Calponin-homology (CH) domain-containing protein

Overview
NameCalponin-homology (CH) domain-containing protein
Smed IDSMED30025902
Length (bp)5948
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calponin-homology (CH) domain-containing protein (SMED30025902) t-SNE clustered cells

Violin plots show distribution of expression levels for Calponin-homology (CH) domain-containing protein (SMED30025902) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calponin-homology (CH) domain-containing protein (SMED30025902) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calponin-homology (CH) domain-containing protein (SMED30025902) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025902

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025902SMESG000078209.1 SmedASXL_017111SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025902SMESG000078209.1 dd_Smed_v6_9419_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025902SMESG000078209.1 dd_Smed_v4_9419_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: SPEF2 (sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:26293])

HSP 1 Score: 389.423 bits (999), Expect = 2.894e-114
Identity = 300/915 (32.79%), Postives = 474/915 (51.80%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK-QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKID------EDKTENQVTYINLNASM--------EEGAVSFNKDENNFTPIVNEIPT--IVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKV------STSKH-----SGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIIL 2620
            +S+ +   +FA  FS+GYL+GE+L K++L D+F +      + AKL+NF  LEP L LLG+ F+ +VA  ++  K  +   L+YQL+IAL+ KK+S  T + MQT+Q     ++Q ++S  +Q+RL+ + PRQTD  L  +  ++Q+  + ++           E  ++  E+ R   + +    R+ Q E M KI+AA+++IPKP  ++T++A++  K +K +KE ED   E+  FE   ++++  ++        +  ++ +   N  +DD                         EYI++I+ RLE D  AR  REKRRRK+L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+  +D    +    +Y KHY +  +++  IVDLS K++++++LT   IP K++ +WK  F N  PIY++ +    VK                LP       +  +E KR+LLD  D  EYK ++GEW + +E +  +   NN IL  I+ RL   S P    S  P LP F +K  ++GK  SGK+ ++R+L K+     +    ++ EA++AF  NE  +V  +L I +N + D      E+  E+Q      +A           EGA   N D+   TP   E+ +     K + RA LG K    L  G+SI D LLV+ IV  I  IP     I+D FP T  QA+L E+A TG     +   R+   K       +TSK         D +ILL+ SD   ++R   I   +L+ K  +  +S+ V A              +Q  +  F +NWP L +++      L+K+   N E+D   +  +V+ IL
Sbjct:   15 VSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKLNNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDD-------------------------EYIKKIQKRLEEDAFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQAS----VK---------------TLPANPSREQLTELE-KRDLLDTNDYEEYKNMVGEWALPEEMVDNLPPSNNCILGHILHRLAEKSLPPRAESTTPELPSFAVKGCLLGKTLSGKTTILRSLQKDFPIQILSIDTLVQEAIQAFHDNE--KVSEVLPIQKNDEEDALPVLQEEIKESQDPQHVFSAGPVSDEVLPETEGA---NADK---TPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPLPSPAFDFVILLDVSDTSSMSRMNDIIAEELSYKTAHEDISQRVAAENQDKDGDQNLRDQIQHRIIGFLDNWPLLEQWFSEPENILIKI---NAEIDKESLCEKVKEIL 873          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: SPEF2 (sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:26293])

HSP 1 Score: 390.578 bits (1002), Expect = 1.202e-109
Identity = 300/917 (32.72%), Postives = 476/917 (51.91%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK-QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKID------EDKTENQ----------VTYINLNASMEEGAVSFNKDENNFTPIVNEIPT--IVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKV------STSKH-----SGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIIL 2620
            +S+ +   +FA  FS+GYL+GE+L K++L D+F +      + AKL+NF  LEP L LLG+ F+ +VA  ++  K  +   L+YQL+IAL+ KK+S  T + MQT+Q     ++Q ++S  +Q+RL+ + PRQTD  L  +  ++Q+  + ++           E  ++  E+ R   + +    R+ Q E M KI+AA+++IPKP  ++T++A++  K +K +KE ED   E+  FE   ++++  ++        +  ++ +   N  +DD                         EYI++I+ RLE D  AR  REKRRRK+L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+  +D    +    +Y KHY +  +++  IVDLS K++++++LT   IP K++ +WK  F N  PIY++ +    VK                LP       +  +E KR+LLD  D  EYK ++GEW + +E +  +   NN IL  I+ RL   S P    S  P LP F +K  ++GK  SGK+ ++R+L K+     +    ++ EA++AF  NE  +V  +L I +N + D      E+  E+Q          V+   L  +  E  +S N D+   TP   E+ +     K + RA LG K    L  G+SI D LLV+ IV  I  IP     I+D FP T  QA+L E+A TG     +   R+   K       +TSK         D +ILL+ SD   ++R   I   +L+ K  +  +S+ V A              +Q  +  F +NWP L +++      L+K+   N E+D   +  +V+ IL
Sbjct:   15 VSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKLNNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDD-------------------------EYIKKIQKRLEEDAFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQAS----VK---------------TLPANPSREQLTELE-KRDLLDTNDYEEYKNMVGEWALPEEMVDNLPPSNNCILGHILHRLAEKSLPPRAESTTPELPSFAVKGCLLGKTLSGKTTILRSLQKDFPIQILSIDTLVQEAIQAFHDNE--KVSEVLPIQKNDEEDALPVLQEEIKESQDPQHVFSAGPVSDEVLPETEGETMLSANADK---TPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPLPSPAFDFVILLDVSDTSSMSRMNDIIAEELSYKTAHEDISQRVAAENQDKDGDQNLRDQIQHRIIGFLDNWPLLEQWFSEPENILIKI---NAEIDKESLCEKVKEIL 878          

HSP 2 Score: 160.614 bits (405), Expect = 1.454e-38
Identity = 79/217 (36.41%), Postives = 134/217 (61.75%), Query Frame = 2
Query: 3098 VVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNI 3745
            V  VP+   P+PG  +WVY  +P+  E+      +WE + + Y N  K V R +R+D+  ++ Y++ I+ +F+ FL RPD KQ+++ Q+Q DFN + D+  +DEE + ELHQR+++L+D+L +I      +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY  M   + +ED +  F R+PL+++ S    +N + +L I
Sbjct:  998 VAIVPQ--PPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQADFNSLPDDLWDDEETKAELHQRVNDLRDRLWDICDARKEEAEQERLDIINESWLQDTLGMTMNHFFSLMQAELNRFQDTKRLLQDYYWGMESKIPVEDNK-RFTRIPLVQLDS---KDNSESQLRI 1208          

HSP 3 Score: 102.834 bits (255), Expect = 6.570e-21
Identity = 98/368 (26.63%), Postives = 162/368 (44.02%), Query Frame = 2
Query: 4424 AEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISM--------------------IPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGD-DPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
             EE  E K+      K K E++AALQ E    +   ++I  K    ++++      V++L   W+ ++ L+E  S +++  V RYHIE    ++ ++ L    F++N NI +                    + +E+ DS + Q +++ P+ I  +G++ FT                       +ID V L   +         P+  N    T+  +  +    + + E+V+WR FLL  S PWP P + EL+  L  FK +D++  G +T EQY    LWF        P +   P   NRQ  +   FF +F   + DP +L            +Y +ML++FA  C  +   G+ RALSVA G
Sbjct: 1332 TEEIAEIKRKNELRVKIKEEHLAALQFEEIATQFRLELIKTKALALLEDLVTKVVDVYKLMEKWLGERYLNEMASTEKLTDVARYHIETSTKIQNELYLSQEDFFINGNIKVFPDPPPSIRPPPVEKEEDGTLTIEQLDSLRDQFLDMAPKGI--IGNKAFTDI---------------------LIDLVTLNLGT------NNFPS--NWMHLTQPELQELTSLLTVNSEFVDWRKFLLVTSMPWPIPLEEELLETLQKFKAVDKEQLGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQL------------DYTQMLLYFA--CHPDTVEGVYRALSVAVG 1654          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: SPEF2 (sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:26293])

HSP 1 Score: 389.423 bits (999), Expect = 2.780e-109
Identity = 300/915 (32.79%), Postives = 474/915 (51.80%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK-QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKID------EDKTENQVTYINLNASM--------EEGAVSFNKDENNFTPIVNEIPT--IVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKV------STSKH-----SGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIIL 2620
            +S+ +   +FA  FS+GYL+GE+L K++L D+F +      + AKL+NF  LEP L LLG+ F+ +VA  ++  K  +   L+YQL+IAL+ KK+S  T + MQT+Q     ++Q ++S  +Q+RL+ + PRQTD  L  +  ++Q+  + ++           E  ++  E+ R   + +    R+ Q E M KI+AA+++IPKP  ++T++A++  K +K +KE ED   E+  FE   ++++  ++        +  ++ +   N  +DD                         EYI++I+ RLE D  AR  REKRRRK+L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+  +D    +    +Y KHY +  +++  IVDLS K++++++LT   IP K++ +WK  F N  PIY++ +    VK                LP       +  +E KR+LLD  D  EYK ++GEW + +E +  +   NN IL  I+ RL   S P    S  P LP F +K  ++GK  SGK+ ++R+L K+     +    ++ EA++AF  NE  +V  +L I +N + D      E+  E+Q      +A           EGA   N D+   TP   E+ +     K + RA LG K    L  G+SI D LLV+ IV  I  IP     I+D FP T  QA+L E+A TG     +   R+   K       +TSK         D +ILL+ SD   ++R   I   +L+ K  +  +S+ V A              +Q  +  F +NWP L +++      L+K+   N E+D   +  +V+ IL
Sbjct:   15 VSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKLNNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDD-------------------------EYIKKIQKRLEEDAFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQAS----VK---------------TLPANPSREQLTELE-KRDLLDTNDYEEYKNMVGEWALPEEMVDNLPPSNNCILGHILHRLAEKSLPPRAESTTPELPSFAVKGCLLGKTLSGKTTILRSLQKDFPIQILSIDTLVQEAIQAFHDNE--KVSEVLPIQKNDEEDALPVLQEEIKESQDPQHVFSAGPVSDEVLPETEGA---NADK---TPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPLPSPAFDFVILLDVSDTSSMSRMNDIIAEELSYKTAHEDISQRVAAENQDKDGDQNLRDQIQHRIIGFLDNWPLLEQWFSEPENILIKI---NAEIDKESLCEKVKEIL 873          

