEKS-LGFGFEKFISFEKLS 1868
            ++ L+G++ N         IW + NF Q R+ + +G    I S PFY+   GYKM L +  NG++ G+ E VS++  +++G  D  LEWP+   +   ++DQ     +   +   + L   PN     RP + ++  G+G+ +F   ++L+
Sbjct:  322 EIELEGRVCN------GTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDS--RRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLT 464          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 103.219 bits (256), Expect = 5.760e-23
Identity = 96/418 (22.97%), Postives = 177/418 (42.34%), Query Frame = 3
Query:  222 CTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKC-PETCG-DDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRN-----SRRKLLSYFPKQMKFL-----KTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYE--FKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            C  C+ ++     + CG RFC  C+   L+     CP D +        F + +F D   +  I  L++ C  E  G  + + L Q+ +H+ +C       PF  + C         M++    EI  H +   ++ E+T  E    K  + E+++ KE +              S  P+  K +     K   +      +     ++  +R  L     ++S  E   +  +E  +N+ ++  ++ +E    + ++       A  +     W I ++  ++++A +GK   ++S PF +   GY++  +   NG G  +  +LS++  +M+G  D  L WPFK  VT  +++Q  +  H       D  P+S  + RP    NI  G P F+S   LE+ T  I D+ I +K  V
Sbjct:   48 CEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADME------PLFKDKIFRDVCCHREIMALKVYCRSEANGCQEQMSLQQIPDHVNVC-------PFFEVPCPLGKCKERMMRK----EIPEHLAWKCKYREST-CEFCKNKMPLTELQKHKETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGRASLETQLNR-HDDMLSVHEIRLADMDLRFQVLETAS-YNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMNIASGCPLFVSQSVLESGT-YIKDDTIFIKVTV 442          

HSP 2 Score: 95.1301 bits (235), Expect = 2.502e-20
Identity = 51/160 (31.87%), Postives = 84/160 (52.50%), Query Frame = 3
Query: 1446 KLANTLHENGNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            ++  T   NG  +IW ++++ + ++DA +GK L ++S+PFY+   GYKM   +Y NG   G    +S++F +++G +D  L WP+K  V   LMDQ  +   + + F  D  P   +  RP  E ++  G   F+S   L      I DD I  +VT + 
Sbjct:  289 QVLETASYNGT-LIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDAFKPD--PSSSSFRRPVAEMNIASGCPLFVSQSVLESG-TYIKDDTIFIKVTVDT 444          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 100.908 bits (250), Expect = 3.183e-22
Identity = 64/202 (31.68%), Postives = 105/202 (51.98%), Query Frame = 3
Query:  870 KTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKL 1451
            K+ +  + N ++ QR    E  +  +E+  S       H     W ++++S K + AK    +E FS PF +H  GY+L   A  NG+G+ E  +LS+YI ++ G  DN L WPF   VTFSI++Q    +   + +  T++  PN K + +P   RN      +G G+P FIS +E++ +   I DN I +K  + +  K+
Sbjct:  268 KSHLTMMCNLVSRQRQEILELRREMEELSVS-------HDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNCIFIKASIEIPQKI 461          

HSP 2 Score: 88.5817 bits (218), Expect = 3.493e-18
Identity = 50/161 (31.06%), Postives = 86/161 (53.42%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPN----------RNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+HR GYK+ +  + NG  +G    +S+Y +++ G +D+ LEWP+   V F ++DQ     +     T+   PD PN          RN    E +LGFG+ KFIS E++      I D+ I  + + E+ +K
Sbjct:  303 LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPD-PNWKNFQKPCSTRNS-LDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIEIPQK 460          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 101.293 bits (251), Expect = 3.187e-22
Identity = 64/202 (31.68%), Postives = 105/202 (51.98%), Query Frame = 3
Query:  870 KTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKL 1451
            K+ +  + N ++ QR    E  +  +E+  S       H     W ++++S K + AK    +E FS PF +H  GY+L   A  NG+G+ E  +LS+YI ++ G  DN L WPF   VTFSI++Q    +   + +  T++  PN K + +P   RN      +G G+P FIS +E++ +   I DN I +K  + +  K+
Sbjct:  275 KSHLTMMCNLVSRQRQEILELRREMEELSVS-------HDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNCIFIKASIEIPQKI 468          

