Microtubule-associated protein futsch

Overview
NameMicrotubule-associated protein futsch
Smed IDSMED30025910
Length (bp)3231
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microtubule-associated protein futsch (SMED30025910) t-SNE clustered cells

Violin plots show distribution of expression levels for Microtubule-associated protein futsch (SMED30025910) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microtubule-associated protein futsch (SMED30025910) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microtubule-associated protein futsch (SMED30025910) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025910

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30025910SMESG000030021.1 SMESG000025422.1 SmedASXL_011384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30025910SMESG000030021.1 SMESG000025422.1 SmedASXL_011384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025910SMESG000030021.1 SMESG000025422.1 SmedASXL_011384SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
muscle cellSMED30025910SMESG000030021.1 SMESG000000893.1 dd_Smed_v4_2033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025910SMESG000030021.1 SMESG000000893.1 dd_Smed_v4_2033_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30025910SMESG000044270.1 SMESG000030021.1 SMESG000025422.1 dd_Smed_v4_1999_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30025910SMESG000025422.1 SMESG000044270.1 SMESG000030021.1 dd_Smed_v6_1999_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025910SMESG000025422.1 SMESG000044270.1 SMESG000030021.1 dd_Smed_v6_1999_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025910SMESG000030021.1 SMESG000000893.1 dd_Smed_v4_2033_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30025910SMESG000030021.1 SMESG000000893.1 dd_Smed_v4_2033_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microtubule-associated protein futsch vs. Ensembl Human
Match: MAP1A (microtubule associated protein 1A [Source:HGNC Symbol;Acc:HGNC:6835])

HSP 1 Score: 82.8037 bits (203), Expect = 3.673e-15
Identity = 110/500 (22.00%), Postives = 201/500 (40.20%), Query Frame = 3
Query:   69 KSNKLIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPND------YLFNGIEDCDFLGGIKLDNC--------EIEVIINSDKDGIINSIDEGLKSDNL--ILLYVGEVTVPFGQWILHDGIFNSNNLHSIL-NGDHQKIERN-------VVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNA---VLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLG-----------LDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQL--QSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK--------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            + + L+++I +I  E QL+A +  L +G+   N    +        LF       F   +K            E  +++N   D I + +   L S +   +L+  G+   P G  IL  G ++  N   +L N +  ++  N        + V+ L   DW  +               E    T   +A+ + +V+    V     + +  T+ G  +L+     +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G           L+   S      S  + +L  P    +  + P  ++L   S+ A       RS     LT         ++ L ++A+    + +N I+P+ LFHK+G G L+M  L P ++  EM+     W  +      +          S+P  +S T L+VW P +    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   53 QKHSLLIVIGDIGTESQLRAVRAHLEQGILSWNIDLSSFDLNQQLRLFITRHLAHFSSEVKGQRTLCHQSEILETIILVNPSADSISSEVHHLLSSSSAYKLLILSGQSLEPGGDLILQSGTYSYENFAQVLHNPEISQLLSNRDPGIQAFLTVSCLGEGDWSHLGLSSSQETLHLRLNPEPTLPTMDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPEKLRLPDASRKAK------RSIEEACLT------LQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLPNGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGN-APQNKILEGLEKLRH--LDFLRYP 530          
BLAST of Microtubule-associated protein futsch vs. Ensembl Human
Match: MAP1B (microtubule associated protein 1B [Source:HGNC Symbol;Acc:HGNC:6836])

HSP 1 Score: 73.559 bits (179), Expect = 2.249e-12
Identity = 111/501 (22.16%), Postives = 202/501 (40.32%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKAS-----------KTCLIK-GLEQVNKKFPNDYLFNGIEDCDF---LGGIKL-----DNCEIEVIINSDKDGIINSIDEGLK--SDNLILLYVGEVTVPFGQWILHDG---------IFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQV--IEKKQLPYFSLCGYE----LEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWK-----KSKYC-----NDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            L+V++ EI  EE L+ +            T LI+  L+Q  K      LF       F   + G K+     D  E  V+IN   + +   +   +   + + +L+  G+     G+ IL  G         IF    +  +L+  H   + ++ L  P    DW+   +++  L  F          L E++    F   ++  V  V     I +  T+ G  +L+     +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++       M+ ++I  L          +      L S       +++   L      +K   +++        ++ L++K +       N I P+ LF K+G G LEM  L P +   EM+ F   W      K+++         L  S  +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP
Sbjct:   39 LLVVVGEIVTEEHLRRAIGNIELGIRSWDTNLIECNLDQELK------LFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEG-DWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVE-VPSPFDILEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINS-------MLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKLK-HLDFLKQP 514          
BLAST of Microtubule-associated protein futsch vs. Ensembl Human
Match: MAP1A (microtubule associated protein 1A [Source:HGNC Symbol;Acc:HGNC:6835])

HSP 1 Score: 72.7886 bits (177), Expect = 4.165e-12
Identity = 67/273 (24.54%), Postives = 118/273 (43.22%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLG-----------LDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQL--QSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK--------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G           L+   S      S  + +L  P    +  + P  ++L   S+ A       RS     LT         ++ L ++A+    + +N I+P+ LFHK+G G L+M  L P ++  EM+     W  +      +          S+P  +S T L+VW P +    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPEKLRLPDASRKAK------RSIEEACLT------LQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLPNGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGN-APQNKILEGLEKLRH--LDFLRYP 292          
BLAST of Microtubule-associated protein futsch vs. Ensembl Human
Match: MAP1B (microtubule associated protein 1B [Source:HGNC Symbol;Acc:HGNC:6836])

HSP 1 Score: 70.8626 bits (172), Expect = 1.086e-11
Identity = 101/467 (21.63%), Postives = 184/467 (39.40%), Query Frame = 3
Query:  237 DNCEIEVIINSDKDGIINSIDEGLK--SDNLILLYVGEVTVPFGQWILHDGIFNSNNL------HSILNGDHQKIERNV-------VLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAK--MAGFVNAVLGKVSIC-QVDTNQGGSQLAAITTRRPSLYLFLDKGSS---------CC---------PALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWK-----KSKYC-----NDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKTT 1475
            D  E  V+IN   + +   +   +   + + +L+  G+     G+ IL  G F+  N         IL G H K   N+       +L T  P               SL  +  EE D  ++ + +  +  F+N  L   SI  +++     ++  + +   PS +  L+  +S         CC          AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++       M+ ++I  L          +      L S       +++   L      +K   +++        ++ L++K +       N I P+ LF K+G G LEM  L P +   EM+ F   W      K+++         L  S  +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP     D   + P    K T
Sbjct:  105 DVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEILKGGHNKCPVNLNFFKIGELLSTTHPANKA-----------SLTLFCPEEGDWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVEVPSPFDILEPPTSGGFLKLSKPCCYIFPGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINS-------MLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKL-KHLDFLKQPLATQKDLTGQVPTPVVKQT 550          
BLAST of Microtubule-associated protein futsch vs. Ensembl Human
Match: MAP1B (microtubule associated protein 1B [Source:HGNC Symbol;Acc:HGNC:6836])

HSP 1 Score: 69.707 bits (169), Expect = 1.761e-11
Identity = 83/365 (22.74%), Postives = 142/365 (38.90%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWK-----KSKYC-----NDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKTT-----------------PPVSATSRGASKSGDSALTNAKKLA--PTAE-------KPSRPITVSAPPVHAGKELPGKR 1631
            +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++       M+ ++I  L          +      L S       +++   L      +K   +++        ++ L++K +       N I P+ LF K+G G LEM  L P +   EM+ F   W      K+++         L  S  +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP     D   + P    K T                 P  S + R  SK     +T    +   P  E       K  +PI     P    KE+P K 
Sbjct:  133 KPCCYIF--PGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINS-------MLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKLK-HLDFLKQPLATQKDLTGQVPTPVVKQTKLKQRADSRESLKPAAKPLPSKSVRKESKEETPEVTKVNHVEKPPKVESKEKVMVKKDKPIKTETKPSVTEKEVPSKE 485          
BLAST of Microtubule-associated protein futsch vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0307597)

HSP 1 Score: 93.5893 bits (231), Expect = 9.111e-19
Identity = 90/346 (26.01%), Postives = 155/346 (44.80%), Query Frame = 3
Query:  360 GQWILHDGIFNSNNLHSILNG-DHQKIERNV--VLVTPLPCED---WQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQV-DTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDM-MSQRINHLF--VPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW----KKSKYCNDSLAKSLP----SSATVLMVWKPFSNKAPIKRIIYVGS 1343
            G WIL DG F+  +        D Q++ R     +   + C D   W  + +K   +   C   +  VD  D     + GF++ +   V    + +  +    +  I    P+LY+F   G     AL  ++GF M+ + GF+R A +  + ++  ++D  LM+ L  SN+ GL A  S +RD  +  +I H F  VP      D +        +  +P  +DL  +   +++ LKA        L +K +       NQ +P+ L+HK+G+G+L+M  + P  +  E+K+F   W    ++     DS   + P     S   L+VW+P +    I RI++ GS
Sbjct:  227 GSWILQDGTFSVADFSEAFQEHDVQRVIRAYADTITMNIHCADAGLWHTLPEKA--FARQCRIRINPVDVLDTSSECINGFIDYLAPMVMPTSLRELLETSDVVGNIRFTHPTLYVF--PGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDAHVYPQIGHFFGNVP------DRKGLPSPDGDKDRDPLLIDLFERGHGIVSDLKA--------LDLKPQ---CCYRNQ-EPVNLYHKVGHGTLDMYVISPARDSKEVKEFLQKWHAGDQRLFAARDSRDFNFPLQNLVSICALLVWQPANPDDTITRILFPGS 550          
BLAST of Microtubule-associated protein futsch vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0307598)

HSP 1 Score: 93.5893 bits (231), Expect = 9.111e-19
Identity = 90/346 (26.01%), Postives = 155/346 (44.80%), Query Frame = 3
Query:  360 GQWILHDGIFNSNNLHSILNG-DHQKIERNV--VLVTPLPCED---WQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQV-DTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDM-MSQRINHLF--VPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW----KKSKYCNDSLAKSLP----SSATVLMVWKPFSNKAPIKRIIYVGS 1343
            G WIL DG F+  +        D Q++ R     +   + C D   W  + +K   +   C   +  VD  D     + GF++ +   V    + +  +    +  I    P+LY+F   G     AL  ++GF M+ + GF+R A +  + ++  ++D  LM+ L  SN+ GL A  S +RD  +  +I H F  VP      D +        +  +P  +DL  +   +++ LKA        L +K +       NQ +P+ L+HK+G+G+L+M  + P  +  E+K+F   W    ++     DS   + P     S   L+VW+P +    I RI++ GS
Sbjct:  227 GSWILQDGTFSVADFSEAFQEHDVQRVIRAYADTITMNIHCADAGLWHTLPEKA--FARQCRIRINPVDVLDTSSECINGFIDYLAPMVMPTSLRELLETSDVVGNIRFTHPTLYVF--PGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDAHVYPQIGHFFGNVP------DRKGLPSPDGDKDRDPLLIDLFERGHGIVSDLKA--------LDLKPQ---CCYRNQ-EPVNLYHKVGHGTLDMYVISPARDSKEVKEFLQKWHAGDQRLFAARDSRDFNFPLQNLVSICALLVWQPANPDDTITRILFPGS 550          
BLAST of Microtubule-associated protein futsch vs. Ensembl Fly
Match: futsch (gene:FBgn0259108 transcript:FBtr0112628)