HSP 2 Score: 160.999 bits (406), Expect = 1.312e-38
Identity = 79/217 (36.41%), Postives = 134/217 (61.75%), Query Frame = 2
Query: 3098 VVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNI 3745
            V  VP+   P+PG  +WVY  +P+  E+      +WE + + Y N  K V R +R+D+  ++ Y++ I+ +F+ FL RPD KQ+++ Q+Q DFN + D+  +DEE + ELHQR+++L+D+L +I      +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY  M   + +ED +  F R+PL+++ S    +N + +L I
Sbjct:  993 VAIVPQ--PPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQADFNSLPDDLWDDEETKAELHQRVNDLRDRLWDICDARKEEAEQERLDIINESWLQDTLGMTMNHFFSLMQAELNRFQDTKRLLQDYYWGMESKIPVEDNK-RFTRIPLVQLDS---KDNSESQLRI 1203          

HSP 3 Score: 102.449 bits (254), Expect = 6.906e-21
Identity = 98/368 (26.63%), Postives = 162/368 (44.02%), Query Frame = 2
Query: 4424 AEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISM--------------------IPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGD-DPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
             EE  E K+      K K E++AALQ E    +   ++I  K    ++++      V++L   W+ ++ L+E  S +++  V RYHIE    ++ ++ L    F++N NI +                    + +E+ DS + Q +++ P+ I  +G++ FT                       +ID V L   +         P+  N    T+  +  +    + + E+V+WR FLL  S PWP P + EL+  L  FK +D++  G +T EQY    LWF        P +   P   NRQ  +   FF +F   + DP +L            +Y +ML++FA  C  +   G+ RALSVA G
Sbjct: 1327 TEEIAEIKRKNELRVKIKEEHLAALQFEEIATQFRLELIKTKALALLEDLVTKVVDVYKLMEKWLGERYLNEMASTEKLTDVARYHIETSTKIQNELYLSQEDFFINGNIKVFPDPPPSIRPPPVEKEEDGTLTIEQLDSLRDQFLDMAPKGI--IGNKAFTDI---------------------LIDLVTLNLGT------NNFPS--NWMHLTQPELQELTSLLTVNSEFVDWRKFLLVTSMPWPIPLEEELLETLQKFKAVDKEQLGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQL------------DYTQMLLYFA--CHPDTVEGVYRALSVAVG 1649          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: SPEF2 (sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:26293])

HSP 1 Score: 389.037 bits (998), Expect = 1.081e-108
Identity = 300/917 (32.72%), Postives = 476/917 (51.91%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK-QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKID------EDKTENQ----------VTYINLNASMEEGAVSFNKDENNFTPIVNEIPT--IVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVS------TSKH-----SGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIIL 2620
            +S+ +   +FA  FS+GYL+GE+L K++L D+F +      + AKL+NF  LEP L LLG+ F+ +VA  ++  K  +   L+YQL+IAL+ KK+S  T + MQT+Q     ++Q ++S  +Q+RL+ + PRQTD  L  +  ++Q+  + ++           E  ++  E+ R   + +    R+ Q E M KI+AA+++IPKP  ++T++A++  K +K +KE ED   E+  FE   ++++  ++        +  ++ +   N  +DD                         EYI++I+ RLE D  AR  REKRRRK+L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+  +D    +    +Y KHY +  +++  IVDLS K++++++LT   IP K++ +WK  F N  PIY++ +    VK                LP       +  +E KR+LLD  D  EYK ++GEW + +E +  +   NN IL  I+ RL   S P    S  P LP F +K  ++GK  SGK+ ++R+L K+     +    ++ EA++AF  NE  +V  +L I +N + D      E+  E+Q          V+   L  +  E  +S N D+   TP   E+ +     K + RA LG K    L  G+SI D LLV+ IV  I  IP     I+D FP T  QA+L E+A TG     +   R+   K +      TSK         D +ILL+ SD   ++R   I   +L+ K  +  +S+ V A              +Q  +  F +NWP L +++      L+K+   N E+D   +  +V+ IL
Sbjct:   15 VSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKLNNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDD-------------------------EYIKKIQKRLEEDAFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQAS----VK---------------TLPANPSREQLTELE-KRDLLDTNDYEEYKNMVGEWALPEEMVDNLPPSNNCILGHILHRLAEKSLPPRAESTTPELPSFAVKGCLLGKTLSGKTTILRSLQKDFPIQILSIDTLVQEAIQAFHDNE--KVSEVLPIQKNDEEDALPVLQEEIKESQDPQHVFSAGPVSDEVLPETEGETMLSANADK---TPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPLPSPAFDFVILLDVSDTSSMSRMNDIIAEELSYKTAHEDISQRVAAENQDKDGDQNLRDQIQHRIIGFLDNWPLLEQWFSEPENILIKI---NAEIDKESLCEKVKEIL 878          

HSP 2 Score: 162.54 bits (410), Expect = 4.391e-39
Identity = 79/217 (36.41%), Postives = 134/217 (61.75%), Query Frame = 2
Query: 3098 VVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNI 3745
            V  VP+   P+PG  +WVY  +P+  E+      +WE + + Y N  K V R +R+D+  ++ Y++ I+ +F+ FL RPD KQ+++ Q+Q DFN + D+  +DEE + ELHQR+++L+D+L +I      +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY  M   + +ED +  F R+PL+++ S    +N + +L I
Sbjct:  998 VAIVPQ--PPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQADFNSLPDDLWDDEETKAELHQRVNDLRDRLWDICDARKEEAEQERLDIINESWLQDTLGMTMNHFFSLMQAELNRFQDTKRLLQDYYWGMESKIPVEDNK-RFTRIPLVQLDS---KDNSESQLRI 1208          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Match: SPEF2 (sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:26293])

HSP 1 Score: 268.47 bits (685), Expect = 2.337e-77
Identity = 188/538 (34.94%), Postives = 302/538 (56.13%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYK 1615
            +S+ +   +FA  FS+GYL+GE+L K++L D+F +      + AKL+NF  LEP L LLG+ F+ +VA  ++  K  +   L+YQL+IAL+ KK+S  T + MQT+Q     ++Q ++S  +Q+RL+ + PRQTD  L  +  ++Q+  + ++           E  ++  E+ R   + +    R+ Q E M KI+AA+++IPKP  ++T++A++  K +K +KE ED   E+  FE     ++ +D                ++   +   L    ++ +D       +   S+ EYI++I+ RLE D  AR  REKRRRK+L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+  +D    +    +Y KHY +  +++  IVDLS K++++++LT   IP K++ +WK  F N  PIY++ +    VK                LP       +  +E KR+LLD  D  EYK
Sbjct:   15 VSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKLNNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFE----ALIKKD--------------LQAKESASKTSLDTAGQTTTDL------LNTYSDDEYIKKIQKRLEEDAFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQAS----VK---------------TLPANPSREQLTELE-KRDLLDTNDYEEYK 508          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Match: spef2 (sperm flagellar 2 [Source:NCBI gene;Acc:553375])

HSP 1 Score: 366.311 bits (939), Expect = 1.966e-102
Identity = 288/916 (31.44%), Postives = 471/916 (51.42%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKN-NILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETI--LSINENSKIDEDKTEN-QVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAAT-----GYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMK---------------------------ISENQLNDKLDNTVVSKDVI---ANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLI 2632
            LS+ ++ ++FA  FSNGYLIGEIL +Y+L D+F   SK++T+ AKL+NF  +EP L+LL + F+ ++AK VM  +      L+YQL+I L+ KKR+  TA +M+ +Q  AT ++  IE+ +Y +RLK +  R+ D++++++ K++    Q M  ++    +L  E   +  E+ R   + + +  R++Q E M +I++AVV+IPKPP  +T +A +K ++ + ++E +   +E+  FE+K++                    S  E G        +  S   TQ +    K + NK+YIE I+ RLE D  AR  RE RRR+ L+  L++H  Q+E  RE  +  RLMRQ+Q E+RI VQL+ ++ +K V++ NR+ +E QYQERR+++F  AL++E  L +Q +L   + LR E +L+     +    +Y+KH+ +   ++  IVDL+ K  E+++LT   IP K+++EW   F +G P+Y+                  V   D   P E     I  +E K ++L+ +D  EY  +IGEW + +E+    +  N +ILD +++RL+ +  P   ++  P  P F I+A ++GK FSGK+  +  +        +    +I +AL A+Q  ++   E+    S+ +N    E  TE  Q      ++ +E G                E    + K S RA  G  +   L  G+++ DQLLV+ IV+ IR IP  +GWI+D FP    QA++ EKA       G +  N+ S+ +   K +      LD ++LL+ SD   L RA                              S   LN + D   +S D       +Q  ++ F + WPKL K++      LVKV      +D   ++  VE IL D I
Sbjct:   15 LSKVVEPHSFARDFSNGYLIGEILYRYELQDDFHLFSKQNTSNAKLNNFTRIEPTLQLLTVPFDLTMAKAVMLGRHGAATRLLYQLYILLQRKKRAGLTATAMEVMQPAATARLHRIENSIYTERLKTVVKREADLKMQKIAKRFHKRGQEMFSRSVMTELLKEEDRLKRQEERRLRDIEKHRQARRKQNEIMIQIQSAVVQIPKPPHIRTSRASEKQQQFRKKQEAQHVHREIAQFEKKKKTT------------------SPPEGG-------ALLFSGRVTQPMSTGDKAQWNKDYIENIRQRLEEDATAREQREMRRRRALMEQLQAHEAQQEALREEQMVSRLMRQTQQEKRITVQLMQIKQQKEVLRENRIFQERQYQERRQRDFQEALDREAVLAQQERLERSEQLRIEHELHKQLAEERAQARYQKHFGICRDILGQIVDLATKAGEYRLLTANLIPVKLMQEWMELFYSGKPLYE------------------VACVDPK-PTEPTPEQIIELE-KLQILNNQDYDEYVAMIGEWALDEETERQTNAGNSDILDHVLNRLRNMIVPPTVSTPPPLFPRFTIRACMLGKTFSGKTTCLSRISSTLNIHVLSANTLIQDALSAYQQEKQAASESQNEKSLEKNVSQTEHTTEQLQKDEQETSSPLESGPQPHEASSGLHEKEDKEESKAIPKWSSRAQHGAAVEKVLRTGQAVPDQLLVDIIVDAIRNIPADSGWILDGFPVDISQAQMLEKALNMTELDGTKTQNNLSTNKNGPKDAAPPSPALDLVVLLDVSDEQVLERATTQPPEGTQIVNGESIKQEKGSSDAAEENTSMPDLNTQ-DPESLSDDKSLGRTQIQFRISGFHQTWPKLEKWFGDQQNILVKVTAG---VDKDTLFSNVETILRDTI 881          