HSP 2 Score: 88.5817 bits (218), Expect = 3.541e-18
Identity = 48/159 (30.19%), Postives = 84/159 (52.83%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPD-------HPNRNR-PFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+HR GYK+ +  + NG  +G    +S+Y +++ G +D+ LEWP+   V F ++DQ     +     T+   PD        P   R    E +LGFG+ KFIS E++      I D+ I  + + E+ +K
Sbjct:  310 LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIEIPQK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 101.293 bits (251), Expect = 3.382e-22
Identity = 65/206 (31.55%), Postives = 106/206 (51.46%), Query Frame = 3
Query:  870 KTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLL--TYDMLPNSKEWNRPTQFRN------IGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKLANTL 1463
            K+ +  + N ++ QR    E  +  +E+  S       H     W ++++S K + AK    +E FS PF +H  GY+L   A  NG+G+ E  +LS+YI ++ G  DN L WPF   VTFSI++Q    +   + +  T++  PN K + +P   RN      +G G+P FIS +E++ +   I DN I +K  + +  K+   L
Sbjct:  275 KSHLTMMCNLVSRQRQEILELRREMEELSVS-------HDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKRN-YIRDNCIFIKASIEIPQKIMVIL 472          

HSP 2 Score: 88.5817 bits (218), Expect = 4.199e-18
Identity = 48/159 (30.19%), Postives = 84/159 (52.83%), Query Frame = 3
Query: 1482 IIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPD-------HPNRNR-PFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            +IW + ++++  ++A+     + FS PFY+HR GYK+ +  + NG  +G    +S+Y +++ G +D+ LEWP+   V F ++DQ     +     T+   PD        P   R    E +LGFG+ KFIS E++      I D+ I  + + E+ +K
Sbjct:  310 LIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIEIPQK 467          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 95.5153 bits (236), Expect = 3.977e-20
Identity = 50/166 (30.12%), Postives = 88/166 (53.01%), Query Frame = 3
Query: 1431 VHLDGKLANTLHENGNKI-IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            V ++GK+ +      + I IW + +FT+ R+DA +G+A  +FS  FY+ + GYKM L +Y NG  TG    +S++F +++G  D  L+WP+   V   L+DQ+ N   +++ F  D+     +  RP ++ ++  G   F    KL      I D+ I  +   ++
Sbjct:  404 VEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQN-NREHIIDAFRPDI--SSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVDL 566          

HSP 2 Score: 89.7373 bits (221), Expect = 2.497e-18
Identity = 83/384 (21.61%), Postives = 155/384 (40.36%), Query Frame = 3
Query:  438 ETCGDDFIELNQMEEHIRICNNQRRFCPFINIGC-------------QENNLVVLNMKQHLLSEIEVH-SSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKF----LKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGY-------------------QLEQEIHTSEKTKAEM-----------HQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDG 1445
            E C    I   +  +HI+ C+  +  C F  +GC             ++ +   LN+  H +  I+V   SL  Q  E    ++  +   + +++    ++ R+    L       +      L + +     + + +  TK+  +       E ++S +E    +  I+N+   +     E Y                   QLE+ +   + +  EM           +   F W I +F+ KR++A +G+   +FS  F + + GY++  +   NG G     +LS++  +M+G +D  L WPF   VT  +++Q +N  H       D+  +S  + RP    NI  G P F    +L+++   I D  I +K  V L G
Sbjct:  191 EGCAKKKIPREKYVDHIKFCSKFKAPCRFHVVGCDTSVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQKLHELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQLQSEKTKVAELSRRCQELELKVSTFE---NIVCILNRELERSCATMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDI--SSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIVDLSG 568          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000039062.1 (SMESG000039062.1)