HSP 1 Score: 93.5893 bits (231), Expect = 9.111e-19
Identity = 90/346 (26.01%), Postives = 155/346 (44.80%), Query Frame = 3
Query:  360 GQWILHDGIFNSNNLHSILNG-DHQKIERNV--VLVTPLPCED---WQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQV-DTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDM-MSQRINHLF--VPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW----KKSKYCNDSLAKSLP----SSATVLMVWKPFSNKAPIKRIIYVGS 1343
            G WIL DG F+  +        D Q++ R     +   + C D   W  + +K   +   C   +  VD  D     + GF++ +   V    + +  +    +  I    P+LY+F   G     AL  ++GF M+ + GF+R A +  + ++  ++D  LM+ L  SN+ GL A  S +RD  +  +I H F  VP      D +        +  +P  +DL  +   +++ LKA        L +K +       NQ +P+ L+HK+G+G+L+M  + P  +  E+K+F   W    ++     DS   + P     S   L+VW+P +    I RI++ GS
Sbjct:  227 GSWILQDGTFSVADFSEAFQEHDVQRVIRAYADTITMNIHCADAGLWHTLPEKA--FARQCRIRINPVDVLDTSSECINGFIDYLAPMVMPTSLRELLETSDVVGNIRFTHPTLYVF--PGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDAHVYPQIGHFFGNVP------DRKGLPSPDGDKDRDPLLIDLFERGHGIVSDLKA--------LDLKPQ---CCYRNQ-EPVNLYHKVGHGTLDMYVISPARDSKEVKEFLQKWHAGDQRLFAARDSRDFNFPLQNLVSICALLVWQPANPDDTITRILFPGS 550          
BLAST of Microtubule-associated protein futsch vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 83.5741 bits (205), Expect = 1.491e-15
Identity = 108/500 (21.60%), Postives = 202/500 (40.40%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKASKTCLIKGLEQ---------VNKKFPNDYLFNGIEDCDFLGGI--------KLDNCEIEVIINSDKDGIINSIDEGLKSDNLI--LLYVGEVTVPFGQWILHDGIFNSNNLHSI--------LNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAG---FVNAVLGKVSI-CQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            ++++I EI  E+QL+ ++  + +G+           ++++     LF       F   +        K D  E  V++N  +D +I+ I   L SD  +  LL +   +   G  +L  G+F+      +        L G     +R  + V+      W  + ++Q     L  Y L      +  + KM G   F   +   V +    D  +  +    +   +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ++ +++             +      L S        ++  KL T  + LK   +++        ++ L +K +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK+   LP            +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   50 MLIVIGEIATEQQLQTARLHIERGIRSWDISVSECDLDQQL---QLFITRHSAQFSAEVRGQRTLQHKSDVLETVVLVNPSEDTVISEI-HCLVSDPAVHKLLVLSGQSSDQGDLVLQTGVFSHQTFLRVFAEPGVSHLLGKASSGQRASLTVSCRSDAGWSSLGQQQR-IRELLNYTLN----PEPILPKMEGVTEFTEYISETVDVPSPFDLLEPPTSGGFLKLSKPCCYIF--PGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGING-------LLQRKVAEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIEEASLTLQYLNKLGIKPEPLFRVVSNTIEPITLFHKMGVGRLDMFVLNPVKDSKEMQFLMQKW-----AGNSKAKTGIILPNGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 523          
BLAST of Microtubule-associated protein futsch vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 83.5741 bits (205), Expect = 1.491e-15
Identity = 108/500 (21.60%), Postives = 202/500 (40.40%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKASKTCLIKGLEQ---------VNKKFPNDYLFNGIEDCDFLGGI--------KLDNCEIEVIINSDKDGIINSIDEGLKSDNLI--LLYVGEVTVPFGQWILHDGIFNSNNLHSI--------LNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAG---FVNAVLGKVSI-CQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            ++++I EI  E+QL+ ++  + +G+           ++++     LF       F   +        K D  E  V++N  +D +I+ I   L SD  +  LL +   +   G  +L  G+F+      +        L G     +R  + V+      W  + ++Q     L  Y L      +  + KM G   F   +   V +    D  +  +    +   +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ++ +++             +      L S        ++  KL T  + LK   +++        ++ L +K +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK+   LP            +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   50 MLIVIGEIATEQQLQTARLHIERGIRSWDISVSECDLDQQL---QLFITRHSAQFSAEVRGQRTLQHKSDVLETVVLVNPSEDTVISEI-HCLVSDPAVHKLLVLSGQSSDQGDLVLQTGVFSHQTFLRVFAEPGVSHLLGKASSGQRASLTVSCRSDAGWSSLGQQQR-IRELLNYTLN----PEPILPKMEGVTEFTEYISETVDVPSPFDLLEPPTSGGFLKLSKPCCYIF--PGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGING-------LLQRKVAEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIEEASLTLQYLNKLGIKPEPLFRVVSNTIEPITLFHKMGVGRLDMFVLNPVKDSKEMQFLMQKW-----AGNSKAKTGIILPNGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 523          
BLAST of Microtubule-associated protein futsch vs. Ensembl Zebrafish
Match: map1aa (microtubule-associated protein 1Aa [Source:ZFIN;Acc:ZDB-GENE-100426-2])

HSP 1 Score: 81.2629 bits (199), Expect = 6.456e-15
Identity = 114/502 (22.71%), Postives = 200/502 (39.84%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKASKTCLIKGLEQ---------VNKKFPNDYLFNGIEDCDFLGGIK--------LDNCEIEVIINSDKDGIINSIDEGLKSDNL---ILLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGY------------------ELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK--------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            ++++I +I  + QL + K  + +G+           +NK+     LF       F   +K         D  E  V++N  ++ I   I   L  D+    +L+  G+ T   G  IL  G F   NL  IL+    K   N        C    V  K +  + SL GY                  E+E V E   ++++       V     + +  T+ G  +L+     +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++     +R +  Q    +       L  +      L S        ++  KL    + LKA  +++        +  L +K +    + +N I+P+ LFHK+G G L+M  L P ++  EM+ F   W  +      +          S+P  +S T L+VW P S    I R+++ G+  P  +    +    H   DFL+ P
Sbjct:   40 MLIVIGDISTDHQLDSVKEHIKRGILSWDIDLTICDLNKELK---LFQARHSAQFSSEVKGQRLLQYKSDILETVVLVNPSEENIAIEI-RTLVCDSAGHKLLVLSGQSTDRSGDIILQSGAFGWKNLSDILSSRRIKDLLNQPYSGQQAC--LTVFCKGEGGWSSL-GYVQEQSILKYRLNPEPVLPEMEGVSEFTEYVSETVD----VPSPFELLEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNILIDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLL--QRKIAEQEEEKIH-----GLNTYGDWMKNLISPELGVVFFNVPEKLKMPESTLKAKRSIEEASLTLQYLHKLGIKPEPLYRVVSNTIEPLTLFHKLGVGKLDMYILNPLKDSKEMQFFMQKWAGNSKAKTGIVLANGKEGEISVPYLTSVTALVVWVPASPTEKIVRVLFPGN-APQNKIFEGLEKLRH--LDFLRYP 513          
BLAST of Microtubule-associated protein futsch vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 76.6406 bits (187), Expect = 1.661e-13
Identity = 66/273 (24.18%), Postives = 119/273 (43.59%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ++ +++             +      L S        ++  KL T  + LK   +++        ++ L +K +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK+   LP            +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGING-------LLQRKVAEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIEEASLTLQYLNKLGIKPEPLFRVVSNTIEPITLFHKMGVGRLDMFVLNPVKDSKEMQFLMQKW-----AGNSKAKTGIILPNGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 292          
BLAST of Microtubule-associated protein futsch vs. Ensembl Zebrafish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 76.6406 bits (187), Expect = 1.661e-13
Identity = 66/273 (24.18%), Postives = 119/273 (43.59%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ++ +++             +      L S        ++  KL T  + LK   +++        ++ L +K +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK+   LP            +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILIDGGSDRRSCFWKLVRHLDRIDSVLLTHIGADNLPGING-------LLQRKVAEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIEEASLTLQYLNKLGIKPEPLFRVVSNTIEPITLFHKMGVGRLDMFVLNPVKDSKEMQFLMQKW-----AGNSKAKTGIILPNGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 292          
BLAST of Microtubule-associated protein futsch vs. Ensembl Xenopus
Match: MAP1S (microtubule associated protein 1S [Source:NCBI gene;Acc:100494497])

HSP 1 Score: 72.7886 bits (177), Expect = 3.128e-12
Identity = 76/317 (23.97%), Postives = 134/317 (42.27%), Query Frame = 3
Query:  672 PSLYLFLDKGSSCC---------PALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAY-----ASTERD------MMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDS-LAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAP--LDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAP 1553
            PS   FL     CC          A   ++GF M+ N G    + + + V++  +ID  L++H+   +L G+++      A  + D         + + +L  P E  ++    A  +L +Q  +P  V    +    L  L+         L ++ +    +    ++P  LF K+G G LEM  L P +   E++     W  S+    + L  +  +SA VL+VW P      I R+++ G   P  + L  +    H   +FLK P   P  L+ +A+  +S R +T P    S+ + +SG    +   K+ P
Sbjct:  224 PSTVGFLKLFKPCCYVFPGGRGDSAFFAVNGFNMLMNGGSDTRSPFWKLVRHLDRIDSILLTHMGTDSLPGINSLLLRKIAEVDEDPSEGPQANEEWLKNLVSP-ELGVVFFNTAE-KLINQEDDPSVVKRNEEAIITLCCLE--------KLGIRPEPLHRVNVALMEPTILFQKMGVGRLEMYILNPVKGSKELEILTKQWTGSESLTGTDLPLACLTSACVLLVWHPAFPSEKIVRVLFPGC-TPQGKILEGLEKLKH--LEFLKAPVITPKDLEIVAENNLSERSSTKPKRTESKESLRSGSGRHSVELKVKP 527          
BLAST of Microtubule-associated protein futsch vs. Ensembl Xenopus
Match: pcbp2 (poly(rC) binding protein 2 [Source:Xenbase;Acc:XB-GENE-5903797])

HSP 1 Score: 72.7886 bits (177), Expect = 3.285e-12
Identity = 68/274 (24.82%), Postives = 117/274 (42.70%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAY-----ASTERDMM------SQRINHLFVPSEAALIDHRPASVQLQSQHANPF-HVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSL------AKSLP----SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALH--SSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++      A  E +        S  + +L  P    +  + P +++      NP  +  +R  L      L+      ++ L++K +       N I PI LF K+G G LEM  L P +   EM+ F   W  +      L         LP    +S + L+VW P +    I R+++ G+    +     I+  L      DFLKQP
Sbjct:  257 KPCCYIF--PGGRGDSALFAVNGFNMLVNGGSDRKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKMAELEEEQSQGSTTNSDWLKNLISPDLGVVFLNVPDNLK------NPEPNFKVRRSLEEACFTLQY-----LNKLSMKPEPLFRSVGNTIDPIILFQKMGVGKLEMYVLNPVKGSTEMQYFMQQWSGNNKEKTGLILPNGQEVELPVNYFTSISSLIVWHPANPSEKIVRVLFPGNTTQYQ-----ILEGLEKLKHLDFLKQP 512          
BLAST of Microtubule-associated protein futsch vs. Ensembl Xenopus
Match: MAP1A (microtubule associated protein 1A [Source:NCBI gene;Acc:100493436])