HSP 2 Score: 126.716 bits (317), Expect = 1.880e-28
Identity = 61/159 (38.36%), Postives = 102/159 (64.15%), Query Frame = 2
Query: 3245 VFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEAN 3721
            + + +R +RE II +++ I++ FR +L +PD KQE++  +Q+D+N + D  REDEE + ELHQR+ +L+++L +IS +   +A++E   + ++ WLED   ++ N Y  LM  E  RFQD V  LKDYY +M     E  + +F R+PL++I + Q  +
Sbjct:  909 MMQNLRGERELIIHHLYNIRENFRQYLQKPDLKQEFVSSWQRDYNSVPDNIREDEETKGELHQRLDDLRERLWDISDKRKDEAEQEKAGVIHDGWLEDHTAVLINNYSALMQIEVGRFQDCVCLLKDYYSTMGKTAFES-KCDFARVPLLDITADQHVD 1066          

HSP 3 Score: 93.2041 bits (230), Expect = 3.223e-18
Identity = 57/211 (27.01%), Postives = 100/211 (47.39%), Query Frame = 2
Query: 5006 TESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPH---------IPVMFKXXXXXXXXXXXTIQE----DSSETNIRIQDLYKVLSFG 5599
            T S +  +    + D E ++WR FLL+ + PWP+PTQ++L+  L  ++++D   TG +T+EQY+ ++LWFP    P+ P D + P   +R   +K  FF +F                    ++Y  ML+HF   C      G  RAL + +G +L +         +P +     +      +  ++    +S E  + + D+ +VLS G
Sbjct: 1360 TPSQVEELVCILAQDSEMLDWRQFLLSAALPWPFPTQTQLIKTLQRYRDIDTAETGLITQEQYEQVELWFPSEQDPSVPDDPTEPVPYDRLANLKKFFFSLF-----------ASTHSSPLLLDYLMMLLHFC--CHPEAAQGFTRALGLVTGHTLHYKHTTPLTQSVPCLEGAGVVDDAGADNEEEQHRGVESEEVGVSVDDVLRVLSHG 1557          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: SPEF2 (sperm flagellar 2 [Source:NCBI gene;Acc:100491905])

HSP 1 Score: 394.815 bits (1013), Expect = 8.964e-112
Identity = 287/869 (33.03%), Postives = 456/869 (52.47%), Query Frame = 2
Query:   29 FASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKA---EKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKD-ESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVST------------SKHSGLDTLILLNTSDRDCLARAMKISENQLNDK-------LDNTVVSKD-VIANLQTSLTNFAENWPKLSKFYCRINENLVKV 2560
             A  FS+GYLIGE+L K+ L ++FD+ S+   A  KL+NF  +EP L+LLG+ F+ +VA  +M  +  +   L+YQLFIAL+ KK++  T ++M+T++  A  ++Q I + +Y++RLK I PRQ+++ L+ + +++    + ++ K    + + +   +  +EE       +L R+   R+ Q E M +I+AA+V+IPKPP ++T++AI+  K LK +KE E+   E+  FE+      GR                             +R S++    +   +K  +N +Y+ +I+ RLE D  AR  REKRRR++L+  L  H  QEE  RE  +  RLMRQSQ ERRIAVQL+H RHEK V++ NR+ RE QYQERRE+EF  AL++E  L +Q  L + + +R  Q+L+D   A+    +Y+KHY + ++++  I+D   K  E++ LT   IP K+++EWK  F  G P+YD+    + +    + E  Q                     +K+ LLDE+D  EYK + GEW   +  S+      NNIL ++V RL  +  P    +  P  PPFPIK  V+GK +SGKS  +++L +    + ++  D ++ EA++AF   E  + E +L                         ++EGA     D+ N   +  ++P    + S RA LG      L +G+S+ D+LL+  +VE I RIP  TGWI++ FP T  QA LFEKA TG    N    +  N+K ++               S LD  +L+  SD + L R   I     N++       + N+ +  D  +  +Q  +T F ++W  L  ++      L+KV
Sbjct:   34 LAKEFSSGYLIGEVLNKFQLQEDFDQFSQTRVANGKLNNFTRIEPTLQLLGVPFDQNVAHSIMSEQHGVATRLLYQLFIALQKKKKAGLTGVAMETLRPAAPAKLQSIGTEMYRERLKTIIPRQSEISLQRVSEQFDLKAKEIEDKVAQIQNDELRKIQKIQEELRIQDIEKLRRA---RRRQTEIMARIQAAIVQIPKPPQNRTLKAIEAQKMLKKKKEAEEVYTEITKFEK------GR-----------------------------LRSSVNIGTAL---LKLDTNDDYVRKIQKRLEEDSVAREQREKRRRRILMEQLVGHGAQEEAFREEQLINRLMRQSQQERRIAVQLMHARHEKEVMQQNRMFREKQYQERREREFQEALDREAALQKQAMLDHKEEIRKVQELHDQIAAERAEARYKKHYNLCQEIMNQILDFVIKTGEYRELTNRLIPVKLMREWKELFFAGYPLYDKAP-IDALPSDPTAEQLQET-------------------EKQSLLDEKDYEEYKTMTGEWGPPEASSVKAPAPNNNILGYVVHRLLEIVSPPLAPTPPPVFPPFPIKGCVLGKIYSGKSTCLKHLAQGIVFIQVLSVDTLLEEAIQAFNDGELEKTEDVLR-----------------------PIQEGA-----DKENKVVVHLKLPYCFLQLSARAQLGGLAETHLKSGKSVPDELLISILVEAINRIPANTGWIMEGFPMTETQATLFEKALTG-SHTNLNGIKGNNNKFASLVTDPAAPKDLPVAPSALDFAVLIEISDNEVLQRMSTIISKLKNERIFHVFPNMSNSRMEADQTMDQIQHRITGFLDHWKNLEMWFSEQQNILIKV 812          

HSP 2 Score: 169.088 bits (427), Expect = 3.435e-41
Identity = 79/204 (38.73%), Postives = 122/204 (59.80%), Query Frame = 2
Query: 3095 EVVSVPEVTEP--QPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEI 3700
            E V+V  V  P  QPG  +WVY  +PL  E+ +    +W+++ +VY    K V R +RQ+R  +I Y++ I+   + +L RPD KQE++ Q+Q DFN   D+  EDEE + ELHQR  +L+D+L +I      +A++E   + N+ WL+D  G++ N + +LM +E DRFQD  R L DYY+ M      +    F R+PL++I
Sbjct:  877 EPVAVTPVGPPPIQPGSPEWVYVNEPLPKEIPAFLVPYWKTIENVYGMTIKTVLRNLRQERLTVIHYLYDIRVHLKDYLKRPDHKQEFVSQWQSDFNSTADDLWEDEETKAELHQRADDLRDRLWDICDNRKEEAEQERTDIMNDGWLQDHTGILINHFFSLMQAEVDRFQDTTRLLSDYYQGMEGQAPSEASHTFSRIPLLDI 1080          

HSP 3 Score: 122.479 bits (306), Expect = 4.824e-27
Identity = 102/364 (28.02%), Postives = 174/364 (47.80%), Query Frame = 2
Query: 4418 QEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSAS-ISVIDFVRLINDSLIASDPKTLP-TFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWF------PIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIP 5485
            Q  E++ E ++ +    K K E++AAL+ E     +  +VI  K  E  ++I +  +S ++    W+  + L+E  S++++  + R+HIE    +K ++ L N  FY+N         +           RP ++++  +   T+ QL   Y+ F  I      S  + ID +  I  + + +D   LP +++ L   T   I  +    S + + VNWRLFLL+ S PWP+P+ ++L++ L +FK +D    G +T E +   +LWF      P+P  PT P    +P   NR   +   FFD+F    DP  +           +NY EML++FA     +   G  RALSV +G+ +   P
Sbjct: 1157 QTLEDSTELQKKQELKMKLKQEHIAALEYEEMAANLRLEVIKTKALEVCQDIASRAESAYKDMEMWMGARFLAEMASVEQLIHIARHHIETGTKIKYQLVLENTDFYIN--------SDVQVVPDPPPPSRPPAVEISANATLTVAQLHRLYQQFAQIAPEGLISNKTFIDILLDITSARLGND--ALPDSWMQL---TLPEIKEMTSELSQNSDVVNWRLFLLSASLPWPYPSVTQLLSTLQSFKAVDHNGCGTLTHEGFSQAELWFHGNAEEPVPENPTEP----LP--FNRPAHLIKYFFDLFA---DPRGIP--------PQLNYTEMLLYFA--SHPDPMEGFYRALSVTAGKPILKAP 1488          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: SPEF2 (sperm flagellar 2 [Source:NCBI gene;Acc:100491905])

HSP 1 Score: 395.201 bits (1014), Expect = 1.432e-111
Identity = 283/862 (32.83%), Postives = 454/862 (52.67%), Query Frame = 2
Query:   29 FASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKA---EKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDI-IEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKD-ESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVST------------SKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKV 2560
             A  FS+GYLIGE+L K+ L ++FD+ S+   A  KL+NF  +EP L+LLG+ F+ +VA  +M  +  +   L+YQLFIAL+ KK++  T ++M+T++  A  ++Q I + +Y++RLK I PRQ+++ L+ + +++    + ++ K    + + +   +  +EE       +L R+   R+ Q E M +I+AA+V+IPKPP ++T++AI+  K LK +KE E+   E+  FE+                            G+ D  +  +  +   + +I    +K  +N +Y+ +I+ RLE D  AR  REKRRR++L+  L  H  QEE  RE  +  RLMRQSQ ERRIAVQL+H RHEK V++ NR+ RE QYQERRE+EF  AL++E  L +Q  L + + +R  Q+L+D   A+    +Y+KHY + ++++  I+D   K  E++ LT   IP K+++EWK  F  G P+YD+    + +    + E  Q                     +K+ LLDE+D  EYK + GEW   +  S+      NNIL ++V RL  +  P    +  P  PPFPIK  V+GK +SGKS  +++L +    + ++  D ++ EA++AF   E  + E +L                         ++EGA     D+ N   +  ++P    + S RA LG      L +G+S+ D+LL+  +VE I RIP  TGWI++ FP T  QA LFEKA TG    N    +  N+K ++               S LD  +L+  SD + L R   I     N+++ +   + ++       +T F ++W  L  ++      L+KV
Sbjct:   34 LAKEFSSGYLIGEVLNKFQLQEDFDQFSQTRVANGKLNNFTRIEPTLQLLGVPFDQNVAHSIMSEQHGVATRLLYQLFIALQKKKKAGLTGVAMETLRPAAPAKLQSIGTEMYRERLKTIIPRQSEISLQRVSEQFDLKAKEIEDKVAQIQNDELRKIQKIQEELRIQDIEKLRRA---RRRQTEIMARIQAAIVQIPKPPQNRTLKAIEAQKMLKKKKEAEEVYTEITKFEK----------------------------GVKDGSVGSLSANTRSSVNIGTALLKLDTNDDYVRKIQKRLEEDSVAREQREKRRRRILMEQLVGHGAQEEAFREEQLINRLMRQSQQERRIAVQLMHARHEKEVMQQNRMFREKQYQERREREFQEALDREAALQKQAMLDHKEEIRKVQELHDQIAAERAEARYKKHYNLCQEIMNQILDFVIKTGEYRELTNRLIPVKLMREWKELFFAGYPLYDKAP-IDALPSDPTAEQLQET-------------------EKQSLLDEKDYEEYKTMTGEWGPPEASSVKAPAPNNNILGYVVHRLLEIVSPPLAPTPPPVFPPFPIKGCVLGKIYSGKSTCLKHLAQGIVFIQVLSVDTLLEEAIQAFNDGELEKTEDVLR-----------------------PIQEGA-----DKENKVVVHLKLPYCFLQLSARAQLGGLAETHLKSGKSVPDELLISILVEAINRIPANTGWIMEGFPMTETQATLFEKALTG-SHTNLNGIKGNNNKFASLVTDPAAPKDLPVAPSALDFAVLIEISDNEVLQRMSTIISKLKNERIFHVFAALNL--RFFYRITGFLDHWKNLEMWFSEQQNILIKV 813          