HSP 1 Score: 1226.08 bits (3171), Expect = 0.000e+0
Identity = 593/600 (98.83%), Postives = 597/600 (99.50%), Query Frame = 3
Query:  135 MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKLANTLHENGNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 1934
            MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQ+NEIKEIKEKINRN RRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNK+NNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNL WPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFIS KELETQTGLIVDN+IILKCKVHLDGKLANTLHENGNKIIWTVKNFTQLRKDAQSGKA+QIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK
Sbjct:    1 MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQINEIKEIKEKINRNPRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEIVNKMNNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLPWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISLKELETQTGLIVDNKIILKCKVHLDGKLANTLHENGNKIIWTVKNFTQLRKDAQSGKAVQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK 600          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 277.33 bits (708), Expect = 4.706e-86
Identity = 164/463 (35.42%), Postives = 251/463 (54.21%), Query Frame = 3
Query:  135 MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEI----KEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEI--------------VNKINNQRINNYEGYQLEQEIHTSEK---TK-AEMHQN-------EFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVH 1436
            M   +FEN+W+I+ NY+F    E+  D+ C +C K+MIN+ N+PCGCRFC DC+  YLN  E  CPG+ D CK  LI+ + N+  D+P N++I+RL +KCPE   D   EL ++E HI  CN+Q   CP+I IGC E+++ +  M  HL ++I  H+ LLM         ID++ N++NEIK I    K + ++N+  +  SY  +    L+                +I +++  +HN EN   +   K K E +              ++ +N    N      +  +I  + K   TK A+M  N       EF W +  F++K + AK GK   IFSD F +H+ GY++  Q  PNG+  Y N YLS+++C+MK   D+ L WPF+ + TFS+INQ++ + HS+   TYD     K  ++P   RN+G G+  F+  KEL        +++I +K KVH
Sbjct:    1 MAKFKFENIWKIMENYDFS-GVEVDSDMICGLCGKVMINSHNAPCGCRFCLDCISNYLNGRENLCPGNKDDCKLELISLEENIAIDRPMNNKISRLIIKCPENSCDYVDELRKIELHISQCNSQTIICPYIKIGCNESDVSLGKMPDHLRNDIHNHTKLLMDC-------IDNLNNEMNEIKIIVGNFKGQFDKNTNDQ--SYLAEIESKLQQ------------QTMEIDLLKQRVHNLENLDFVDRPKLKAESLNNIISDNFRNYPNRLDTLNRNSTNPINLTAVSNKIDDAMKFGLTKLADMEINLKRMKSFEFVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQMEKCLDKPILERNVGYGYLDFMDLKELFNNDDWTRNDQIFIKFKVH 441          

HSP 2 Score: 98.5969 bits (244), Expect = 1.299e-21
Identity = 50/151 (33.11%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1479 KIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDK--IAFRVTTEV 1925
            + +W V  F    K A+ GK L IFS+ FY+H+ GYKM L+L+PNG     N  +S++  ++K   DD LEWP++ +  F L++Q T  P   +  T D        ++P  E+++G+G+  F+  ++L  N     +D+  I F+V + +
Sbjct:  294 EFVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQMEKCLDKPILERNVGYGYLDFMDLKELFNNDDWTRNDQIFIKFKVHSSL 444          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000025794.1 (SMESG000025794.1)

HSP 1 Score: 268.085 bits (684), Expect = 1.489e-82
Identity = 150/457 (32.82%), Postives = 258/457 (56.46%), Query Frame = 3
Query:  135 MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKE-------KINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEF--KTKVEEIVNKI----NNQRINNYE-GYQLEQEIHTSEKTKAEMHQN-------EFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLD 1442
            M   + ENVW+I+R+YN+E  +EI  D+ C +CKK+++NA  +PCGCRFC  C+  +L+  EK CPGD++ CK+ +++ + N+  D P N +I++L++KC E       EL +ME+H R C  +   CP+ NIGC + N+    +  HL SEI  H+ LLM +  N  NE++ +K   N +  + E       ++  +  R+ +     Q K           + +LN    IP +R +  N  +++   +   +   +E+++KI    N Q+++  E   ++++     ++   EM  N       EF W +  F++K  +AK+G    I+S+ FL+H+NG+++  + DP+G+G  +  +LS++  +MKG  D  L WPF+ +VTF++INQ++ + H  + +     PN K   +PT  RN G+GFP F+S +EL +   L+ +N+I +KC V +D
Sbjct:    1 MSGSKLENVWQIMRDYNYESVTEIQNDMLCFLCKKLLVNARCAPCGCRFCFTCISDFLDHKEKICPGDTEECKQEMLHLNENICVDYPMNIKISKLQVKCKEMSCVYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFAHTKLLMDFVVNFNNEMEMLKANNNGLSAVNELLRNEINELKLDGERRRVEIADLQRKCADQ----AEEIELLN--EDIPALRNVDRNVSDRLDGLQLIIEGNQKELIDKIGQMENKQKVDLTEMSNKIDKLSGNVDRKLLEMAANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQPTD-RNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDID 450          