HSP 1 Score: 72.7886 bits (177), Expect = 3.991e-12
Identity = 117/538 (21.75%), Postives = 206/538 (38.29%), Query Frame = 3
Query:   78 KLIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPNDYLFNGIEDCDFLGGIKL-----------------------DNCEIEVIINSDKDGIINSIDEGLKSDNLILLYV--GEVTVPFGQWILHDGIFNSNNLHSIL----------NGDHQKIERNVVLVTPLPCEDW---------QVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQV--DTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGL-----------DAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISN-LAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK-------------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKT 1472
            +L+++I ++  E QL+A +  L +G+   N           ++ CD    +KL                       D  E  V++N + D I+  +   +   +   L++  G+ +   G  IL    F       +           N D +   +  + V+ L   DW          +I  K  P  +L         E D  I++ A +V+  +   S   +    N GG     +   +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G+           D   S      S  + +L  P    +  + P  +++             S +    +  +A   +Q  N L +K +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK             S+P  +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P     D  A  P + + T
Sbjct:   44 QLLIVIGDVSTESQLQAVRDHLERGIRSWNI---------SLDSCDLNYQLKLFAIRHLAHFSPDVKGQRTLQHRSDVLETVVLVNPNADSIVQEVRSLITGSSAHKLFILSGQSSEQEGDLILQTETFTYQRFEEVFSDPEVCQQLSNTDPET--KASLTVSCLGEGDWCNIGSSGFQDIIHIKLNPDLALP--------EMDG-ISEFADYVSETVDVPSPFDLLEPPNSGG----FLKLSKPCCYIF--PGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSILLTHIGADNLPGINGLLQRKIAEQDEEQSQGSTTYSDWMKNLISPELGVVFFNVPDKLKMP-----------ESNMKVKRSIEEACLTLQYLNKLGIKPEPLYRVVSNTIEPITLFHKMGVGRLDMYILNPVKDSKEMQFLMQKW-----AGNSKAKTGIILANGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYPVATQKDISAGIPTTTKHT 536          
BLAST of Microtubule-associated protein futsch vs. Ensembl Xenopus
Match: MAP1A (microtubule associated protein 1A [Source:NCBI gene;Acc:100493436])

HSP 1 Score: 70.4774 bits (171), Expect = 2.061e-11
Identity = 73/295 (24.75%), Postives = 124/295 (42.03%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGL-----------DAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISN-LAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK-------------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKT 1472
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G+           D   S      S  + +L  P    +  + P  +++             S +    +  +A   +Q  N L +K +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK             S+P  +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P     D  A  P + + T
Sbjct:  135 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSILLTHIGADNLPGINGLLQRKIAEQDEEQSQGSTTYSDWMKNLISPELGVVFFNVPDKLKMP-----------ESNMKVKRSIEEACLTLQYLNKLGIKPEPLYRVVSNTIEPITLFHKMGVGRLDMYILNPVKDSKEMQFLMQKW-----AGNSKAKTGIILANGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYPVATQKDISAGIPTTTKHT 408          
BLAST of Microtubule-associated protein futsch vs. Ensembl Mouse
Match: Map1a (microtubule-associated protein 1 A [Source:MGI Symbol;Acc:MGI:1306776])

HSP 1 Score: 84.3445 bits (207), Expect = 8.687e-16
Identity = 113/496 (22.78%), Postives = 204/496 (41.13%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPND------YLFNGIEDCDFLGGIK--------LDNCEIEVIINSDKDGIINSIDEGLKSDNL--ILLYVGEVTVPFGQWILHDGIFNSNNLHSILN--------GDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVS---ICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLG-----------LDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQL--QSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW---KKSK----YCNDSLAK-SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            L+++I +I  E QL+A +  L +G+   N    +        LF       F   +K         +  E  +++N   D I + +   L S +   +L+  G+   P G  IL  G ++  N   +L+         +     +  + V+ L   DW  +               E V  T   +A+ + +V+  +   S   + +  T+ G  +L+     +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G           L+   S      S  + +L  P    +  + P  ++L   S+ A       RS     LT         ++ L ++A+    + +N I+P+ LFHK+G G L+M  L P ++  EM+     W    K+K      N   A+ S+P  +S T L+VW P +    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   57 LLIVIGDIGTESQLRAVRAHLEQGILSWNIDLSSFDLNQQLRLFITRHLAHFSSEVKGQRTLCHQSETLETIILVNPTADSISSEVHHLLSSPSAHKLLILSGQTLEPEGDLILQSGTYSYQNFAQVLHKPEIAQLLSNRDPGIQAFLTVSCLGEGDWSHLGLSSSQETLHLRLNPEPVLPTMDGVAEFSEYVSETVDVPSPFDLLEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPDKLRLPDASRKAK------RSIEEACLT------LQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLANGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGN-APQNKILEGLEKLRH--LDFLRYP 530          
BLAST of Microtubule-associated protein futsch vs. Ensembl Mouse
Match: Map1b (microtubule-associated protein 1B [Source:MGI Symbol;Acc:MGI:1306778])

HSP 1 Score: 73.1738 bits (178), Expect = 1.972e-12
Identity = 99/447 (22.15%), Postives = 182/447 (40.72%), Query Frame = 3
Query:  282 IINSIDEGLKSD----------NLILLYVGEVTVPFGQWILHDG---------IFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQV--IEKKQLPYFSLCGYE----LEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLA-KKPVSARKTTPPV 1484
            +IN  DE + ++          + +L+  G+     G+ IL  G         IF    +  +L+  H   + ++ L  P    DW+   +++  L  F          L E++    F   ++  V  V     I +  T+ G  +L+     +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++       M+ ++I  L          +      L S       +++   L      +K   +++        ++ L++K +       N I+P+ LF K+G G LEM  L P +   EM+ F   W  +    D     LP            +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP       LA +K ++ +  TPPV
Sbjct:  112 LINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEG-DWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVE-VPSPFDILEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINS-------MLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNVPENLKDPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIEPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTN--KDKAELILPNGQEVDIPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKLK-HLDFLKQP-------LATQKDLTGQVPTPPV 530          
BLAST of Microtubule-associated protein futsch vs. Ensembl Mouse
Match: Map1a (microtubule-associated protein 1 A [Source:MGI Symbol;Acc:MGI:1306776])

HSP 1 Score: 73.1738 bits (178), Expect = 2.274e-12
Identity = 71/273 (26.01%), Postives = 122/273 (44.69%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLG-----------LDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQL--QSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW---KKSK----YCNDSLAK-SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G           L+   S      S  + +L  P    +  + P  ++L   S+ A       RS     LT         ++ L ++A+    + +N I+P+ LFHK+G G L+M  L P ++  EM+     W    K+K      N   A+ S+P  +S T L+VW P +    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPDKLRLPDASRKAK------RSIEEACLT------LQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLANGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGN-APQNKILEGLEKLRH--LDFLRYP 292          
BLAST of Microtubule-associated protein futsch vs. UniProt/SwissProt
Match: sp|Q9W596|FUTSC_DROME (Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4)

HSP 1 Score: 93.5893 bits (231), Expect = 9.133e-18
Identity = 90/346 (26.01%), Postives = 155/346 (44.80%), Query Frame = 3
Query:  360 GQWILHDGIFNSNNLHSILNG-DHQKIERNV--VLVTPLPCED---WQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQV-DTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDM-MSQRINHLF--VPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW----KKSKYCNDSLAKSLP----SSATVLMVWKPFSNKAPIKRIIYVGS 1343
            G WIL DG F+  +        D Q++ R     +   + C D   W  + +K   +   C   +  VD  D     + GF++ +   V    + +  +    +  I    P+LY+F   G     AL  ++GF M+ + GF+R A +  + ++  ++D  LM+ L  SN+ GL A  S +RD  +  +I H F  VP      D +        +  +P  +DL  +   +++ LKA        L +K +       NQ +P+ L+HK+G+G+L+M  + P  +  E+K+F   W    ++     DS   + P     S   L+VW+P +    I RI++ GS
Sbjct:  227 GSWILQDGTFSVADFSEAFQEHDVQRVIRAYADTITMNIHCADAGLWHTLPEKA--FARQCRIRINPVDVLDTSSECINGFIDYLAPMVMPTSLRELLETSDVVGNIRFTHPTLYVF--PGGQGDAALFGINGFNMLVDGGFNRKACFWDFARHLDRLDAVLMTRLNNSNVQGLGAVVSRKRDAHVYPQIGHFFGNVP------DRKGLPSPDGDKDRDPLLIDLFERGHGIVSDLKA--------LDLKPQ---CCYRNQ-EPVNLYHKVGHGTLDMYVISPARDSKEVKEFLQKWHAGDQRLFAARDSRDFNFPLQNLVSICALLVWQPANPDDTITRILFPGS 550          
BLAST of Microtubule-associated protein futsch vs. UniProt/SwissProt
Match: sp|P15205|MAP1B_RAT (Microtubule-associated protein 1B OS=Rattus norvegicus OX=10116 GN=Map1b PE=1 SV=3)

HSP 1 Score: 77.0258 bits (188), Expect = 1.085e-12
Identity = 125/516 (24.22%), Postives = 212/516 (41.09%), Query Frame = 3
Query:  282 IINSIDEGLKSD----------NLILLYVGEVTVPFGQWILHDG---------IFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQV--IEKKQLPYFSLCGYE----LEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLD-------AYASTERDMMSQR----INHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISN-LAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLA-KKPVSARKTTPPVS-------ATSRGASK------SGDSALTNAKKLAPTAEKPSR----PITVSAPPVHAGKELPGK 1628
            +IN  DE + ++          + +L+  G+     G+ IL  G         IF    +  +L+  H   + ++ L  P    DW+   +++  L  F          L E++    F   ++  V  V     I +  T+ G  +L+     +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G++       A    ER   S      + +L  P    +  + P +++      NP   +++ K  T     +A   +Q  N L++K +       N I+P+ LF K+G G LEM  L P +   EM+ F   W  +    D     LP            +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP       LA +K ++ + +TPPV        A SR + K      S  S    +K+ AP A K S+    P   S   V   K+ PGK
Sbjct:  112 LINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEG-DWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVE-VPSPFDILEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNVPENLK------NP-EPNIKMKRSTE----EACFTLQYLNKLSMKPEPLFRSVGNAIEPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTN--KDKAELILPNGQEVDIPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKLK-HLDFLKQP-------LATQKDLTGQVSTPPVKQVKLKQRADSRESLKPATKPLSSKSVRKESKEEAPEATKASQVEKTPKVESKEKVIVKKDKPGK 595          
BLAST of Microtubule-associated protein futsch vs. UniProt/SwissProt
Match: sp|P46821|MAP1B_HUMAN (Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2)