HSP 2 Score: 169.474 bits (428), Expect = 2.618e-41
Identity = 79/204 (38.73%), Postives = 122/204 (59.80%), Query Frame = 2
Query: 3095 EVVSVPEVTEP--QPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEI 3700
            E V+V  V  P  QPG  +WVY  +PL  E+ +    +W+++ +VY    K V R +RQ+R  +I Y++ I+   + +L RPD KQE++ Q+Q DFN   D+  EDEE + ELHQR  +L+D+L +I      +A++E   + N+ WL+D  G++ N + +LM +E DRFQD  R L DYY+ M      +    F R+PL++I
Sbjct:  920 EPVAVTPVGPPPIQPGSPEWVYVNEPLPKEIPAFLVPYWKTIENVYGMTIKTVLRNLRQERLTVIHYLYDIRVHLKDYLKRPDHKQEFVSQWQSDFNSTADDLWEDEETKAELHQRADDLRDRLWDICDNRKEEAEQERTDIMNDGWLQDHTGILINHFFSLMQAEVDRFQDTTRLLSDYYQGMEGQAPSEASHTFSRIPLLDI 1123          

HSP 3 Score: 123.635 bits (309), Expect = 2.253e-27
Identity = 102/364 (28.02%), Postives = 174/364 (47.80%), Query Frame = 2
Query: 4418 QEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSAS-ISVIDFVRLINDSLIASDPKTLP-TFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWF------PIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIP 5485
            Q  E++ E ++ +    K K E++AAL+ E     +  +VI  K  E  ++I +  +S ++    W+  + L+E  S++++  + R+HIE    +K ++ L N  FY+N         +           RP ++++  +   T+ QL   Y+ F  I      S  + ID +  I  + + +D   LP +++ L   T   I  +    S + + VNWRLFLL+ S PWP+P+ ++L++ L +FK +D    G +T E +   +LWF      P+P  PT P    +P   NR   +   FFD+F    DP  +           +NY EML++FA     +   G  RALSV +G+ +   P
Sbjct: 1258 QTLEDSTELQKKQELKMKLKQEHIAALEYEEMAANLRLEVIKTKALEVCQDIASRAESAYKDMEMWMGARFLAEMASVEQLIHIARHHIETGTKIKYQLVLENTDFYIN--------SDVQVVPDPPPPSRPPAVEISANATLTVAQLHRLYQQFAQIAPEGLISNKTFIDILLDITSARLGND--ALPDSWMQL---TLPEIKEMTSELSQNSDVVNWRLFLLSASLPWPYPSVTQLLSTLQSFKAVDHNGCGTLTHEGFSQAELWFHGNAEEPVPENPTEP----LP--FNRPAHLIKYFFDLFA---DPRGIP--------PQLNYTEMLLYFA--SHPDPMEGFYRALSVTAGKPILKAP 1589          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: SPEF2 (sperm flagellar 2 [Source:NCBI gene;Acc:100491905])

HSP 1 Score: 383.645 bits (984), Expect = 3.322e-108
Identity = 285/862 (33.06%), Postives = 451/862 (52.32%), Query Frame = 2
Query:   29 FASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKA---EKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALK-ELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKD-ESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVST------------SKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKV 2560
             A  FS+GYLIGE+L K+ L ++FD+ S+   A  KL+NF  +EP L+LLG+ F+ +VA  +M  +  +   L+YQLFIAL+ KK++  T ++M+T++  A  ++Q I + +Y++RLK I PRQ+++ L+ + +++    + ++ K    + + +   +  +EE       +L R+   R+ Q E M +I+AA+V+IPKPP ++T++AI+  K LK +KE E  L   + N   KQ   + R                             +R S++    +   +K  +N +Y+ +I+ RLE D  AR  REKRRR++L+  L  H  QEE  RE  +  RLMRQSQ ERRIAVQL+H RHEK V++ NR+ RE QYQERRE+EF  AL++E  L +Q  L + + +R  Q+L+D   A+    +Y+KHY + ++++  I+D   K  E++ LT   IP K+++EWK  F  G P+YD+    + +    + E  Q                     +K+ LLDE+D  EYK + GEW   +  S+      NNIL ++V RL  +  P    +  P  PPFPIK  V+GK +SGKS  +++L +    + ++  D ++ EA++AF   E  + E +L                         ++EGA   NK   +   I   +P    + S RA LG      L +G+S+ D+LL+  +VE I RIP  TGWI++ FP T  QA LFEKA TG    N    +  N+K ++               S LD  +L+  SD + L R   I     N+++ +   + ++       +T F ++W  L  ++      L+KV
Sbjct:   34 LAKEFSSGYLIGEVLNKFQLQEDFDQFSQTRVANGKLNNFTRIEPTLQLLGVPFDQNVAHSIMSEQHGVATRLLYQLFIALQKKKKAGLTGVAMETLRPAAPAKLQSIGTEMYRERLKTIIPRQSEISLQRVSEQFDLKAKEIEDKVAQIQNDELRKIQKIQEELRIQDIEKLRRA---RRRQTEIMARIQAAIVQIPKPPQNRTLKAIEAQKMLKKKKEAEVLLGIRMFNSILKQGPTLQR-----------------------------LRSSVNIGTAL---LKLDTNDDYVRKIQKRLEEDSVAREQREKRRRRILMEQLVGHGAQEEAFREEQLINRLMRQSQQERRIAVQLMHARHEKEVMQQNRMFREKQYQERREREFQEALDREAALQKQAMLDHKEEIRKVQELHDQIAAERAEARYKKHYNLCQEIMNQILDFVIKTGEYRELTNRLIPVKLMREWKELFFAGYPLYDKAP-IDALPSDPTAEQLQET-------------------EKQSLLDEKDYEEYKTMTGEWGPPEASSVKAPAPNNNILGYVVHRLLEIVSPPLAPTPPPVFPPFPIKGCVLGKIYSGKSTCLKHLAQGIVFIQVLSVDTLLEEAIQAFNDGELEKTEDVLR-----------------------PIQEGADKENKVVVHLKVI---LPYCFLQLSARAQLGGLAETHLKSGKSVPDELLISILVEAINRIPANTGWIMEGFPMTETQATLFEKALTG-SHTNLNGIKGNNNKFASLVTDPAAPKDLPVAPSALDFAVLIEISDNEVLQRMSTIISKLKNERIFHVFAALNL--RFFYRITGFLDHWKNLEMWFSEQQNILIKV 811          

HSP 2 Score: 168.703 bits (426), Expect = 4.010e-41
Identity = 79/204 (38.73%), Postives = 122/204 (59.80%), Query Frame = 2
Query: 3095 EVVSVPEVTEP--QPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEI 3700
            E V+V  V  P  QPG  +WVY  +PL  E+ +    +W+++ +VY    K V R +RQ+R  +I Y++ I+   + +L RPD KQE++ Q+Q DFN   D+  EDEE + ELHQR  +L+D+L +I      +A++E   + N+ WL+D  G++ N + +LM +E DRFQD  R L DYY+ M      +    F R+PL++I
Sbjct:  895 EPVAVTPVGPPPIQPGSPEWVYVNEPLPKEIPAFLVPYWKTIENVYGMTIKTVLRNLRQERLTVIHYLYDIRVHLKDYLKRPDHKQEFVSQWQSDFNSTADDLWEDEETKAELHQRADDLRDRLWDICDNRKEEAEQERTDIMNDGWLQDHTGILINHFFSLMQAEVDRFQDTTRLLSDYYQGMEGQAPSEASHTFSRIPLLDI 1098          

HSP 3 Score: 122.479 bits (306), Expect = 4.973e-27
Identity = 102/364 (28.02%), Postives = 174/364 (47.80%), Query Frame = 2
Query: 4418 QEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSAS-ISVIDFVRLINDSLIASDPKTLP-TFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWF------PIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIP 5485
            Q  E++ E ++ +    K K E++AAL+ E     +  +VI  K  E  ++I +  +S ++    W+  + L+E  S++++  + R+HIE    +K ++ L N  FY+N         +           RP ++++  +   T+ QL   Y+ F  I      S  + ID +  I  + + +D   LP +++ L   T   I  +    S + + VNWRLFLL+ S PWP+P+ ++L++ L +FK +D    G +T E +   +LWF      P+P  PT P    +P   NR   +   FFD+F    DP  +           +NY EML++FA     +   G  RALSV +G+ +   P
Sbjct: 1175 QTLEDSTELQKKQELKMKLKQEHIAALEYEEMAANLRLEVIKTKALEVCQDIASRAESAYKDMEMWMGARFLAEMASVEQLIHIARHHIETGTKIKYQLVLENTDFYIN--------SDVQVVPDPPPPSRPPAVEISANATLTVAQLHRLYQQFAQIAPEGLISNKTFIDILLDITSARLGND--ALPDSWMQL---TLPEIKEMTSELSQNSDVVNWRLFLLSASLPWPYPSVTQLLSTLQSFKAVDHNGCGTLTHEGFSQAELWFHGNAEEPVPENPTEP----LP--FNRPAHLIKYFFDLFA---DPRGIP--------PQLNYTEMLLYFA--SHPDPMEGFYRALSVTAGKPILKAP 1506          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: SPEF2 (sperm flagellar 2 [Source:NCBI gene;Acc:100491905])