HSP 2 Score: 107.842 bits (268), Expect = 1.428e-24
Identity = 53/158 (33.54%), Postives = 90/158 (56.96%), Query Frame = 3
Query: 1452 ANTLHENGNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEV 1925
            AN       + +W +  FT    DA++G   +I+SE F +H+NG+KM L + P+G   G    +S++F ++KG  D  LEWP++ +V F L++Q T  P V         P+     +P T+++ G GF KF+S E+LS NP L+ +++I  + + ++
Sbjct:  293 ANQNQRINGEFMWKLDKFTDKMADAKNGINTRIYSESFLTHKNGFKMCLRVDPDGNGGGKGTHLSVFFHLMKGEFDGILEWPFRHSVTFALINQRTRLPHVSKTVKCANYPNDKALIQP-TDRNAGLGFPKFVSHEELSSNPDLMRNNQIFIKCSVDI 449          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000020135.1 (SMESG000020135.1)

HSP 1 Score: 260.381 bits (664), Expect = 8.433e-80
Identity = 158/451 (35.03%), Postives = 242/451 (53.66%), Query Frame = 3
Query:  171 LRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEI----KEKINRNSRRKLLSYFPKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVEEI--------------VNKINNQRINNYEGYQLEQEIHTSEK---TK-AEMHQN-------EFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKVH 1436
            + NY+F    E+  D+ C +C K+MIN+ N+PCGCRFC DC+  YLN  E  CPG+ D CK  LI+ + N+  D+P N++I+RL +KCPE   D   EL ++E HI  CN+Q   CP+I IGC E+++ +  M  HL ++I  H+ LLM         ID++ N++NEIK I    K + ++N+  +  SY  +    L+                +I +++  +HN EN   +   K K E +              ++ +N    N      +  +I  + K   TK A+M  N       EF W +  F++K + AK GK   IFSD F +H+ GY++  Q  PNG+  Y N YLS+++C+MK   D+ L WPF+ + TFS+INQ++ + HS+   TYD     K  ++P   RN+G G+  F+  KEL        +++I +K KVH
Sbjct:    1 MENYDFS-GVEVDSDMICGLCGKVMINSHNAPCGCRFCLDCISNYLNGRENLCPGNKDDCKLELISLEENIAIDRPMNNKISRLIIKCPENSCDYVDELRKIELHISQCNSQTIICPYIKIGCNESDVSLGKMPDHLRNDIHNHTKLLMDC-------IDNLNNEMNEIKIIVGNFKGQFDKNTNDQ--SYLAEIESKLQQ------------QTMEIDLLKQRVHNLENLDFVDRPKLKAESLNNIISDNFRNYPNRLDTLNRNSTNPINLTAVSNKIDDAMKFGLTKLADMEINLKRMKSFEFVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQMEKCLDKPILERNVGYGYLDFMDLKELFNNDDWTRNDQIFIKFKVH 429          

HSP 2 Score: 98.5969 bits (244), Expect = 1.280e-21
Identity = 50/151 (33.11%), Postives = 84/151 (55.63%), Query Frame = 3
Query: 1479 KIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDK--IAFRVTTEV 1925
            + +W V  F    K A+ GK L IFS+ FY+H+ GYKM L+L+PNG     N  +S++  ++K   DD LEWP++ +  F L++Q T  P   +  T D        ++P  E+++G+G+  F+  ++L  N     +D+  I F+V + +
Sbjct:  282 EFVWKVDKFNDKMKAAKKGKTLSIFSDSFYTHQYGYKMCLQLFPNGNAEYANNYLSVFLCLMKSDLDDILEWPFRNHFTFSLINQRTRLPHSRSTTTYDNFQMEKCLDKPILERNVGYGYLDFMDLKELFNNDDWTRNDQIFIKFKVHSSL 432          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014923.1 (SMESG000014923.1)