HSP 1 Score: 73.559 bits (179), Expect = 1.080e-11
Identity = 111/501 (22.16%), Postives = 202/501 (40.32%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKAS-----------KTCLIK-GLEQVNKKFPNDYLFNGIEDCDF---LGGIKL-----DNCEIEVIINSDKDGIINSIDEGLK--SDNLILLYVGEVTVPFGQWILHDG---------IFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQV--IEKKQLPYFSLCGYE----LEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWK-----KSKYC-----NDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            L+V++ EI  EE L+ +            T LI+  L+Q  K      LF       F   + G K+     D  E  V+IN   + +   +   +   + + +L+  G+     G+ IL  G         IF    +  +L+  H   + ++ L  P    DW+   +++  L  F          L E++    F   ++  V  V     I +  T+ G  +L+     +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++       M+ ++I  L          +      L S       +++   L      +K   +++        ++ L++K +       N I P+ LF K+G G LEM  L P +   EM+ F   W      K+++         L  S  +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP
Sbjct:   39 LLVVVGEIVTEEHLRRAIGNIELGIRSWDTNLIECNLDQELK------LFVSRHSARFSPEVPGQKILHHRSDVLETVVLINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEG-DWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVE-VPSPFDILEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINS-------MLQRKIAELEEEQSQGSTTNSDWMKNLISPDLGVVFLNVPENLKNPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIDPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTNKDKAEFILPNGQEVDLPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKLK-HLDFLKQP 514          
BLAST of Microtubule-associated protein futsch vs. UniProt/SwissProt
Match: sp|P14873|MAP1B_MOUSE (Microtubule-associated protein 1B OS=Mus musculus OX=10090 GN=Map1b PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 1.380e-11
Identity = 99/447 (22.15%), Postives = 182/447 (40.72%), Query Frame = 3
Query:  282 IINSIDEGLKSD----------NLILLYVGEVTVPFGQWILHDG---------IFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQV--IEKKQLPYFSLCGYE----LEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLA-KKPVSARKTTPPV 1484
            +IN  DE + ++          + +L+  G+     G+ IL  G         IF    +  +L+  H   + ++ L  P    DW+   +++  L  F          L E++    F   ++  V  V     I +  T+ G  +L+     +P  Y+F   G     AL  ++GF M+ N G  R + + + +++  ++D  L++H+   NL G+++       M+ ++I  L          +      L S       +++   L      +K   +++        ++ L++K +       N I+P+ LF K+G G LEM  L P +   EM+ F   W  +    D     LP            +S + L+VW P +    I R+++ G+    + N+   +  L    DFLKQP       LA +K ++ +  TPPV
Sbjct:  112 LINPSDEAVSTEVRLMITDAARHKLLVLTGQCFENTGELILQSGSFSFQNFIEIFTDQEIGELLSTTHPANKASLTLFCPEEG-DWKNSNLDRHNLQDFINIKLNSASILPEMEGLSEFTEYLSESVE-VPSPFDILEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNMLINGGSERKSCFWKLIRHLDRVDSILLTHIGDDNLPGINS-------MLQRKIAELEEERSQGSTSNSDWMKNLISPDLGVVFLNVPENLKDPEPNIKMKRSIEEACFTLQYLNKLSMKPEPLFRSVGNTIEPVILFQKMGVGKLEMYVLNPVKSSKEMQYFMQQWTGTN--KDKAELILPNGQEVDIPISYLTSVSSLIVWHPANPAEKIIRVLFPGNST--QYNILEGLEKLK-HLDFLKQP-------LATQKDLTGQVPTPPV 530          
BLAST of Microtubule-associated protein futsch vs. UniProt/SwissProt
Match: sp|P34926|MAP1A_RAT (Microtubule-associated protein 1A OS=Rattus norvegicus OX=10116 GN=Map1a PE=1 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 1.577e-11
Identity = 71/273 (26.01%), Postives = 122/273 (44.69%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLG-----------LDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQL--QSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDW---KKSK----YCNDSLAK-SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G           L+   S      S  + +L  P    +  + P  ++L   S+ A       RS     LT         ++ L ++A+    + +N I+P+ LFHK+G G L+M  L P ++  EM+     W    K+K      N   A+ S+P  +S T L+VW P +    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLLQRKVAELEEEQSQGSSSYSDWVKNLISPELGVVFFNVPDKLRLPDASRKAK------RSIEEACLT------LQHLNRLGIQAEPLYRVVSNTIEPLTLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGIVLANGKEAEISVPYLTSITALVVWLPANPTEKIVRVLFPGN-APQNKILEGLEKLRH--LDFLRYP 292          
BLAST of Microtubule-associated protein futsch vs. TrEMBL
Match: A0A433UCY1 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_000468 PE=4 SV=1)

HSP 1 Score: 132.88 bits (333), Expect = 1.485e-27
Identity = 121/440 (27.50%), Postives = 200/440 (45.45%), Query Frame = 3
Query:  237 DNCEIEVIINSDKDGIINSIDEGLKSDNLI--LLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDH------QKIERNVVLVTPLPCEDWQVIEKKQLPYFSLC-----GYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTER-DMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVK-------AKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLPS------SATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALH--SSFDFLKQPEYAPLDGLAKKPVSARK 1469
            +N  +E+++N     + NSI + L + + I  ++Y G      G WIL D  F  NNL  +           Q  E N+ + TP+    W     +     SL         LE V     F+A ++ F+  V+   S+ Q     G  Q   I+  RP+LY+F   G     AL  + GF ++ N G++R A +  + ++  ++D  LM+HL   NL GL+A    +  D +  +I +L+  +    +D +P +    SQ       D   K  ++L  + +  A +I+ +A +           AA+     +P+ L+HK+G+GSL+M  L P  +  E+K+F   W K      S+ +S P       S   L+VWKP++    I RI + G+ CP  +    +I  L    +F+FLKQ      D +  KPV+ +K
Sbjct:   85 ENLGVEILVNPLAQSVKNSIKKLLIAPSPIKYIIYAGHAFQGSGAWILQDDTFAFNNLAQVFKNVEVETALKQNFEANLTIHTPVADSSWGAAISRADATNSLRIQLNPPARLENVHGVMQFLAYVSSFIR-VVPITSLLQ-----GSEQFGNISFTRPTLYIF--PGCQGDSALFGISGFNLLVNGGYNRRACFWDFARHLDRVDAMLMTHLDSDNLFGLNAVLQRKSLDNIHPQIGYLYFNA----LD-KPGAFSAPSQTTG----DGEEKQVSLLVNI-SEEAGKITQMAKQLGISPHPCMHNAAVPV--CEPVNLYHKLGHGSLDMYILNPVSDTKELKEFFQAWSKQA---PSMGQSGPFPLQHVLSVCTLLVWKPYNYDEKIVRIFFPGN-CPQHK----VIEGLEKMKTFNFLKQASCTARDLM--KPVAVKK 494          
BLAST of Microtubule-associated protein futsch vs. TrEMBL
Match: A0A2C9LV39 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078513 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.153e-24
Identity = 142/536 (26.49%), Postives = 220/536 (41.04%), Query Frame = 3
Query:  237 DNCEIEVIINSDKDGIINSIDEGL--KSDNLILLYVGEVTVPFGQWILHDGIFNSNNLHSIL------NGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAF--IAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTER-DMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLPS----SATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALH--SSFDFLK------------QPEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAPPVHAGKELPGKRPQTA-----------TGGLGGGKPKSEPPKQAHEPPTKKPAA 1724
            D   +E++IN     + NSI + L   S+   ++Y G      G W+L D  F  NNL  I       N   Q IE N+ + T L   +W     K   + S    +L   ++ D    + +   ++ + L  V I  +   Q   Q   I   RP+LY+F   G     AL  ++GF ++ N GF+R A +  + ++  ++D  LM+HL   N+ GL+     +  + +  +I +L+  +  + +     +   QS       ++L  +   M    K  G      L        + T    +PI L+HK+G+GSL+M  L P  +  E+K+F+  W K    N   +   P     S   L+VWKP++    I RI   G+  P  +    +I  L    SF +LK             P   PL G A KP S+R    PV +T+     S  S L N    A  +E   R +T     V   KE   K+  T            T     GKP S P   +   PTK+P +
Sbjct:   76 DKIAVEILINPLSQTVKNSIKKLLLSPSETKFIIYAGNAFQGSGAWVLQDDTFAFNNLAQIFKNVDVENALKQNIEANLTIHT-LADSNWGTSISK-ADFTSHLRIQLNPQEKLDNIHGVVQFTAYIGSFLKVVPITNL--LQASEQFGNIGFTRPTLYIF--PGCQGDSALFGINGFNLLVNGGFNRRACFWDFARHLDRVDAMLMTHLGTDNIFGLNTVLQRKSLENIHPQIGYLYFNTVLSSVGGDGDTAPSQSS----LLINLAEEACKMTQMAKQLGISPQPCLR-------SATGETCEPINLYHKLGHGSLDMYVLNPVADSKELKEFYQAWSKHS-VNLGTSGPFPMQNVLSVCALLVWKPYNLDEKIVRIFLPGN-APQHK----VIEGLEKVKSFGYLKLAACTNRDLIKPPPVKKPLAG-AAKPGSSR----PVKSTT-----STRSDLANKPVSATRSEPIKRTVTSPTKAVKTIKEETNKKKLTTKEKSADNDTKKTERDQKGKPSSRPTSAS---PTKRPTS 575          
BLAST of Microtubule-associated protein futsch vs. TrEMBL
Match: A0A2C9LV56 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106078513 PE=4 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 2.274e-24
Identity = 142/536 (26.49%), Postives = 220/536 (41.04%), Query Frame = 3
Query:  237 DNCEIEVIINSDKDGIINSIDEGL--KSDNLILLYVGEVTVPFGQWILHDGIFNSNNLHSIL------NGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAF--IAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTER-DMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLPS----SATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALH--SSFDFLK------------QPEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAPPVHAGKELPGKRPQTA-----------TGGLGGGKPKSEPPKQAHEPPTKKPAA 1724
            D   +E++IN     + NSI + L   S+   ++Y G      G W+L D  F  NNL  I       N   Q IE N+ + T L   +W     K   + S    +L   ++ D    + +   ++ + L  V I  +   Q   Q   I   RP+LY+F   G     AL  ++GF ++ N GF+R A +  + ++  ++D  LM+HL   N+ GL+     +  + +  +I +L+  +  + +     +   QS       ++L  +   M    K  G      L        + T    +PI L+HK+G+GSL+M  L P  +  E+K+F+  W K    N   +   P     S   L+VWKP++    I RI   G+  P  +    +I  L    SF +LK             P   PL G A KP S+R    PV +T+     S  S L N    A  +E   R +T     V   KE   K+  T            T     GKP S P   +   PTK+P +
Sbjct:   82 DKIAVEILINPLSQTVKNSIKKLLLSPSETKFIIYAGNAFQGSGAWVLQDDTFAFNNLAQIFKNVDVENALKQNIEANLTIHT-LADSNWGTSISK-ADFTSHLRIQLNPQEKLDNIHGVVQFTAYIGSFLKVVPITNL--LQASEQFGNIGFTRPTLYIF--PGCQGDSALFGINGFNLLVNGGFNRRACFWDFARHLDRVDAMLMTHLGTDNIFGLNTVLQRKSLENIHPQIGYLYFNTVLSSVGGDGDTAPSQSS----LLINLAEEACKMTQMAKQLGISPQPCLR-------SATGETCEPINLYHKLGHGSLDMYVLNPVADSKELKEFYQAWSKHS-VNLGTSGPFPMQNVLSVCALLVWKPYNLDEKIVRIFLPGN-APQHK----VIEGLEKVKSFGYLKLAACTNRDLIKPPPVKKPLAG-AAKPGSSR----PVKSTT-----STRSDLANKPVSATRSEPIKRTVTSPTKAVKTIKEETNKKKLTTKEKSADNDTKKTERDQKGKPSSRPTSAS---PTKRPTS 581          
BLAST of Microtubule-associated protein futsch vs. TrEMBL
Match: K1PNL0 (Microtubule-associated protein futsch OS=Crassostrea gigas OX=29159 GN=CGI_10019640 PE=4 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.394e-20
Identity = 134/568 (23.59%), Postives = 239/568 (42.08%), Query Frame = 3
Query:  327 LLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELE--EVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERD-MMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKS--------GAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLP----SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLD----GLAKKPVSARKTTPPVS---ATSRGASKSGDSA--------------LTNAKKLAPTAEKPSRPITVSAPPVHAGKEL--PGKRP-QTATGGLGGG----------KPKSEPPKQAHEP-PTKKPAAQTNTGKALSNASTPAPKKQQPVAPSHKKVADSKPQIKDA----GHVKPAKPK 1868
            L++ G      G W+L D IF+ + + S+LN    KI+     V      +W+ +   ++  F   G+ +   E       I + A +++  +  ++I   D  +    + ++    P++Y+F   G     AL  +  F ++ N GF R + +  + ++ ++ID  L++HL   N+ G+ +    + +  +S  I ++++                  + A+P         G  L  LK N A + + +    K           A +++ + P+ L+HK+G+G+L+M  L P  +  E+K+F   W+K+   +  +++ +P     S   L+VWKP +    I RI++ G+  P  +    +    H   DFLK P  +  D    G  KKP +A   T P S   A  R + ++G +A              L    K  P+ +  + P +VS   V +  E   P K+  Q +   L              PK   PK   EP  T KP  + ++ K   + STP  K  +PVA S  K A  + + + +        P KPK
Sbjct:  132 LVFAGPYMEGSGAWVLQDDIFSVSKVASVLNDPKLKIKSKKFCVQCHQEGEWKQVNLLKVAGFKDHGFTVTPTETQTNHHGIIQFAAYISNFVKPMTI--TDLMKSTDLVGSLKFTSPTMYIF--PGCEGDSALFAMREFNLLINGGFRRKSCFWDFARHLERIDAMLITHLGIDNVFGMSSLLQRKSEGKVSTDIGYVYM--------------NASEKSASPN--------GLKLASLKINVAEEGTGIVEACKKIGLAPHPCTRANSSSPLAPVNLYHKVGHGTLDMYVLNPVADSKELKEFLQQWQKNG-ADFGISQGMPLPNLVSICALLVWKPANPSEKIIRILFPGN-APQHKIAEGLEKVKH--LDFLKFPSCSAKDLSSKGAGKKPPAA--ATRPSSGKPAVGRLSLEAGKAAAKPPNDTKAASSKSLNGQSKARPSTDHKAPPKSVSDTKVSSKAEATKPEKKDVQRSKSDLNKTVDKHKAKPIESPKHTAPKAKVEPKKTSKPPEEKSSNKGTPSKSTPK-KDIKPVAESTPKKASPEKETRKSPVKNKAATPTKPK 666          
BLAST of Microtubule-associated protein futsch vs. TrEMBL
Match: A0A1B6M4Q5 (Uncharacterized protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.46716 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 3.373e-19
Identity = 133/522 (25.48%), Postives = 227/522 (43.49%), Query Frame = 3
Query:  327 LLYVGEVTVPFGQWILHDGIFNSNNL-HSILNGDHQKIER---NVVLVTP--LPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAA-ITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLA-VKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCND-----SLAK-------SLP----SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHS--SFDFLKQPEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNA--KKLAPTAEKPSRPITVSAPPVHAGKELPGKR--PQTAT---GGLGGGKPKSEPPKQAHEPPTK--KPAAQTNTGKALSNASTPAPKKQQP 1787
            +++ G      G WI+ DG F+  +L  +    + Q++ R   N V V     P  DW     ++  +  LC   +   D++ +  A +  FV+ +   V    V+     S +   I    P+LY+F   G     AL  ++GF M+ + GF+R A +  + ++  ++D  LM+ +  SN+ GL +       +  ++I+H++       + H   ++Q + Q   P    +R  L   L  L   G   + NL  ++ K    +  + ++PI L+HK+G+G L+M  + P ++  E+K+F   W    + ND     S+ +       S P     S   L+VW+P + +  I RI++ GS  P  +    I   L    S DF+KQ            PV   KT  P S+T   ++K   +  T A   KL P  E  ++P+  S     A  E   K+  P+ AT    G    K  S P ++  +P  +  KP  +T   K +    T  PK+ +P
Sbjct:   53 IIHAGYTFAGNGSWIVQDGTFSLADLIDAFQETEVQRVLRAYENSVTVDIHCAPEGDWSTARLRRESFTKLCKVRVNP-DDSPSPAANIQQFVDYLAPFVRPASVEQLLEPSDVVGNIRFSHPTLYVF--PGGQGDAALFGINGFNMLVDGGFARKACFWDFARHLDRLDAVLMTRINNSNVNGLASV------LRRKKISHVY-----PQVGHFFCNLQDRKQPTTPDEEKVRDPL---LVSLLDEGQEMVQNLRHLQLKPHHCVRESVLEPINLYHKVGHGKLDMYVISPSKDSKELKEFLSKW----HSNDISMFNSVTRKPGDKDISFPLQNLVSICALLVWQPANPEDTITRILFPGS-TPQHK----IFEGLEKLRSLDFMKQ------------PVCTAKTLSPSSSTIGISTKVSRTKSTPAVIDKLLP-GEGLTKPVMKST----AQTETVTKQNVPKNATIPVSGESKTKLTSAPVQKISKPKQEKVKPDNKTEVEKEIETDVTVLPKQDKP 531          
BLAST of Microtubule-associated protein futsch vs. Ensembl Cavefish
Match: map1aa (microtubule-associated protein 1Aa [Source:ZFIN;Acc:ZDB-GENE-100426-2])