HSP 1 Score: 343.969 bits (881), Expect = 3.383e-95
Identity = 260/746 (34.85%), Postives = 411/746 (55.09%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKA---EKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRN-VVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKD-ESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETIL------SINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEI--PTI---VKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIR 2191
            LS+ ++    A  FS+GYLIGE+L K+ L ++FD+ S+   A  KL+NF  +EP L+LLG+ F+ +VA  +M  +  +   L+YQLFIAL+ KK++  T ++M+T++  A  ++Q I + +Y++RLK I PRQ+++ L+ + +++    + ++ K    + + +   +  +EE       +L R+   R+ Q E M +I+AA+V+IPKPP ++T++AI+  K LK +KE E+   E+  FE+  ++  VG              S S +  G T   L  +R S++    ++   K  +N +Y+ +I+ RLE D  AR  REKRRR++L+  L  H  QEE  RE  +  RLMRQSQ ERRIAVQL+H RHEK V++ NR+ RE QYQERRE+EF  AL++E  L +Q  L + + +R  Q+L+D   A+    +Y+KHY + ++++  I+D   K  E++ LT   IP K+++EWK  F  G P+YD+                        LP +     +   EK+  LLDE+D  EYK + GEW   +  S+      NNIL ++V RL  +  P    +  P  PPFPIK  V+GK +SGKS  +++L +      +    ++ EA++AF   E  + E +L      +  EN  ID          I +  S  + A S    E++    +++I  P I   V K S RA LG      L +G+S+ D+LL+  +VE I+
Sbjct:   15 LSKRVEPKYLAKEFSSGYLIGEVLNKFQLQEDFDQFSQTRVANGKLNNFTRIEPTLQLLGVPFDQNVAHSIMSEQHGVATRLLYQLFIALQKKKKAGLTGVAMETLRPAAPAKLQSIGTEMYRERLKTIIPRQSEISLQRVSEQFDLKAKEIEDKVAQIQNDELRKIQKIQEELRIQDIEKLRRA---RRRQTEIMARIQAAIVQIPKPPQNRTLKAIEAQKMLKKKKEAEEVYTEITKFEKGVKDGSVG--------------SLSANTRGPT---LQRLRSSVNIGTALL---KLDTNDDYVRKIQKRLEEDSVAREQREKRRRRILMEQLVGHGAQEEAFREEQLINRLMRQSQQERRIAVQLMHARHEKEVMQQNRMFREKQYQERREREFQEALDREAALQKQAMLDHKEEIRKVQELHDQIAAERAEARYKKHYNLCQEIMNQILDFVIKTGEYRELTNRLIPVKLMREWKELFFAGYPLYDKAPID-------------------ALPSDPTAEQLQETEKQ-SLLDEKDYEEYKTMTGEWGPPEASSVKAPAPNNNILGYVVHRLLEIVSPPLAPTPPPVFPPFPIKGCVLGKIYSGKSTCLKHLAQVYSIQVLSVDTLLEEAIQAFNDGELEKTEDVLRPIQEGADKENKPIDSPAPVTNGEEIPVVGSGSKPA-SAEARESDKELSLHQILKPAIEDTVPKLSARAQLGGLAETHLKSGKSVPDELLISILVEAIK 716          

HSP 2 Score: 169.474 bits (428), Expect = 2.427e-41
Identity = 79/204 (38.73%), Postives = 122/204 (59.80%), Query Frame = 2
Query: 3095 EVVSVPEVTEP--QPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEI 3700
            E V+V  V  P  QPG  +WVY  +PL  E+ +    +W+++ +VY    K V R +RQ+R  +I Y++ I+   + +L RPD KQE++ Q+Q DFN   D+  EDEE + ELHQR  +L+D+L +I      +A++E   + N+ WL+D  G++ N + +LM +E DRFQD  R L DYY+ M      +    F R+PL++I
Sbjct:  873 EPVAVTPVGPPPIQPGSPEWVYVNEPLPKEIPAFLVPYWKTIENVYGMTIKTVLRNLRQERLTVIHYLYDIRVHLKDYLKRPDHKQEFVSQWQSDFNSTADDLWEDEETKAELHQRADDLRDRLWDICDNRKEEAEQERTDIMNDGWLQDHTGILINHFFSLMQAEVDRFQDTTRLLSDYYQGMEGQAPSEASHTFSRIPLLDI 1076          

HSP 3 Score: 125.946 bits (315), Expect = 4.511e-28
Identity = 103/359 (28.69%), Postives = 172/359 (47.91%), Query Frame = 2
Query: 4433 TEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSAS-ISVIDFVRLINDSLIASDPKTLP-TFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWF------PIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIP 5485
            TE  K+  L + K K E++AAL+ E     +  +VI  K  E  ++I +  +S ++    W+  + L+E  S++++  + R+HIE    +K ++ L N  FY+N         +           RP ++++  +   T+ QL   Y+ F  I      S  + ID +  I  + + +D   LP +++ L   T   I  +    S + + VNWRLFLL+ S PWP+P+ ++L++ L +FK +D    G +T E +   +LWF      P+P  PT P    +P   NR   +   FFD+F    DP  +           +NY EML++FA     +   G  RALSV +G+ +   P
Sbjct: 1225 TELQKKQELKM-KLKQEHIAALEYEEMAANLRLEVIKTKALEVCQDIASRAESAYKDMEMWMGARFLAEMASVEQLIHIARHHIETGTKIKYQLVLENTDFYIN--------SDVQVVPDPPPPSRPPAVEISANATLTVAQLHRLYQQFAQIAPEGLISNKTFIDILLDITSARLGND--ALPDSWMQL---TLPEIKEMTSELSQNSDVVNWRLFLLSASLPWPYPSVTQLLSTLQSFKAVDHNGCGTLTHEGFSQAELWFHGNAEEPVPENPTEP----LP--FNRPAHLIKYFFDLFA---DPRGIP--------PQLNYTEMLLYFA--SHPDPMEGFYRALSVTAGKPILKAP 1550          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Match: SPEF2 (sperm flagellar 2 [Source:NCBI gene;Acc:100491905])

HSP 1 Score: 312.768 bits (800), Expect = 1.571e-85
Identity = 214/606 (35.31%), Postives = 342/606 (56.44%), Query Frame = 2
Query:   29 FASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKA---EKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDI-IEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKD-ESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVK 1831
             A  FS+GYLIGE+L K+ L ++FD+ S+  +    L+NF  +EP L+LLG+ F+ +VA  +M  +  +   L+YQLFIAL+ KK++  T ++M+T++  A  ++Q I + +Y++RLK I PRQ+++ L+ + +++    + ++ K    + + +   +  +EE       +L R+   R+ Q E M +I+AA+V+IPKPP ++T++AI+  K LK +KE E+   E+  FE+                            G+ D  +  +  +   + +I    +K  +N +Y+ +I+ RLE D  AR  REKRRR++L+  L  H  QEE  RE  +  RLMRQSQ ERRIAVQL+H RHEK V++ NR+ RE QYQERRE+EF  AL++E  L +Q  L + + +R  Q+L+D   A+    +Y+KHY + ++++  I+D   K  E++ LT   IP K+++EWK  F  G P+YD+    + +    + E  Q                     +K+ LLDE+D  EYK + GEW   +  S+      NNIL ++V RL  +  P    +  P  PPFPIK  V+GK +SGKS  +++L +
Sbjct:   17 LAKEFSSGYLIGEVLNKFQLQEDFDQFSQTRSV-LTLNNFTRIEPTLQLLGVPFDQNVAHSIMSEQHGVATRLLYQLFIALQKKKKAGLTGVAMETLRPAAPAKLQSIGTEMYRERLKTIIPRQSEISLQRVSEQFDLKAKEIEDKVAQIQNDELRKIQKIQEELRIQDIEKLRRA---RRRQTEIMARIQAAIVQIPKPPQNRTLKAIEAQKMLKKKKEAEEVYTEITKFEK----------------------------GVKDGSVGSLSANTRSSVNIGTALLKLDTNDDYVRKIQKRLEEDSVAREQREKRRRRILMEQLVGHGAQEEAFREEQLINRLMRQSQQERRIAVQLMHARHEKEVMQQNRMFREKQYQERREREFQEALDREAALQKQAMLDHKEEIRKVQELHDQIAAERAEARYKKHYNLCQEIMNQILDFVIKTGEYRELTNRLIPVKLMREWKELFFAGYPLYDKAP-IDALPSDPTAEQLQET-------------------EKQSLLDEKDYEEYKTMTGEWGPPEASSVKAPAPNNNILGYVVHRLLEIVSPPLAPTPPPVFPPFPIKGCVLGKIYSGKSTCLKHLAQ 570          

HSP 2 Score: 169.088 bits (427), Expect = 3.462e-41
Identity = 79/204 (38.73%), Postives = 122/204 (59.80%), Query Frame = 2
Query: 3095 EVVSVPEVTEP--QPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEI 3700
            E V+V  V  P  QPG  +WVY  +PL  E+ +    +W+++ +VY    K V R +RQ+R  +I Y++ I+   + +L RPD KQE++ Q+Q DFN   D+  EDEE + ELHQR  +L+D+L +I      +A++E   + N+ WL+D  G++ N + +LM +E DRFQD  R L DYY+ M      +    F R+PL++I
Sbjct:  852 EPVAVTPVGPPPIQPGSPEWVYVNEPLPKEIPAFLVPYWKTIENVYGMTIKTVLRNLRQERLTVIHYLYDIRVHLKDYLKRPDHKQEFVSQWQSDFNSTADDLWEDEETKAELHQRADDLRDRLWDICDNRKEEAEQERTDIMNDGWLQDHTGILINHFFSLMQAEVDRFQDTTRLLSDYYQGMEGQAPSEASHTFSRIPLLDI 1055          