HSP 1 Score: 259.225 bits (661), Expect = 3.627e-79
Identity = 152/443 (34.31%), Postives = 242/443 (54.63%), Query Frame = 3
Query:  135 MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFCSDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKCPETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLLSEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYFPKQMKFLKTFLVFT-----FYMLILNYATKIPIIRTILHNEENQI--SIYEFKTKVEEIVNKIN-NQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRENAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKGSNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKE--WNRPTQFRNIGVGFPSFISFKELETQTGLIVDNRIILKCKV 1433
            M ++R+EN+WRIL  Y     +EIS DL C ICK ++ NACN PCGCR+C +C+++YL + EKFCP + D CK  L+N D N+  D   N RI+R+ +KCPE   +   EL ++ +HI  C+ +   CP+ +IGC E  +    +  HL+ +   H+  L+   +N KNE+  +K    E+K+IK++ ++  +  L     K  +F + F+  +       + +     K+  +R  L  ++N     + E   + E++  K + NQR +     +LE      E    + H     W I NF+ KR+ A+SG + +I+S+PF SH+NGY++  Q  P+G    +   LS++  IM+G ND  L WP KL VT  IINQ+S  +H+     YD + +     +++P    N+G G+  FI   EL     L+ ++RI+LKC V
Sbjct:    1 MSNLRYENIWRILSEYRVNSMTEISSDLICVICKNLLKNACNGPCGCRYCFECIQSYLGQVEKFCPQNFDECKEELLNIDRNILLDNAANSRISRIIVKCPEPSCEFHDELRKIGDHINACDKKIVKCPYFDIGCSEGKVASERINDHLIVDNYTHAKTLVNCIQNLKNEMALMKECFEELKKIKDE-SQKKQSLLYDLQDKISEFKRKFIQKSDENIHLKLKLQQTEHKLEDLRHQLDMKQNATENQMIELLLENEKLKYKSDENQRFSEILHGKLES--LERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSHKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGY-DFIKLDELIKNNKLLKNDRIVLKCVV 439          