HSP 1 Score: 90.5077 bits (223), Expect = 7.821e-18
Identity = 109/493 (22.11%), Postives = 194/493 (39.35%), Query Frame = 3
Query:   84 IVIISEIWNEEQLKASKTCLIKGLEQ---------VNKKFPNDYLFNGIEDCDFLGGIK--------LDNCEIEVIINSDKDGIINSIDEGL--KSDNLILLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDHQK-------IERNVVLVTPLPCED-WQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVL---GKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK--------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +++I E+  E QL+  K  + +GL           +N++     LF       F   +K         D  E  V++N   D I   I   L   + + +L+  G+ T   G  IL  G+FN  +   I+     K             L    P E  W  +E KQ  Y        E V      +A+   +V+  +       + +  T+ G  +L+     +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   N+ G++        ++ ++I             +      L S        ++  KL T    LK   +++        +S L ++ +    + +N I+P+ LFHK+G G L+M  L P ++  EM  F   W  +      +          S+P  +S T L+VW P S    I R+++ G+  P  +    +    H   DFL+ P
Sbjct:   43 LIVIGELSGEHQLEKVKDRIKQGLHSWPVDLSVCNLNQEL---QLFETKHSAQFSSEVKGQRLLQYKSDVLETVVLVNPSADNIAIEIRTLLCDSAKHKLLILSGQSTEQGGDIILQKGVFNWKSFSDIITSQRVKNFLRQSGPAEQACLTVCCPAEGAWSSLELKQEQYLLDIRLNPEPVLPEMEGVAEFTEYVSETVDVPSPFELLEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNILIDGGSDRKSCFWKLVRHLDRIDSVLLTHIGADNIPGING-------LLQRKIAEQEEEQSQGSNAYGEWMKNLISPELGVVFFNVPDKLKTSEPTLKVKRSIEEASLTLQYLSKLGIRPEPLYRVVSNTIEPVTLFHKLGVGKLDMYILNPVKDSKEMHFFMQKWAGNSKAKTGITLANGKEGEISVPYLTSVTALVVWVPASPTEKIVRVLFPGN-APQNKIFEGLEKLRH--LDFLRYP 515          
BLAST of Microtubule-associated protein futsch vs. Ensembl Cavefish
Match: map1ab (microtubule-associated protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-100426-3])

HSP 1 Score: 81.6481 bits (200), Expect = 4.534e-15
Identity = 110/500 (22.00%), Postives = 200/500 (40.00%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKASKTCLIKGLEQ---------VNKKFPNDYLFNGIEDCDFLGGIK--------LDNCEIEVIINSDKDGIINSIDEGLKSDNLI--LLYVGEVTVPFGQWILHDGIFNSNNLHSILN--GDHQKIE------RNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAG---FVNAVLGKVSI-CQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ--------ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            L+++I EI  E+QL+ +K  + +G+           ++K+     LF       F   ++         D  E  V++N   D +++ I + L SD  +  LL +       G  IL  G+F    L  +    G    +E      R  + V+      W  + ++   +     Y+L      +  + KM G   F   +   V +    D  +  +    +   +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ++ ++I             +      L S        ++  KL T  + LK   +++        +  L +K +    + +N I+PI LFHK+G G L+M  L P +E  EM+     W       +S AK+   LP            +S T L+VW P +    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   41 LLIVIGEIGTEQQLQTAKQQIERGIRSWDINLAVCDLDKQL---QLFITRHSAHFSAEVRGQRILHHRSDVLETVVLVNPSGDTVLSEI-QSLVSDPAVHKLLVLSGQNSDQGDLILQTGVFTYQALSRVFADPGVTHLLEKADPGQRATLTVSCRAEAGWTSLGQRLKEFL---DYKLN----PEPVLPKMEGVTEFTEYISETVDVPSPFDLLEPPTSGGFLKLSKPCCYIF--PGGRGDSALFAVNGFNILIDGGSERRSCFWKLVRHLDRIDSILLTHIGADNLPGING-------LLQRKIAEQEEEQSQGSTTYSDWMKNLISPELGVVFFNVPEKLRTSESNLKVKRSIEEASLTLQYLDKLGIKPEPLFRVVSNTIEPITLFHKMGVGRLDMFVLNPVKESKEMQFLMQKW-----AGNSKAKTGIVLPNGKEGEISVPYLTSVTALVVWLPANPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 512          
BLAST of Microtubule-associated protein futsch vs. Ensembl Cavefish
Match: map1b (microtubule associated protein 1B [Source:NCBI gene;Acc:103047754])

HSP 1 Score: 75.0998 bits (183), Expect = 3.708e-13
Identity = 63/245 (25.71%), Postives = 110/245 (44.90%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAY-----ASTERDMM------SQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSL------AKSLP----SSATVLMVWKPFSNKAPIKRIIYVG 1340
            +P  Y+F   G     AL  ++GF M+ N G +R A + + V++  ++D  L++H+   NL G+++      A  E +        S  + ++  P    +  + P +++    +  P H   R+     +TQ        +S L++K +       N I+PI LF K+G G LEM  L P +   E++ F   W  S+    S+         LP    SS + L+VW P +    I R+++ G
Sbjct:  263 KPCCYIF--PGGRGDSALFAVNGFNMLVNGGSNRKACFWKLVRHLDRVDSILLTHIGDDNLPGINSMLQRKIAELEEEQSQGSTANSDWMKNMISPDIGVVFLNLPETLE----NPEPNHRVRRNIAEAAITQ------QYLSKLSLKPEPLQKNVGNTIEPIILFQKMGVGKLEMYVLNPAKNSKELQYFMKQWTGSEKDKASVLLPNGNESELPISYLSSISALIVWHPSNPSEKIVRVLFPG 495          
BLAST of Microtubule-associated protein futsch vs. Ensembl Cavefish
Match: map1sb (microtubule-associated protein 1S-like [Source:NCBI gene;Acc:103035879])