HSP 3 Score: 123.25 bits (308), Expect = 3.271e-27
Identity = 102/364 (28.02%), Postives = 174/364 (47.80%), Query Frame = 2
Query: 4418 QEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSAS-ISVIDFVRLINDSLIASDPKTLP-TFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWF------PIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIP 5485
            Q  E++ E ++ +    K K E++AAL+ E     +  +VI  K  E  ++I +  +S ++    W+  + L+E  S++++  + R+HIE    +K ++ L N  FY+N         +           RP ++++  +   T+ QL   Y+ F  I      S  + ID +  I  + + +D   LP +++ L   T   I  +    S + + VNWRLFLL+ S PWP+P+ ++L++ L +FK +D    G +T E +   +LWF      P+P  PT P    +P   NR   +   FFD+F    DP  +           +NY EML++FA     +   G  RALSV +G+ +   P
Sbjct: 1146 QTLEDSTELQKKQELKMKLKQEHIAALEYEEMAANLRLEVIKTKALEVCQDIASRAESAYKDMEMWMGARFLAEMASVEQLIHIARHHIETGTKIKYQLVLENTDFYIN--------SDVQVVPDPPPPSRPPAVEISANATLTVAQLHRLYQQFAQIAPEGLISNKTFIDILLDITSARLGND--ALPDSWMQL---TLPEIKEMTSELSQNSDVVNWRLFLLSASLPWPYPSVTQLLSTLQSFKAVDHNGCGTLTHEGFSQAELWFHGNAEEPVPENPTEP----LP--FNRPAHLIKYFFDLFA---DPRGIP--------PQLNYTEMLLYFA--SHPDPMEGFYRALSVTAGKPILKAP 1477          

HSP 4 Score: 81.2629 bits (199), Expect = 1.907e-14
Identity = 56/183 (30.60%), Postives = 86/183 (46.99%), Query Frame = 2
Query: 2054 IVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVST------------SKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQ--TSLTNFAENWPKLSKFYCRINENLVKV 2560
            +  E+P    + S RA LG      L +G+S+ D+LL+  +VE I RIP  TGWI++ FP T  QA LFEKA TG    N    +  N+K ++               S LD  +L+  SD + L R   I    +++      + +    NL+    +T F ++W  L  ++      L+KV
Sbjct:  568 LAQELPYCFLQLSARAQLGGLAETHLKSGKSVPDELLISILVEAINRIPANTGWIMEGFPMTETQATLFEKALTG-SHTNLNGIKGNNNKFASLVTDPAAPKDLPVAPSALDFAVLIEISDNEVLQRMSTI----ISNSFLAYSLPRFAALNLRFFYRITGFLDHWKNLEMWFSEQQNILIKV 745          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Spef2 (sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:2443727])

HSP 1 Score: 363.229 bits (931), Expect = 4.535e-106
Identity = 279/910 (30.66%), Postives = 464/910 (50.99%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQ----------SNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDE-----NNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEE------------PNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKL--------------DNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMD 2584
            +S+ +   +FA  FSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L              EI++         + P QT++ L+ L                            ++E  R+ RLNR +     Q E M KI+AA+++IPKP  ++T++AI+  K +K +KE ED   E+  FE     ++ +D                            I++S+S T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+++++    +    +Y+KHY +  +++  ++DL  K++++++LT   IP K++ +WK  F +G+PIY++T+ T    +                P E   + +    KKR LLD +D  +YK ++GEW + ++ +      NN IL  ++ RL   + P   N++   LP   +K  ++GK  SGK+ ++++L +N+  V ++  D ++ EA++AF           + E+ + + +++  + SK  +DK    V+ +  + + ++  V  N+ E     ++F  +           S RA LG K    L  G+SI D LLV  +V  I+ IP    W++D FP T  QAKL E+A TGY+             P       T+++VS    S LD +ILL+ SD   LAR   I   +++ ++              DN    +++  ++Q  +  F +NWP L +++ +    L KV   N E+D
Sbjct:   15 VSRTVSPKSFAKAFSNGYLIGEVLFKFELQSDFAEFSESRGSTAKLNNFSRLQPTLHLLGLQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGL--------------EIQT---------MQP-QTNLRLQTL----------------------------KSEAFREQRLNRRR-----QNEIMAKIQAAIIQIPKPESNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKDL--------------------------QIKESVSKTSLETTDQTTAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLMAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALAKQAKIDFAEQTLREKEIHEKISVERAQQRYKKHYGICAEILDQMLDLCTKVADYRLLTNNLIPHKMMHDWKELFFSGIPIYEQTSLTHGQTE----------------PTEDHRAEV----KKRNLLDSKDYEDYKNMVGEWALPEDMVNSSPPSNNSILGHVLLRLIEKADPSASNAEATELPSLAVKGCILGKTLSGKTTVLKSL-QNDFPVHVLSIDTLVQEAIQAFHERQKSGKTPPTQEDDKRDPVVNQEKVSKT-QDKNVLAVSPVPGDRTSQKEGVKINEFEQFRSSDSFLSL-----------SMRAQLGAKSELMLRRGKSIPDILLVSILVNAIKEIPVDQSWVLDGFPITLNQAKLLEEALTGYKRKFLQLKKKKEQMPTLALDPSTSTEVSLLP-SALDFVILLDISDNSSLARTNDIIAKEISHEISHENVGRPGTGTSQDNKSEDRNLRDHIQHRIVGFLDNWPLLEEWFTQPKNILTKV---NAEID 800          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Spef2 (sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:2443727])

HSP 1 Score: 361.688 bits (927), Expect = 9.527e-101
Identity = 276/910 (30.33%), Postives = 461/910 (50.66%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQ----------SNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFN-----KDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEE------------PNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKL--------------DNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMD 2584
            +S+ +   +FA  FSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L                        ++ + P QT++ L+ L                            ++E  R+ RLNR +     Q E M KI+AA+++IPKP  ++T++AI+  K +K +KE ED   E+  FE     ++ +D                            I++S+S T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+++++    +    +Y+KHY +  +++  ++DL  K++++++LT   IP K++ +WK  F +G+PIY++T+ T    +                P E   + +    KKR LLD +D  +YK ++GEW + ++ +      NN IL  ++ RL   + P   N++   LP   +K  ++GK  SGK+ ++++L +N+  V ++  D ++ EA++AF           + E+ + + +++  + SK  +DK    V+ +  + + ++  V  N     +  ++F  +           S RA LG K    L  G+SI D LLV  +V  I+ IP    W++D FP T  QAKL E+A TGY+             P       T+++VS    S LD +ILL+ SD   LAR   I   +++ ++              DN    +++  ++Q  +  F +NWP L +++ +    L KV   N E+D
Sbjct:   15 VSRTVSPKSFAKAFSNGYLIGEVLFKFELQSDFAEFSESRGSTAKLNNFSRLQPTLHLLGLQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGLE-----------------------IQTMQP-QTNLRLQTL----------------------------KSEAFREQRLNRRR-----QNEIMAKIQAAIIQIPKPESNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKDL--------------------------QIKESVSKTSLETTDQTTAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLMAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALAKQAKIDFAEQTLREKEIHEKISVERAQQRYKKHYGICAEILDQMLDLCTKVADYRLLTNNLIPHKMMHDWKELFFSGIPIYEQTSLTHGQTE----------------PTEDHRAEV----KKRNLLDSKDYEDYKNMVGEWALPEDMVNSSPPSNNSILGHVLLRLIEKADPSASNAEATELPSLAVKGCILGKTLSGKTTVLKSL-QNDFPVHVLSIDTLVQEAIQAFHERQKSGKTPPTQEDDKRDPVVNQEKVSKT-QDKNVLAVSPVPGDRTSQKEGVKINEFEQFRSSDSFLSL-----------SMRAQLGAKSELMLRRGKSIPDILLVSILVNAIKEIPVDQSWVLDGFPITLNQAKLLEEALTGYKRKFLQLKKKKEQMPTLALDPSTSTEVSLLP-SALDFVILLDISDNSSLARTNDIIAKEISHEISHENVGRPGTGTSQDNKSEDRNLRDHIQHRIVGFLDNWPLLEEWFTQPKNILTKV---NAEID 800          

HSP 2 Score: 156.762 bits (395), Expect = 1.483e-37
Identity = 71/190 (37.37%), Postives = 123/190 (64.74%), Query Frame = 2
Query: 3134 GDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEI 3700
            G  +WVY  +P+  EL S    +WE +   Y N+ K V R +R+ +  ++ Y++  + +F+ FL RPD KQ+++ Q+Q DFN + ++  EDEE + ELHQR+++L+D+L +I +    +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY++M   + LED + +F R+PL+++
Sbjct:  910 GTEEWVYVNEPIPEELPSFLVPYWELIEKSYINHIKTVLRHLRERQHNVLSYLYETRTSFQEFLRRPDHKQDFVSQWQADFNSVPEDLWEDEETKAELHQRVNDLRDRLWDICEARKEEAEQERLDIINESWLQDSIGITMNHFFSLMQAEVNRFQDTKRLLQDYYRAMESKIPLEDSK-KFTRVPLVQL 1098          

HSP 3 Score: 113.235 bits (282), Expect = 2.842e-24
Identity = 102/386 (26.42%), Postives = 172/386 (44.56%), Query Frame = 2
Query: 4385 TPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISM--------------------IPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFP------IPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
            +P  EV+       E  E +K+N L L + K E++AALQ E    +   ++I LK    ++++      V++L   W+  + L+E  SI+++ ++ RYHIE    ++ +I L    FY+N +I +                    + +E+ D+ + Q +++ P+ I  +G+        KAF  +   + T +   +   +F            P +      L+      +  I    + + E+V+WR FL+  + PWP   + EL+  L  FK LD+  TG +T EQY    LWF       IP  P  P    +P   NRQ  +   FF +F            D +     ++Y +ML++FA  C  +   G+ RALSVA G
Sbjct: 1224 SPVAEVSPVTVTPEEMAEMEKRNELRL-RIKEEHLAALQTEEQAAQFRLELIKLKALSVLEDLVTKVIDVYRLMEKWLGKRYLNEMASIQKLTELARYHIETATKIQNEIYLSQEDFYINGDIKVFPDPSPPTRPPPVEREENGTLTIEQLDNLRDQFLDMAPKGI--IGN--------KAFSDILLDLITLN---LGTNNF------------PSSWMHLSQLD------LQEITSLLTVNTEFVDWRKFLMVTAMPWPMALEDELLDTLQRFKALDEAQTGTITYEQYKQAGLWFSGDEDIKIPENPLEP----LP--FNRQEHLIEFFFRLF-----------ADCEKEPPQLDYTQMLLYFA--CHPDTLEGVYRALSVAVG 1558          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Spef2 (sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:2443727])