HSP 2 Score: 111.309 bits (277), Expect = 7.527e-26
Identity = 59/169 (34.91%), Postives = 99/169 (58.58%), Query Frame = 3
Query: 1437 LDGKLAN------TLHENGNKIIWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGINEMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLPDHPNR--NRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTT 1919
            L GKL +      ++ ++   I W + NFT+ RK+AQSG    I+SEPFYSH+NGYKM L+L+P+G   G    +S++F I++G +D  L+WP K+ V   +++Q +       KF  D + D      ++P T+ ++G+G++ FI  ++L  N  L+ +D+I  +   
Sbjct:  272 LHGKLESLERETLSMKQHFGSIQWKIDNFTKKRKEAQSGIIADIYSEPFYSHKNGYKMCLQLHPDGFKAGKGTNLSVFFFIMRGENDVILQWPMKLEVTIGIINQESGDIHTSYKFNYDPVLDKYRHLFDKPKTDINVGYGYD-FIKLDELIKNNKLLKNDRIVLKCVV 439          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF52.565e-2824.94TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF52.565e-2824.94TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF52.565e-2824.94TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF23.940e-2323.60TNF receptor associated factor 2 [Source:HGNC Symb... [more]
TRAF66.603e-1922.00TNF receptor associated factor 6 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-21.407e-1630.65TNF Receptor Associated Factor (TRAF) homolog [So... [more]
trf-13.951e-1532.68TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Traf44.011e-1832.03gene:FBgn0026319 transcript:FBtr0077429[more]
Traf44.914e-1832.03gene:FBgn0026319 transcript:FBtr0334401[more]
Traf62.627e-619.60gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a5.581e-2235.98tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a5.581e-2235.98tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
unm_sa8083.354e-2129.85un-named sa808 [Source:ZFIN;Acc:ZDB-GENE-120727-21... [more]
traf2b3.728e-2133.33Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b3.728e-2133.33Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl21.249e-2136.08synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
slc12a15.003e-2125.62solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a12.099e-2023.92solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a12.623e-2022.25solute carrier family 12 member 1 [Source:Xenbase;... [more]
TRAF23.610e-2034.01TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf58.887e-2522.47TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf58.887e-2522.47TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf21.397e-2423.94TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf22.335e-2423.94TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf51.267e-2027.23TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O00463|TRAF5_HUMAN1.232e-2724.94TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|P70191|TRAF5_MOUSE4.232e-2523.56TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|P39429|TRAF2_MOUSE9.772e-2423.94TNF receptor-associated factor 2 OS=Mus musculus O... [more]
sp|Q12933|TRAF2_HUMAN1.892e-2223.60TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
sp|Q6IWL4|TRAF6_DANRE3.588e-2021.03TNF receptor-associated factor 6 OS=Danio rerio OX... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1011.567e-4228.33TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A2B4SJ652.282e-3325.64TNF receptor-associated factor 4 OS=Stylophora pis... [more]
I1ZID81.310e-3236.16TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A3M6TEQ91.935e-3126.76Uncharacterized protein (Fragment) OS=Pocillopora ... [more]
A0A485MBY17.634e-3025.49TNF receptor-associated factor OS=Lynx pardinus OX... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf54.710e-2322.34TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2b1.190e-2223.60TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4a3.236e-2235.98TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf64.374e-2021.74TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf69.637e-2021.29TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000002130.11.319e-2721.77pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.12.120e-2322.28pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
traf68.483e-1019.89TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352372.334e-2625.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412434.982e-2223.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494642.100e-2022.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388732.243e-2022.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487733.838e-2023.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf35.760e-2322.97TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a3.183e-2231.68TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a3.187e-2231.68TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a3.382e-2231.55TNF receptor associated factor 4 [Source:NCBI gene... [more]
ENSORLT00000020861.23.977e-2030.12TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000039062.10.000e+098.83SMESG000039062.1[more]
SMESG000020135.14.706e-8635.42SMESG000020135.1[more]
SMESG000025794.11.489e-8232.82SMESG000025794.1[more]
SMESG000020135.18.433e-8035.03SMESG000020135.1[more]
SMESG000014923.13.627e-7934.31SMESG000014923.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025971 ID=SMED30025971|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1989bp
GTTTTAAACGACCTGTACTTTGAAATTATTTAATTTTAAGATTACAAGTC
TACTTCAAATTTGTTTATCAGTAGGCATTCAAATTTCAATTAAAATATTT
CAACTTGAAAAGTTGGTCTGAGCATCCCTCCTCAATGGAAAGCATCCGAT
TTGAAAACGTATGGAGAATTTTGCGAAATTATAATTTTGAAGTTAACAGC
GAAATTAGCTGTGACCTGAAATGCACAATTTGCAAGAAAATTATGATTAA
TGCCTGCAATTCCCCCTGCGGATGTAGATTTTGTTCCGATTGTCTGAAAA
CCTATTTGAATAGATCGGAGAAGTTTTGTCCGGGTGACTCGGATTATTGT
AAAAGGGTCTTGATTAACTTCGATAACAATGTGTTTTGTGATCAACCGAC
CAATCATCGAATTGCGCGTTTGCGCTTGAAGTGCCCGGAAACCTGTGGAG
ATGATTTCATTGAACTTAATCAAATGGAAGAACATATACGAATATGCAAT
AACCAAAGACGCTTTTGTCCATTTATTAATATTGGATGTCAAGAAAACAA
TTTAGTAGTACTCAACATGAAACAACATCTGCTTTCGGAAATTGAGGTTC
ATTCGAGTTTATTAATGCAATGGAATGAGAACACGAAAAACGAAATTGAT
TCGATAAAAAATCAAGTAAATGAAATAAAAGAAATAAAAGAAAAGATCAA
TCGCAATTCCCGTAGGAAGCTTTTATCTTATTTTCCAAAACAAATGAAAT
TTCTGAAAACTTTTTTGGTATTCACTTTCTACATGCTGATTCTAAATTAT
GCCACAAAAATTCCAATTATCAGAACAATATTACACAATGAAGAAAATCA
AATATCGATTTATGAATTTAAAACAAAAGTAGAAGAAATAGTGAATAAGA
TAAACAATCAAAGAATTAATAATTACGAAGGATACCAGCTGGAGCAAGAG
ATTCATACATCAGAAAAGACAAAAGCAGAAATGCATCAAAATGAATTCAC
GTGGACAATTCATAATTTCTCTAACAAAAGAGAAAATGCTAAATCTGGCA
AGGTTTACGAAATATTCAGTGACCCTTTTTTGTCACACGAGAATGGATAC
CAATTGATGTTTCAAGCTGATCCAAATGGATCAGGAAACTACGAAAACCT
TTATTTATCTATTTATATATGTATAATGAAAGGGTCTAATGACAATAATT
TATTATGGCCCTTCAAACTAAATGTCACATTCAGTATTATCAATCAGAAA
TCAAATATGGTTCATAGTAAAAGATTGCTCACATATGACATGCTTCCAAA
TTCCAAAGAATGGAATAGACCTACTCAATTCAGGAATATCGGAGTCGGAT
TTCCGAGTTTTATTTCATTTAAAGAATTGGAAACACAAACAGGATTAATT
GTTGACAACAGAATTATTTTAAAATGCAAAGTCCATCTCGATGGCAAATT
GGCAAATACTCTACATGAAAATGGGAATAAAATCATTTGGACTGTAAAAA
ATTTTACTCAGTTAAGAAAAGATGCCCAATCCGGAAAAGCTTTGCAGATT
TTTAGTGAACCGTTTTATTCTCATCGAAATGGATACAAAATGATTCTGGA
ACTCTATCCCAATGGAATTAATACTGGAATAAATGAAATGGTATCCATCT
ATTTTCAAATAATTAAGGGACCTCATGATGATAAATTGGAGTGGCCATAT
AAAGTCAATGTAGTATTTGAGTTAATGGACCAGCATACAAATTATCCAGC
GGTCGTGAACAAGTTCACAGATGACTTATTGCCAGATCATCCGAATCGCA
ACAGACCATTTACTGAAAAAAGTCTTGGTTTTGGCTTTGAAAAATTTATT
AGTTTTGAAAAATTATCAATGAATCCTGGACTGATTGTTGACGATAAAAT
CGCTTTTCGCGTAACAACAGAAGTCCAGAAAAAATAATGATAATATTTTA
AATTTATTATATTTTAAATACATTTTTTTAATTAAAAAA
back to top