HSP 1 Score: 67.0106 bits (162), Expect = 9.386e-11
Identity = 80/342 (23.39%), Postives = 138/342 (40.35%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAY-----ASTERDMMS------QRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSK--YCNDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP------------EYAP--------LDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAP 1595
            RP  Y+F      C  A   ++GF ++ N G    + + + V++  ++D  L++H    NL G+++      A  E D  S      + + +L  P    +  + P   +L+    +P  +    +    L  L+        NL +  +     +   I+P+ LF K+G G LE+  L P +   E + F   W +S        +  +   S   L+VW P S    I R+++ GS  P  + L  +    H   +FLK+P            E  P        L    K+  ++  +  P   ++ G S+  D A   A   APTAE+ S  + +S P
Sbjct:  209 RPCCYIFPGGRGDC--AFFAVNGFNVLVNGGADARSCFWKLVRHLDRVDSVLLTHAGTDNLPGINSLFERKVAELEEDDSSNFNKKEKWLKNLISPELGVVFFNAPN--RLKKLQGDPNVLKSSDQAALTLRHLE--------NLKISPEQLLRNSNGSIEPVILFQKMGVGCLELYVLNPIKRSKEFEAFMHSWPESSPNLKGSEIPLNCLVSICALLVWHPASPHEKIIRVLFPGS-TPQGKILDGLEKLKH--LEFLKKPVVCSKDIESTKSEKNPKRAESQDSLKSSTKESRTSNASAAPKERSTHGYSEPKDKARV-ANVNAPTAEENSGNLKLSKP 534          
BLAST of Microtubule-associated protein futsch vs. Ensembl Cavefish
Match: map1sb (microtubule-associated protein 1S-like [Source:NCBI gene;Acc:103035879])

HSP 1 Score: 67.0106 bits (162), Expect = 1.037e-10
Identity = 80/342 (23.39%), Postives = 138/342 (40.35%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAY-----ASTERDMMS------QRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSK--YCNDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP------------EYAP--------LDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAP 1595
            RP  Y+F      C  A   ++GF ++ N G    + + + V++  ++D  L++H    NL G+++      A  E D  S      + + +L  P    +  + P   +L+    +P  +    +    L  L+        NL +  +     +   I+P+ LF K+G G LE+  L P +   E + F   W +S        +  +   S   L+VW P S    I R+++ GS  P  + L  +    H   +FLK+P            E  P        L    K+  ++  +  P   ++ G S+  D A   A   APTAE+ S  + +S P
Sbjct:  243 RPCCYIFPGGRGDC--AFFAVNGFNVLVNGGADARSCFWKLVRHLDRVDSVLLTHAGTDNLPGINSLFERKVAELEEDDSSNFNKKEKWLKNLISPELGVVFFNAPN--RLKKLQGDPNVLKSSDQAALTLRHLE--------NLKISPEQLLRNSNGSIEPVILFQKMGVGCLELYVLNPIKRSKEFEAFMHSWPESSPNLKGSEIPLNCLVSICALLVWHPASPHEKIIRVLFPGS-TPQGKILDGLEKLKH--LEFLKKPVVCSKDIESTKSEKNPKRAESQDSLKSSTKESRTSNASAAPKERSTHGYSEPKDKARV-ANVNAPTAEENSGNLKLSKP 568          
BLAST of Microtubule-associated protein futsch vs. Ensembl Medaka
Match: map1ab (microtubule-associated protein 1A [Source:NCBI gene;Acc:101157288])

HSP 1 Score: 83.5741 bits (205), Expect = 1.134e-15
Identity = 113/510 (22.16%), Postives = 208/510 (40.78%), Query Frame = 3
Query:   72 SNKLIVIISEIWNEEQLKASKTCLIKGLEQ---------VNKKFPNDYLFNGIEDCDFLGGIK--------LDNCEIEVIINSDKDGIINSIDEGLKSDNL--ILLYVGEVTVPFGQWILHDGIFNSNNLHSILN--------GDHQKIERNVVLVTPLPCEDWQVIEKKQLPYF-SLCGYELEEVDETDAFIAKMAG---FVNAVLGKVSI-CQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINH-------------LFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ-ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            S+ ++++I EI  E+QL+ ++  + +G+           ++++     LF       F   ++         D  E  V++N  +D +I+ I + L +D+    LL +   +   G  +L  G+FN      ++         G     ++  + V+      W  +   QLP    +  Y+L      +  + KM G   F   V   V +    D  +  +    +   +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++     +R +  Q   H             L  P    +  + P  +++             S L    +  +A+  +Q +S L VK +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK+   LP            +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:   61 SHYMLIVIGEIGTEQQLETARAQIERGIRSWDLDLQRCDLDQQL---QLFITRHSAHFSSEVRGQRTLHHRSDVLETVVLVNPSEDSVISEI-QTLLTDSAGHKLLVLSGQSSDHGGLLLQTGVFNYQIFSRVITDPGVTALLGTAAPKQQATLTVSCRGEVGWSSL--GQLPPLRDIVDYKLN----PEPVLPKMDGVKEFTEYVSETVDVPSPFDLLEPPTSGGFLKLSKPCCYIF--PGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSMLLTHIGADNLPGINGLL--QRKIAEQDEEHSQGSMNCSDWMKNLISPELGVVFFNVPEKLRMP-----------ESNLKVKRSIEEASLTLQYLSKLGVKPEPLFRVVSNTIEPITLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKW-----AGNSKAKTGIVLPNGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 537          
BLAST of Microtubule-associated protein futsch vs. Ensembl Medaka
Match: map1b (microtubule associated protein 1B [Source:NCBI gene;Acc:101156753])

HSP 1 Score: 79.337 bits (194), Expect = 1.781e-14
Identity = 111/514 (21.60%), Postives = 208/514 (40.47%), Query Frame = 3
Query:   81 LIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPNDYLFNGIEDCDFLGGIKLDNCEIEVIINSDKDG---------------IINSIDEGLKSD----------NLILLYVGEVTVPFGQWILHD---------GIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQ--VIEKKQLPYF-------SLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAY-----ASTERDMM------SQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALH--SSFDFLKQP 1418
            L+V+I EI +++QLK    C I  +E+  + +  + +     DC+    +KL         ++D  G               +IN  DE + ++          + +L+  G+ +   G+ IL            IF    +  +L+  H   + N+ L  P    DW+   ++K  L  F       +L   E+E + E   ++++       +     + +  T+ G  +L+     +P  Y+F   G     AL  ++GF M+ N G  R + + + V++  ++D  L++H+   NL G+++      A  E +        S  + ++  P    +  + P ++        P +   R+     LTQ        +S L ++ +       N I+P+ LF K+G G L+M  L P +   EM+ F   W   +   D+++  LP            +S + L+VW P +    + R+++ G+      N   I   L      DFLKQP
Sbjct:   35 LLVVIGEITSDDQLK----CAIADIEKGIRSWDTNLI-----DCNLDQELKLFVSRHSARFSADVKGQRILHHKSPVLETVVLINPSDEAVSTEVRLMISDVARHKLLVLSGQCSENTGELILQSGSFSFFSFIDIFTDQEIGELLSTIHPANKANLTLSCPEQG-DWKDSSLDKHNLQDFINMKINSTLILPEMEGLSEFTEYLSESV----EIPSPFDLLEPPTSGGFLKLS-----KPCCYIF--PGGRGDSALFAVNGFNMLINGGSDRKSCFWKLVRHLDRVDSILLTHIGSDNLPGINSMLQRKIAELEEEQSQGSTANSDWVKNMISPDLGVVFVNFPENLD----KPEPNYRVCRTVEEAALTQ------QFLSRLNLRIEPLQRPVGNTIEPVVLFQKMGVGKLDMYVLNPSKNSKEMQHFMKHWTGKE--KDAISILLPNGKESEFPLSYLTSISSLIVWHPANPTDKVVRVLFPGNA-----NQDHIFDGLEKLKHLDFLKQP 510          
BLAST of Microtubule-associated protein futsch vs. Ensembl Medaka
Match: map1ab (microtubule-associated protein 1A [Source:NCBI gene;Acc:101157288])

HSP 1 Score: 77.0258 bits (188), Expect = 1.194e-13
Identity = 71/279 (25.45%), Postives = 121/279 (43.37%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINH-------------LFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQ-ISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKS---LP------------SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++     +R +  Q   H             L  P    +  + P  +++             S L    +  +A+  +Q +S L VK +    + +N I+PI LFHK+G G L+M  L P ++  EM+     W       +S AK+   LP            +S T L+VW P S    I R+++ G+  P  + L  +    H   DFL+ P
Sbjct:  167 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSMLLTHIGADNLPGINGLL--QRKIAEQDEEHSQGSMNCSDWMKNLISPELGVVFFNVPEKLRMP-----------ESNLKVKRSIEEASLTLQYLSKLGVKPEPLFRVVSNTIEPITLFHKMGVGRLDMYVLNPVKDSKEMQFLMQKW-----AGNSKAKTGIVLPNGKEGEISVPYLTSITALVVWLPASPTEKIVRVLFPGN-APQNKILEGLEKLKH--LDFLRYP 422          
BLAST of Microtubule-associated protein futsch vs. Ensembl Medaka
Match: map1aa (microtubule associated protein 1A [Source:NCBI gene;Acc:101165625])

HSP 1 Score: 70.0922 bits (170), Expect = 1.496e-11
Identity = 65/271 (23.99%), Postives = 116/271 (42.80%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYAS---TERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALT--------ANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK--------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ER+    R +     SE            L S        ++  KL    + LK   +++ ++L ++  +   +T        +N I+PI LFHK+G G L+M  L P ++  EM+     W  +      +          S+P  +S T L+VW P      I R+++ G+  P  +    +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLFQRKVAEREEEKNRGSGSCSSSEWM--------KNLISPELGIVFFNVPEKLRMPESTLKVKRSIEEASLTLQYLNKLGITPEPLHRAASNTIEPITLFHKLGVGKLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGILMPNGKEGEISVPYLTSVTALIVWIPHRPTEKIVRVLFPGN-APQNKIFEGLEKLKH--LDFLRHP 294          
BLAST of Microtubule-associated protein futsch vs. Ensembl Medaka
Match: map1aa (microtubule associated protein 1A [Source:NCBI gene;Acc:101165625])

HSP 1 Score: 70.0922 bits (170), Expect = 1.496e-11
Identity = 65/271 (23.99%), Postives = 116/271 (42.80%), Query Frame = 3
Query:  669 RPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYAS---TERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALT--------ANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAK--------SLP--SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQP 1418
            +P  Y+F   G     AL  ++GF ++ + G  R + + + V++  +ID  L++H+   NL G++        ER+    R +     SE            L S        ++  KL    + LK   +++ ++L ++  +   +T        +N I+PI LFHK+G G L+M  L P ++  EM+     W  +      +          S+P  +S T L+VW P      I R+++ G+  P  +    +    H   DFL+ P
Sbjct:   37 KPCCYIF--PGGRGDSALFAVNGFNILVDGGSERKSCFWKLVRHLDRIDSVLLTHIGADNLPGINGLFQRKVAEREEEKNRGSGSCSSSEWM--------KNLISPELGIVFFNVPEKLRMPESTLKVKRSIEEASLTLQYLNKLGITPEPLHRAASNTIEPITLFHKLGVGKLDMYVLNPVKDSKEMQFLMQKWAGNSKAKTGILMPNGKEGEISVPYLTSVTALIVWIPHRPTEKIVRVLFPGN-APQNKIFEGLEKLKH--LDFLRHP 294          
BLAST of Microtubule-associated protein futsch vs. Planmine SMEST
Match: SMESG000030021.1 (SMESG000030021.1)