HSP 1 Score: 360.533 bits (924), Expect = 6.094e-100
Identity = 278/910 (30.55%), Postives = 463/910 (50.88%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQ----------SNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFN-----KDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEE------------PNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKL--------------DNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMD 2584
            +S+ +   +FA  FSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L              EI++         + P QT++ L+ L                            ++E  R+ RLNR +     Q E M KI+AA+++IPKP  ++T++AI+  K +K +KE ED   E+  FE     ++ +D                            I++S+S T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+++++    +    +Y+KHY +  +++  ++DL  K++++++LT   IP K++ +WK  F +G+PIY++T+ T    +                P E   + +    KKR LLD +D  +YK ++GEW + ++ +      NN IL  ++ RL   + P   N++   LP   +K  ++GK  SGK+ ++++L +N+  V ++  D ++ EA++AF           + E+ + + +++  + SK  +DK    V+ +  + + ++  V  N     +  ++F  +           S RA LG K    L  G+SI D LLV  +V  I+ IP    W++D FP T  QAKL E+A TGY+             P       T+++VS    S LD +ILL+ SD   LAR   I   +++ ++              DN    +++  ++Q  +  F +NWP L +++ +    L KV   N E+D
Sbjct:   15 VSRTVSPKSFAKAFSNGYLIGEVLFKFELQSDFAEFSESRGSTAKLNNFSRLQPTLHLLGLQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGL--------------EIQT---------MQP-QTNLRLQTL----------------------------KSEAFREQRLNRRR-----QNEIMAKIQAAIIQIPKPESNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKDL--------------------------QIKESVSKTSLETTDQTTAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLMAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALAKQAKIDFAEQTLREKEIHEKISVERAQQRYKKHYGICAEILDQMLDLCTKVADYRLLTNNLIPHKMMHDWKELFFSGIPIYEQTSLTHGQTE----------------PTEDHRAEV----KKRNLLDSKDYEDYKNMVGEWALPEDMVNSSPPSNNSILGHVLLRLIEKADPSASNAEATELPSLAVKGCILGKTLSGKTTVLKSL-QNDFPVHVLSIDTLVQEAIQAFHERQKSGKTPPTQEDDKRDPVVNQEKVSKT-QDKNVLAVSPVPGDRTSQKEGVKINEFEQFRSSDSFLSL-----------SMRAQLGAKSELMLRRGKSIPDILLVSILVNAIKEIPVDQSWVLDGFPITLNQAKLLEEALTGYKRKFLQLKKKKEQMPTLALDPSTSTEVSLLP-SALDFVILLDISDNSSLARTNDIIAKEISHEISHENVGRPGTGTSQDNKSEDRNLRDHIQHRIVGFLDNWPLLEEWFTQPKNILTKV---NAEID 800          

HSP 2 Score: 157.147 bits (396), Expect = 1.225e-37
Identity = 71/190 (37.37%), Postives = 123/190 (64.74%), Query Frame = 2
Query: 3134 GDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEI 3700
            G  +WVY  +P+  EL S    +WE +   Y N+ K V R +R+ +  ++ Y++  + +F+ FL RPD KQ+++ Q+Q DFN + ++  EDEE + ELHQR+++L+D+L +I +    +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY++M   + LED + +F R+PL+++
Sbjct:  910 GTEEWVYVNEPIPEELPSFLVPYWELIEKSYINHIKTVLRHLRERQHNVLSYLYETRTSFQEFLRRPDHKQDFVSQWQADFNSVPEDLWEDEETKAELHQRVNDLRDRLWDICEARKEEAEQERLDIINESWLQDSIGITMNHFFSLMQAEVNRFQDTKRLLQDYYRAMESKIPLEDSK-KFTRVPLVQL 1098          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Spef2 (sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:2443727])

HSP 1 Score: 327.791 bits (839), Expect = 1.051e-96
Identity = 214/639 (33.49%), Postives = 365/639 (57.12%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQ 1894
            +S+ +   +FA  FSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L +QT+Q     ++Q ++S  +++RLK + PRQTD  L  +  ++Q+  + M+    +      E  ++  E+ R   + + +  R+ Q E M KI+AA+++IPKP  ++T++AI+  K +K +KE ED   E+  FE     ++ +D                            I++S+S T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+++++    +    +Y+KHY +  +++  ++DL  K++++++LT   IP K++ +WK  F +G+PIY++T+ T    +                P E   + +    KKR LLD +D  +YK ++GEW + ++ +      NN IL  ++ RL   + P   N++   LP   +K  ++GK  SGK+ ++++L +N+  V ++  D ++ EA++AF 
Sbjct:   15 VSRTVSPKSFAKAFSNGYLIGEVLFKFELQSDFAEFSESRGSTAKLNNFSRLQPTLHLLGLQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGLEIQTMQPQTNLRLQTLKSEAFRERLKNLIPRQTDFNLMRVTCRFQEKCKQMKEDLARMNFEKFEKIQKLEEEQRHFNIEKQRLNRRRQNEIMAKIQAAIIQIPKPESNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKDL--------------------------QIKESVSKTSLETTDQTTAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLMAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALAKQAKIDFAEQTLREKEIHEKISVERAQQRYKKHYGICAEILDQMLDLCTKVADYRLLTNNLIPHKMMHDWKELFFSGIPIYEQTSLTHGQTE----------------PTEDHRAEV----KKRNLLDSKDYEDYKNMVGEWALPEDMVNSSPPSNNSILGHVLLRLIEKADPSASNAEATELPSLAVKGCILGKTLSGKTTVLKSL-QNDFPVHVLSIDTLVQEAIQAFH 602          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Match: Spef2 (sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:2443727])

HSP 1 Score: 280.796 bits (717), Expect = 7.458e-82
Identity = 187/544 (34.38%), Postives = 311/544 (57.17%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYK 1615
            +S+ +   +FA  FSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L +QT+Q     ++Q ++S  +++RLK + PRQTD  L  +  ++Q+  + M+    +      E  ++  E+ R   + + +  R+ Q E M KI+AA+++IPKP  ++T++AI+  K +K +KE ED   E+  FE     ++ +D                            I++S+S T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+++++    +    +Y+KHY +  +++  ++DL  K++++++LT   IP K++ +WK  F +G+PIY++T+ T    +                P E   + +    KKR LLD +D  +YK
Sbjct:   15 VSRTVSPKSFAKAFSNGYLIGEVLFKFELQSDFAEFSESRGSTAKLNNFSRLQPTLHLLGLQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGLEIQTMQPQTNLRLQTLKSEAFRERLKNLIPRQTDFNLMRVTCRFQEKCKQMKEDLARMNFEKFEKIQKLEEEQRHFNIEKQRLNRRRQNEIMAKIQAAIIQIPKPESNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKD--------------------------LQIKESVSKTSLETTDQTTAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLMAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALAKQAKIDFAEQTLREKEIHEKISVERAQQRYKKHYGICAEILDQMLDLCTKVADYRLLTNNLIPHKMMHDWKELFFSGIPIYEQTSLTHGQTE----------------PTEDHRAEV----KKRNLLDSKDYEDYK 508          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9R095|SPEF2_RAT (Sperm flagellar protein 2 OS=Rattus norvegicus OX=10116 GN=Spef2 PE=1 SV=2)

HSP 1 Score: 399.053 bits (1024), Expect = 9.879e-112
Identity = 295/905 (32.60%), Postives = 480/905 (53.04%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEI-KDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQSNEEIEVETILSINENSKID-----------EDKTENQVTYINLNAS-MEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRR-----------TNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMD 2584
            +S+ +   +FA TFSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L +QT+Q     ++Q ++S  +++RLK + PRQTD  L  +  ++Q+  + M+    +      E  ++  E+ R   + + +  R+ Q E M KI+AA+++IPKP P++T++AI+  K +K +KE ED   E+  FE     ++ +D                             R+SIS T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +     +++++    +    +Y KHY +  +++  I+DL  K++++++LT   IP K++++WK  F +G PIY++T+ T    +++S E   V +                   KR LLD +D  +YK + GEW + +D + +     NNIL  ++ RL   S+P ++      LP F +K  ++GK  SGK+ +++ L +N+  + ++  D ++ EA++AF   E  +     S++E+ K D           +DK E   T +   A+  +EG  S   D   F P  N   ++    S RA LG K    L  G+S+ D LLV  +V  I++IP    W++D FP T  QAKL E+A TGY+  + +  ++           T SK      S  D  ILL+ SD   LAR   I   +++ ++ +  VS   I              ++Q  +  F +NWP L +++      L KV   N E+D
Sbjct:   15 VSRTVSPKSFAKTFSNGYLIGEVLFKFELQSDFSEFSESRVSTAKLNNFSRLQPTLHLLGVQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGLEIQTMQPQTNQRLQALKSEAFRERLKNLIPRQTDFNLMRVTCRFQEKCKQMKEDLARMHFEKFEKIQKLEEEQRHFNIEKQRLNRRRQNEIMAKIQAAIIQIPKPEPNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKDL--------------------------QTRESISKTSLDTIDQTAAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLIAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALTKQAKIDFAEQTLRAKEIHEKIAMERAQQRYEKHYGICAEILDQILDLCTKVADYRLLTNNLIPHKMMRDWKELFFSGNPIYEQTSHTHG--QTESTEDHHVEL------------------NKRNLLDSKDYEDYKNMTGEWALPEDMANSSPPSNNNILGHVLLRLIENSYPSEKEVADTELPSFAVKGCLLGKTLSGKTTILKAL-QNDIPIQVLSIDTLVQEAIQAFNDGE--KSSKAPSMHEDVKGDPEVDQKEMIIPQDKNELTDTQVPGEAAPQKEGTKS--SDFEQFRP-SNSFLSL----SMRAQLGAKSELMLRRGKSVPDVLLVNILVNAIKKIPVNQSWVLDGFPMTVNQAKLLEEALTGYKRKSLQLKKKKAQMPTLALSPTTSKEVPFLPSAFDFAILLDISDNSSLARINDIIAKEISHEISHENVSGPTITSSEEKSEDRNLRDHIQHRIVGFLDNWPLLEEWFTEPRNILKKV---NAEID 856          

HSP 2 Score: 159.458 bits (402), Expect = 1.494e-37
Identity = 71/192 (36.98%), Postives = 126/192 (65.62%), Query Frame = 2
Query: 3128 QPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEI 3700
            +PG  +WVY  +P+  EL S    +WE +   Y ++ K V R++R+ +  ++ Y++  + +F+ FL RPD KQ+++ Q+Q DFN + ++  EDEE + ELHQR+++L+D+L +I +    +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY++M   + LED + +F R+PL+++
Sbjct:  964 KPGSEEWVYVTEPIPEELPSFLVPYWELIEKTYISHIKTVLRQLRESQHTVLSYLYETRTSFQEFLRRPDHKQDFVSQWQADFNSVPEDLWEDEETKAELHQRVNDLRDRLWDICEARKEEAEQERLDIINESWLQDYIGITMNHFFSLMQAEVNRFQDTKRLLQDYYRAMESRIPLEDNK-KFTRIPLVQL 1154          