protein sequence of SMED30025971-orf-1

>SMED30025971-orf-1 ID=SMED30025971-orf-1|Name=SMED30025971-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=601bp
MESIRFENVWRILRNYNFEVNSEISCDLKCTICKKIMINACNSPCGCRFC
SDCLKTYLNRSEKFCPGDSDYCKRVLINFDNNVFCDQPTNHRIARLRLKC
PETCGDDFIELNQMEEHIRICNNQRRFCPFINIGCQENNLVVLNMKQHLL
SEIEVHSSLLMQWNENTKNEIDSIKNQVNEIKEIKEKINRNSRRKLLSYF
PKQMKFLKTFLVFTFYMLILNYATKIPIIRTILHNEENQISIYEFKTKVE
EIVNKINNQRINNYEGYQLEQEIHTSEKTKAEMHQNEFTWTIHNFSNKRE
NAKSGKVYEIFSDPFLSHENGYQLMFQADPNGSGNYENLYLSIYICIMKG
SNDNNLLWPFKLNVTFSIINQKSNMVHSKRLLTYDMLPNSKEWNRPTQFR
NIGVGFPSFISFKELETQTGLIVDNRIILKCKVHLDGKLANTLHENGNKI
IWTVKNFTQLRKDAQSGKALQIFSEPFYSHRNGYKMILELYPNGINTGIN
EMVSIYFQIIKGPHDDKLEWPYKVNVVFELMDQHTNYPAVVNKFTDDLLP
DHPNRNRPFTEKSLGFGFEKFISFEKLSMNPGLIVDDKIAFRVTTEVQKK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0003676nucleic acid binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0046872metal ion binding
GO:0004842ubiquitin-protein transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR012227TNF_rcpt-assoc_TRAF_met
IPR043211TNF_rcpt-assoc_TRAF
IPR013087Znf_C2H2_type
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR001293Znf_TRAF
IPR001841Znf_RING
IPR007087Znf_C2H2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 164..191
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 446..595
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 27..433
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 22..69
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 449..577
e-value: 8.0E-14
score: 61.9
coord: 290..415
e-value: 7.8E-11
score: 52.0
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 447..595
score: 24.763
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 285..433
score: 23.894
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 96..148
e-value: 4.7E-7
score: 30.4
IPR012227TNF receptor-associated factor TRAF, metazoaPIRSFPIRSF015614TRAFcoord: 90..441
e-value: 4.4E-53
score: 178.3
coord: 6..103
e-value: 6.2E-5
score: 19.5
coord: 439..600
e-value: 2.4E-36
score: 123.1
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..129
e-value: 2.9E-11
score: 45.3
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 438..600
e-value: 9.5E-43
score: 147.9
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 234..435
e-value: 2.2E-47
score: 163.2
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 286..434
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 448..594
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 446..595
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 27..433
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 98..126
score: 8.538
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 30..69
score: 9.583