HSP 1 Score: 1822.37 bits (4719), Expect = 0.000e+0
Identity = 929/929 (100.00%), Postives = 929/929 (100.00%), Query Frame = 3
Query:   66 MKSNKLIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPNDYLFNGIEDCDFLGGIKLDNCEIEVIINSDKDGIINSIDEGLKSDNLILLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAPPVHAGKELPGKRPQTATGGLGGGKPKSEPPKQAHEPPTKKPAAQTNTGKALSNASTPAPKKQQPVAPSHKKVADSKPQIKDAGHVKPAKPKGVKAGITNGTHHQLDSETQHVAANSGTVDMTHATDVDIVSNGGGQPNNTVAIATDNEXXXXXXXXXXXXDXXXXXXXXXXXXXXXXXXECAITEHGEADFCDDTPEEITADQMREMGLYDDNEKEEEKGRADSNPDVDPGAVNIAHLPMEGSFYGKEAVDGNLPSNSAMEWNQPLAMPMPLKDAAVAPGNAAKKSAGKSTMPVYVDCLCVPCDIDKEDLRYLFEAIKAAMIYLQLEKPSDLSKAIXXXXXXXXXXGSVNGYDTKVIPSTIDDSYLMWAASNISRLESCRVTVGTDLSRCLISTFGGGSGSGDQANPTTDGCHGIKWEF 2852
            MKSNKLIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPNDYLFNGIEDCDFLGGIKLDNCEIEVIINSDKDGIINSIDEGLKSDNLILLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAPPVHAGKELPGKRPQTATGGLGGGKPKSEPPKQAHEPPTKKPAAQTNTGKALSNASTPAPKKQQPVAPSHKKVADSKPQIKDAGHVKPAKPKGVKAGITNGTHHQLDSETQHVAANSGTVDMTHATDVDIVSNGGGQPNNTVAIATDNETPAANPAASTTPDVTAAAGTSTSSVVAVGTVECAITEHGEADFCDDTPEEITADQMREMGLYDDNEKEEEKGRADSNPDVDPGAVNIAHLPMEGSFYGKEAVDGNLPSNSAMEWNQPLAMPMPLKDAAVAPGNAAKKSAGKSTMPVYVDCLCVPCDIDKEDLRYLFEAIKAAMIYLQLEKPSDLSKAIELLLEEKEKEGSVNGYDTKVIPSTIDDSYLMWAASNISRLESCRVTVGTDLSRCLISTFGGGSGSGDQANPTTDGCHGIKWEF
Sbjct:    1 MKSNKLIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPNDYLFNGIEDCDFLGGIKLDNCEIEVIINSDKDGIINSIDEGLKSDNLILLYVGEVTVPFGQWILHDGIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLPSSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQPEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEKPSRPITVSAPPVHAGKELPGKRPQTATGGLGGGKPKSEPPKQAHEPPTKKPAAQTNTGKALSNASTPAPKKQQPVAPSHKKVADSKPQIKDAGHVKPAKPKGVKAGITNGTHHQLDSETQHVAANSGTVDMTHATDVDIVSNGGGQPNNTVAIATDNETPAANPAASTTPDVTAAAGTSTSSVVAVGTVECAITEHGEADFCDDTPEEITADQMREMGLYDDNEKEEEKGRADSNPDVDPGAVNIAHLPMEGSFYGKEAVDGNLPSNSAMEWNQPLAMPMPLKDAAVAPGNAAKKSAGKSTMPVYVDCLCVPCDIDKEDLRYLFEAIKAAMIYLQLEKPSDLSKAIELLLEEKEKEGSVNGYDTKVIPSTIDDSYLMWAASNISRLESCRVTVGTDLSRCLISTFGGGSGSGDQANPTTDGCHGIKWEF 929          
BLAST of Microtubule-associated protein futsch vs. Planmine SMEST
Match: SMESG000014298.1 (SMESG000014298.1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.122e-12
Identity = 87/362 (24.03%), Postives = 161/362 (44.48%), Query Frame = 3
Query:  327 LLYVGEVTVPFG-QWILHDGIFNSNNLHSILNGDHQKIERN-------VVLVTPLPCEDWQVI-------EKKQ--LPYFSLCGYELEEVDETDAFIAKMAGFVNAVLGKV-------SICQVDTNQGGSQLAAITTRRPSLYLFLDKGSSC-CPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDA-----YASTE--RDMMSQRINHLFVPSEAALIDHRPASVQLQSQHANPFHVDLRSKLGTMLTQLKANGA--MQISNLAVKAKSGAALTANQIKPIQLFHKIGYGSLEMVPL--CPFEEDVEMKKFHDDWKKSKYCN----DSLAKSLPSSATVLMVW 1292
            ++YVG     +   W+L DGIF+++ + + LN +   IE+        + ++TP     W  I       E KQ  +  FS    E+  +DE   F  ++  F  ++  K        ++     N G  QL   T +  S Y+F D+G  C   +LL L GF ++ + G+ R  E+  +++  ++ID  +M+     NL G+++     + STE   ++    +N+  +P     I   P   + +    +   +++  +   +L Q+KA     +Q+S  A            ++ P QL+ K+G G L+  PL  C  E     K++ ++W+K   C     D L K   +++  L++W
Sbjct:   99 IVYVGSHGAGYSSNWLLEDGIFSAHTMLTTLN-ETSWIEKYSMESASPINILTPKNSAHWNKILSTLKIKETKQDTVRVFSFSS-EIP-IDEESIFDQEIEDFSKSLYEKFQSMLVNNAVLNCSQNIGTLQL---TNKNGSFYIF-DEG--CGQSSLLALSGFNLLIDTGYKRTPEFWNFLQKLEKIDTLMMTSWNEFNLFGVESLLKFKFDSTENKEELSHPNLNYCVLP-----IGPNPVKEKEKLDIKSYLEINIEMESHKILRQIKALDIPLLQMSRDA------------KLNPHQLYFKLGQGCLDAFPLWPCSPETSGYSKRYIEEWEKESKCQPIYFDELVKD--NASAFLLIW 432          
BLAST of Microtubule-associated protein futsch vs. Planmine SMEST
Match: SMESG000064314.1 (SMESG000064314.1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.195e-6
Identity = 87/378 (23.02%), Postives = 157/378 (41.53%), Query Frame = 3
Query:  327 LLYVG-EVTVPFGQWILHDGIFNSNNLHSILNGDHQ----KIERNVV--LVTPLPCEDWQVIEKKQLP--------YFSLCGYELEEVDETDA-FIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITTRRPS-----LYLFLDKGSSCCPALLTLDGFAMMF---NFG--FSRNAEWRRYVKYYQQIDVGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQLQSQHA----NPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALT---ANQIKPIQLFHKIGYGSLEMVPLCPFEEDVE--MKKFHDDWKKSKYCNDSLAKSL--PSSATVLMVWKPFSNKAPIKRIIYVGSKC 1349
            L+Y+G  ++     W   DGIF++ ++ +IL    Q    K+ +NV   L+    C  W     K            F    +E + + ++D  FI  +   + + +          NQ   +L +I     S     + L L        +L+++ GF ++    NF   F  N     Y K   +ID  +++   + N  G   Y   + ++MS  I +  +P         PA+ +  ++      N F VD+R+ +  ++ Q+K              KS ++L+   A   K  +LF+K+G G+L+M  + P  +D+   +K  +D W+ +K    SL + L   SS   L +W     + P++  I V S C
Sbjct:   92 LIYIGITISESSNYWAFPDGIFSTFSMENILENIRQTVPEKMSKNVHMHLIEKSKC--WTEFSSKNHQDKDFNFSVNFQFHDHEKKTLGKSDVNFITVIEDLIVSSM----------NQNYPELLSIANNVMSNNPNQINLLLSNQLMGSSSLISVAGFNLVIDCPNFSSPFCYN-----YFKNLPKIDTFVLTSWNFKNTFGF--YNMLKCNLMS-SIGYFILP---------PANQKPYTKSEITPNNLFSVDMRNMINEIMIQVK--------------KSDSSLSQPLAEVKKSYKLFYKLGAGTLQMFCIFPPTKDLYKPLKSLYDAWENNKET--SLFEKLLCDSSLASLFIWSSDDKQKPLR--ILVSSCC 422          
The following BLAST results are available for this feature:
BLAST of Microtubule-associated protein futsch vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP1A3.673e-1522.00microtubule associated protein 1A [Source:HGNC Sym... [more]
MAP1B2.249e-1222.16microtubule associated protein 1B [Source:HGNC Sym... [more]
MAP1A4.165e-1224.54microtubule associated protein 1A [Source:HGNC Sym... [more]
MAP1B1.086e-1121.63microtubule associated protein 1B [Source:HGNC Sym... [more]
MAP1B1.761e-1122.74microtubule associated protein 1B [Source:HGNC Sym... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
futsch9.111e-1926.01gene:FBgn0259108 transcript:FBtr0307597[more]
futsch9.111e-1926.01gene:FBgn0259108 transcript:FBtr0307598[more]
futsch9.111e-1926.01gene:FBgn0259108 transcript:FBtr0112628[more]
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1ab1.491e-1521.60microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1ab1.491e-1521.60microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1aa6.456e-1522.71microtubule-associated protein 1Aa [Source:ZFIN;Ac... [more]
map1ab1.661e-1324.18microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1ab1.661e-1324.18microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MAP1S3.128e-1223.97microtubule associated protein 1S [Source:NCBI gen... [more]
pcbp23.285e-1224.82poly(rC) binding protein 2 [Source:Xenbase;Acc:XB-... [more]
MAP1A3.991e-1221.75microtubule associated protein 1A [Source:NCBI gen... [more]
MAP1A2.061e-1124.75microtubule associated protein 1A [Source:NCBI gen... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Map1a8.687e-1622.78microtubule-associated protein 1 A [Source:MGI Sym... [more]
Map1b1.972e-1222.15microtubule-associated protein 1B [Source:MGI Symb... [more]
Map1a2.274e-1226.01microtubule-associated protein 1 A [Source:MGI Sym... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9W596|FUTSC_DROME9.133e-1826.01Microtubule-associated protein futsch OS=Drosophil... [more]
sp|P15205|MAP1B_RAT1.085e-1224.22Microtubule-associated protein 1B OS=Rattus norveg... [more]
sp|P46821|MAP1B_HUMAN1.080e-1122.16Microtubule-associated protein 1B OS=Homo sapiens ... [more]
sp|P14873|MAP1B_MOUSE1.380e-1122.15Microtubule-associated protein 1B OS=Mus musculus ... [more]
sp|P34926|MAP1A_RAT1.577e-1126.01Microtubule-associated protein 1A OS=Rattus norveg... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A433UCY11.485e-2727.50Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A2C9LV392.153e-2426.49Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A2C9LV562.274e-2426.49Uncharacterized protein OS=Biomphalaria glabrata O... [more]
K1PNL05.394e-2023.59Microtubule-associated protein futsch OS=Crassostr... [more]
A0A1B6M4Q53.373e-1925.48Uncharacterized protein (Fragment) OS=Graphocephal... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1aa7.821e-1822.11microtubule-associated protein 1Aa [Source:ZFIN;Ac... [more]
map1ab4.534e-1522.00microtubule-associated protein 1Ab [Source:ZFIN;Ac... [more]
map1b3.708e-1325.71microtubule associated protein 1B [Source:NCBI gen... [more]
map1sb9.386e-1123.39microtubule-associated protein 1S-like [Source:NCB... [more]
map1sb1.037e-1023.39microtubule-associated protein 1S-like [Source:NCB... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microtubule-associated protein futsch vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map1ab1.134e-1522.16microtubule-associated protein 1A [Source:NCBI gen... [more]
map1b1.781e-1421.60microtubule associated protein 1B [Source:NCBI gen... [more]
map1ab1.194e-1325.45microtubule-associated protein 1A [Source:NCBI gen... [more]
map1aa1.496e-1123.99microtubule associated protein 1A [Source:NCBI gen... [more]
map1aa1.496e-1123.99microtubule associated protein 1A [Source:NCBI gen... [more]
back to top
BLAST of Microtubule-associated protein futsch vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000030021.10.000e+0100.00SMESG000030021.1[more]
SMESG000014298.15.122e-1224.03SMESG000014298.1[more]
SMESG000064314.11.195e-623.02SMESG000064314.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025910 ID=SMED30025910|Name=Microtubule-associated protein futsch|organism=Schmidtea mediterranea sexual|type=transcript|length=3231bp
TTCAACTGTTTGTTTAGTCGAATCATTCAATTTATTTGAAGTCTGTTTTG
AAATAGATAATTTCTATGAAGTCTAATAAATTAATTGTTATCATCTCTGA
AATTTGGAATGAAGAGCAACTGAAAGCGTCGAAAACATGTTTGATAAAAG
GTTTGGAGCAAGTAAACAAAAAATTCCCGAACGATTATTTATTCAATGGA
ATAGAAGATTGTGATTTCTTAGGCGGTATAAAATTAGATAATTGCGAGAT
AGAAGTGATCATAAATTCGGATAAAGATGGAATAATTAATTCGATTGACG
AGGGATTGAAAAGTGATAATTTAATCCTGTTATATGTAGGTGAAGTAACA
GTTCCATTTGGTCAATGGATTTTACACGATGGAATTTTTAATAGCAATAA
TTTGCACTCCATTCTAAATGGCGACCACCAAAAGATTGAGAGAAATGTTG
TGTTAGTAACGCCATTGCCATGCGAGGATTGGCAAGTTATCGAAAAGAAG
CAGCTGCCTTATTTCAGTCTCTGTGGTTATGAATTGGAGGAAGTTGATGA
AACTGATGCATTTATAGCAAAGATGGCAGGTTTCGTCAATGCTGTTTTAG
GAAAGGTTTCGATTTGCCAGGTCGACACAAATCAAGGAGGCTCACAGTTA
GCGGCGATCACCACACGGCGCCCTTCTCTATATCTGTTCCTTGACAAAGG
CTCCTCATGCTGCCCTGCCTTGCTGACATTGGATGGATTCGCGATGATGT
TTAATTTCGGATTCAGTAGGAATGCCGAGTGGCGGCGCTACGTGAAATAT
TACCAGCAGATCGATGTGGGCCTCATGAGCCACCTGGCGTACAGCAATCT
GCTGGGATTGGATGCCTATGCCAGCACTGAACGCGACATGATGAGCCAGC
GCATTAACCATTTGTTTGTGCCGAGTGAGGCTGCCCTTATTGACCACCGG
CCTGCATCAGTGCAGCTCCAGAGCCAGCATGCCAATCCATTCCACGTGGA
CCTCAGATCAAAACTGGGAACGATGCTCACTCAATTGAAGGCCAACGGGG
CCATGCAAATCTCAAATCTGGCGGTCAAGGCGAAATCTGGCGCCGCATTA
ACAGCGAATCAAATTAAACCAATCCAATTGTTTCACAAGATCGGTTACGG
GAGCCTAGAAATGGTTCCGTTGTGCCCATTTGAAGAAGATGTCGAAATGA
AAAAGTTTCACGATGATTGGAAAAAATCCAAATATTGCAATGACAGCTTG
GCCAAGTCCTTGCCGTCCTCGGCAACCGTTCTGATGGTCTGGAAACCATT
CAGTAACAAAGCACCGATAAAGCGCATTATTTATGTCGGCTCTAAATGCC
CGCTGAGGAGGAATTTGCCCGCAATAATAACCGCACTACACAGCTCATTC
GATTTCCTCAAGCAGCCAGAATACGCGCCACTCGACGGATTGGCCAAGAA
GCCTGTATCTGCTCGGAAAACGACGCCTCCCGTGTCCGCTACCAGTCGAG
GTGCCAGCAAATCCGGCGACAGCGCCTTAACAAATGCTAAGAAGCTAGCG
CCAACCGCTGAGAAGCCTTCTAGACCAATCACAGTTTCTGCACCGCCTGT
TCATGCTGGAAAGGAGCTGCCGGGGAAACGGCCGCAAACTGCCACTGGCG
GTCTCGGCGGCGGTAAGCCTAAATCGGAGCCTCCTAAACAAGCGCATGAA
CCACCGACTAAGAAACCTGCTGCCCAGACAAACACGGGCAAAGCGCTGTC
CAACGCGTCCACTCCGGCACCGAAAAAGCAGCAACCGGTAGCGCCCTCAC
ATAAAAAAGTGGCAGATAGCAAACCTCAAATCAAAGATGCTGGGCACGTG
AAACCTGCTAAACCGAAGGGGGTGAAAGCTGGGATCACCAACGGAACTCA
CCATCAATTGGACAGTGAGACGCAGCACGTGGCGGCTAATAGCGGGACAG
TTGACATGACGCACGCAACTGATGTGGATATCGTCTCGAATGGCGGCGGC
CAGCCCAATAACACCGTTGCCATAGCTACCGATAATGAGACACCGGCTGC
CAACCCGGCAGCATCTACTACACCAGATGTCACCGCCGCTGCCGGCACCA
GCACCAGCTCTGTTGTTGCCGTGGGAACGGTGGAATGTGCCATCACTGAG
CACGGCGAGGCTGACTTCTGTGATGATACACCAGAGGAGATTACAGCGGA
TCAAATGAGGGAAATGGGACTCTATGATGATAATGAGAAGGAGGAGGAGA
AGGGACGGGCTGACAGCAATCCCGATGTTGACCCGGGCGCGGTCAATATT
GCCCATCTGCCGATGGAGGGATCTTTCTATGGCAAGGAGGCAGTTGATGG
CAATCTCCCTAGCAACAGCGCTATGGAATGGAATCAGCCGCTGGCAATGC
CAATGCCACTTAAAGATGCCGCCGTCGCCCCTGGCAACGCAGCCAAGAAA
AGTGCCGGCAAGTCCACCATGCCAGTCTATGTGGACTGCCTCTGTGTGCC
TTGTGATATTGACAAGGAGGACTTACGTTACCTATTCGAGGCAATCAAAG
CTGCAATGATTTATTTGCAGTTGGAAAAGCCATCTGACCTGAGCAAAGCT
ATCGAGTTGCTACTGGAGGAGAAAGAAAAGGAGGGATCGGTCAATGGCTA
CGATACCAAGGTTATCCCTAGCACCATCGACGATTCCTATCTTATGTGGG
CTGCGTCAAACATTTCCCGGTTGGAGTCGTGCCGGGTAACCGTTGGTACC
GATCTCAGCCGCTGCTTGATTTCTACATTTGGCGGCGGCAGCGGCAGCGG
GGATCAGGCTAATCCGACAACCGACGGTTGCCATGGCATCAAATGGGAGT
TCTAGCATTCTTGGTGATGAGGATGATGATGACGATATTGATATGATATG
ATATATACAATTCCATGAATTGCTGAAATGCTTCTGTTACAGGTGCAGCA
ACAGTAGTTGCCATCACCACCGCCGCATCCGTTGATGCCCTCGTTGTCCG
GTTGCTGCTCTAATTATGAATGTGAAATTATTATTATTATTATTATGAGA
TTCGATTTTGCAACGTTAGAGAGCTTTAAATTGTGGATTTAGATTTTTAC
GTCGTTTGTTTTGTTTGTATTTTTTAATTTCATTTCTACTGCTATTATAA
TATTATTATTATTGATTATTATTTATTCTATATTTGATTATTTGAATTAT
TTAAATCAATAATATAATATAAGCCATTGCG
back to top

protein sequence of SMED30025910-orf-1

>SMED30025910-orf-1 ID=SMED30025910-orf-1|Name=SMED30025910-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=930bp
MKSNKLIVIISEIWNEEQLKASKTCLIKGLEQVNKKFPNDYLFNGIEDCD
FLGGIKLDNCEIEVIINSDKDGIINSIDEGLKSDNLILLYVGEVTVPFGQ
WILHDGIFNSNNLHSILNGDHQKIERNVVLVTPLPCEDWQVIEKKQLPYF
SLCGYELEEVDETDAFIAKMAGFVNAVLGKVSICQVDTNQGGSQLAAITT
RRPSLYLFLDKGSSCCPALLTLDGFAMMFNFGFSRNAEWRRYVKYYQQID
VGLMSHLAYSNLLGLDAYASTERDMMSQRINHLFVPSEAALIDHRPASVQ
LQSQHANPFHVDLRSKLGTMLTQLKANGAMQISNLAVKAKSGAALTANQI
KPIQLFHKIGYGSLEMVPLCPFEEDVEMKKFHDDWKKSKYCNDSLAKSLP
SSATVLMVWKPFSNKAPIKRIIYVGSKCPLRRNLPAIITALHSSFDFLKQ
PEYAPLDGLAKKPVSARKTTPPVSATSRGASKSGDSALTNAKKLAPTAEK
PSRPITVSAPPVHAGKELPGKRPQTATGGLGGGKPKSEPPKQAHEPPTKK
PAAQTNTGKALSNASTPAPKKQQPVAPSHKKVADSKPQIKDAGHVKPAKP
KGVKAGITNGTHHQLDSETQHVAANSGTVDMTHATDVDIVSNGGGQPNNT
VAIATDNETPAANPAASTTPDVTAAAGTSTSSVVAVGTVECAITEHGEAD
FCDDTPEEITADQMREMGLYDDNEKEEEKGRADSNPDVDPGAVNIAHLPM
EGSFYGKEAVDGNLPSNSAMEWNQPLAMPMPLKDAAVAPGNAAKKSAGKS
TMPVYVDCLCVPCDIDKEDLRYLFEAIKAAMIYLQLEKPSDLSKAIELLL
EEKEKEGSVNGYDTKVIPSTIDDSYLMWAASNISRLESCRVTVGTDLSRC
LISTFGGGSGSGDQANPTTDGCHGIKWEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000028Category 2 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR026074MAP1
Vocabulary: biological process
TermDefinition
GO:0000226microtubule cytoskeleton organization
Vocabulary: cellular component
TermDefinition
GO:0005874microtubule
Vocabulary: molecular function
TermDefinition
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 583..598
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 463..602
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 549..572
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 469..490
NoneNo IPR availablePANTHERPTHR13843:SF12MICROTUBULE-ASSOCIATED PROTEIN FUTSCHcoord: 99..625
IPR026074Microtubule associated protein 1PANTHERPTHR13843MICROTUBULE-ASSOCIATED PROTEINcoord: 99..625