HSP 3 Score: 106.301 bits (264), Expect = 2.639e-21
Identity = 104/367 (28.34%), Postives = 172/367 (46.87%), Query Frame = 2
Query: 4415 PQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDS-----DKKQRVEVRPESIDVVGDRYF-----TIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFP------IPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGD-DPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
            P+E  E E  ++N L L K K E++AALQ E    +   ++I  K    ++++      V++    W+  + L+E  SI+++ +V RYHIE    ++ +I L    FY+N +I + P     +     +K++   +  E +D + D++       I   KAF  +   + T +           L  ++L +S       +++L   T+  +  I    + + E+V+WR FL+  + PWP P + EL+  L  FK  D+  TG +T EQY    LWF       IP  P  P    +P   NRQ  +   FF +F   + DP +L            +Y +ML++FA  C  +   G+ RALSVA G
Sbjct: 1313 PEEMAEME--RKNELKL-KIKEEHLAALQTEEQATQFRLELIKSKALSILEDLVTKVIEVYRFMEKWLGKRYLNEMASIQKLTEVARYHIETATKIQNEIYLSQEDFYINGDIKVFPDPPPPTRPPPVEKEENGTLTIEQLDNLRDQFLDMAPKGIIGNKAFTDILLDLVTLN-----------LGTNNLSSS-------WMHL---TQLDLQEITSLLTVNTEFVDWRKFLMVAAMPWPIPLEEELLETLQRFKATDEAQTGTITFEQYKQAGLWFSGDEDIKIPENPLEP----LP--FNRQEHLIEFFFRLFADSEKDPPQL------------DYTQMLLYFA--CHPDTLEGVYRALSVAVG 1635          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2IA00|SPEF2_PIG (Sperm flagellar protein 2 OS=Sus scrofa OX=9823 GN=SPEF2 PE=2 SV=1)

HSP 1 Score: 392.889 bits (1008), Expect = 1.292e-109
Identity = 286/893 (32.03%), Postives = 470/893 (52.63%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK-QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNF----TPIVNEI--PTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYE----EPNSRSSRRTNSKVSTSKH-------SGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMD 2584
            +SQ +   +FA  FS+GYLIGE+L KY+L D+F + S++  + AKL+NF  LEP L LLG+ F+ +VA D++  K  + + L+YQL+IAL+ KK+S  T + +QT+Q    T++Q ++S  ++ RL+ + PRQTD+ L  +  ++Q+  +          +   E  ++  E+ R   + + +  R+ Q E M +I+AA+++IPKP  ++T++A+   K +K +KE ED   E+  FE   ++++  ++        +  ++ +   N  +DD                         EYI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE QY+ERR K+F +AL++E  L +Q K+   +    E+++++   A+    +Y+KHY +  +++  I+DLS K++++++LT   IP K++ +WK  F NG+PIY++ +      K  + +L ++                    +KR+LLD  D  EYK ++GEW + +E +  I   +N IL  ++ RL   S P    S  P LP F IK  ++GK FSGK+  ++ L K      +    ++ EA++AF +NE++     L      K    + E+     NL+  +        +DE       TP   E+     + + + RA LG K    L  G+SI+D LLV  +V  I +IP   GWI+D FP T  QAKL E+A TG+     E   + S+ +   V  +         S  D ++LL+ SD   L R   I       +  +  +++ V A              +Q  +  F ++WP L +++      L+K+   N E+D
Sbjct:   15 VSQTVSPKSFAKAFSSGYLIGEVLHKYELQDDFAEFSEKRISSAKLNNFSRLEPTLHLLGVQFDQNVAHDIITEKPGVAMKLLYQLYIALQRKKKSGLTGVELQTMQPLTNTKLQNMKSEAFRDRLRNLIPRQTDVSLMRVSHRFQEKYKYKDEDLVHTHLKKLENFQKLQEEQRSFNIEKQRLSRRRQNEIMAQIQAAIIQIPKPASNRTLKALDAQKMMKKKKEAEDVANEIKKFEALIKKDLQAKESASKTSLDAAGQTTTDLLNTYSDD-------------------------EYIKKIQKRLEEDAFAREQREKRRRRLLMDQLIAHEAQEEAYREEQLVSRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQYEERRLKDFQDALDREAALAKQAKIDYEEQALREKEMHEQIAAERVQARYKKHYSICAEILDQILDLSTKVADYRMLTNNLIPYKLMHDWKELFFNGMPIYEQASLKHLSAKPSTEQLIEL--------------------EKRDLLDNNDYEEYKNMVGEWALPEEMVDNIPPSDNRILGHVIHRLIEHSLPPQVESTAPELPSFAIKGCLLGKTFSGKTTALKFLQKYFPIEVLSIDTLVQEAIQAFHNNEKVSGALQLQKAAEEKASPVRQESGDRSQNLHNVLSAEGTPETEDETRLSTKKTPKAEEVIASASLSELTTRAQLGAKSEKLLKKGKSISDTLLVSIVVNAINQIPIYKGWILDGFPMTLNQAKLLEEALTGFNRNLIELEGKKSQISTLAVDPTASREVPLPPSAFDFVMLLDISDNTSLNRMNDIMAEAFLSETPHENINQRVAAENQDMDEDQNLRDQIQHRIIGFWDHWPSLEQWFTEPENILIKM---NAEVD 859          

HSP 2 Score: 148.673 bits (374), Expect = 3.042e-34
Identity = 66/189 (34.92%), Postives = 113/189 (59.79%), Query Frame = 2
Query: 3134 GDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEI 3700
            G  +WV+  +P+  E+      +W+ + + Y N+ K V R +R+ +  ++ Y++  +  F+ FL RPD KQ ++ Q+Q DFN + D+  EDEE + ELHQR+++L+D+L +I      +A++E   + N  WL+D  G+  N + +LM +E +RFQD  R L+DYY+ M      D    F R+PL+++
Sbjct: 1001 GSEEWVFVNEPIPEEIPLFLVPYWKLIENSYINSIKTVLRHLREGQHTVLAYLYDTRTGFQQFLRRPDHKQNFVSQWQADFNSLPDDLWEDEETKAELHQRVNDLRDRLWDICDARKEEAEQERLDIINESWLQDSTGIAMNHFFSLMQAELNRFQDTKRLLQDYYRGMECKIPTDDTKRFTRIPLVQL 1189          

HSP 3 Score: 104.76 bits (260), Expect = 6.796e-21
Identity = 97/366 (26.50%), Postives = 166/366 (45.36%), Query Frame = 2
Query: 4433 TEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNI--------------------SMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPT-FINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGD-DPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
             E +++N L L + K E++AALQ E    +   ++I  K    ++++      V++L   W+ ++ L+E  S++++ +V RYHIE    ++ ++ L    F++N NI                      + +E+ D+ + Q +++ P+   V+G+        KAF  +   + T +  +                      P+ +++L   T+  +  +A     + E V+WR FLL  + PWP P + EL+  L  FK +D++  G VT EQY    LWF        P +   P   NRQ  +   FF +F   D DP  L            +Y EML++FA  C  +   G+ RALSVA+G
Sbjct: 1328 AEMERKNELRL-RIKEEHLAALQFEERATQFRLELIKTKALAFLEDLVTKAVDVYKLMEKWLGERYLNEMASVEKLTEVARYHIETSTKIQNELYLDQEDFFINGNIKVFPDPPPPVRPPPVEKEENGTLTIEQLDNLRDQFLDIAPKG--VIGN--------KAFADILLDLVTLNLGT-------------------NNFPSSWMHL---TQPELQELASLLVINSELVDWRKFLLVAALPWPIPLEEELLETLQRFKAVDEEQLGTVTFEQYLQAGLWFTGDKDIKIPANPLEPLPFNRQEHLIEFFFRLFADHDKDPPRL------------DYTEMLLYFA--CHPDGMEGVYRALSVATG 1646          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9C093|SPEF2_HUMAN (Sperm flagellar protein 2 OS=Homo sapiens OX=9606 GN=SPEF2 PE=1 SV=2)

HSP 1 Score: 390.578 bits (1002), Expect = 5.774e-109
Identity = 300/917 (32.72%), Postives = 476/917 (51.91%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK-QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKID------EDKTENQ----------VTYINLNASMEEGAVSFNKDENNFTPIVNEIPT--IVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKV------STSKH-----SGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIA-------------NLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIIL 2620
            +S+ +   +FA  FS+GYL+GE+L K++L D+F +      + AKL+NF  LEP L LLG+ F+ +VA  ++  K  +   L+YQL+IAL+ KK+S  T + MQT+Q     ++Q ++S  +Q+RL+ + PRQTD  L  +  ++Q+  + ++           E  ++  E+ R   + +    R+ Q E M KI+AA+++IPKP  ++T++A++  K +K +KE ED   E+  FE   ++++  ++        +  ++ +   N  +DD                         EYI++I+ RLE D  AR  REKRRRK+L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+  +D    +    +Y KHY +  +++  IVDLS K++++++LT   IP K++ +WK  F N  PIY++ +    VK                LP       +  +E KR+LLD  D  EYK ++GEW + +E +  +   NN IL  I+ RL   S P    S  P LP F +K  ++GK  SGK+ ++R+L K+     +    ++ EA++AF  NE  +V  +L I +N + D      E+  E+Q          V+   L  +  E  +S N D+   TP   E+ +     K + RA LG K    L  G+SI D LLV+ IV  I  IP     I+D FP T  QA+L E+A TG     +   R+   K       +TSK         D +ILL+ SD   ++R   I   +L+ K  +  +S+ V A              +Q  +  F +NWP L +++      L+K+   N E+D   +  +V+ IL
Sbjct:   15 VSRTVSPKSFAKAFSSGYLLGEVLHKFELQDDFSEFLDSRVSSAKLNNFSRLEPTLNLLGVQFDQNVAHGIITEKPGVATKLLYQLYIALQKKKKSGLTGVEMQTMQRLTNLRLQNMKSDTFQERLRHMIPRQTDFNLMRITYRFQEKYKHVKEDLAHLHFEKLERFQKLKEEQRCFDIEKQYLNRRRQNEIMAKIQAAIIQIPKPASNRTLKALEAQKMMKKKKEAEDVADEIKKFEALIKKDLQAKESASKTSLDTAGQTTTDLLNTYSDD-------------------------EYIKKIQKRLEEDAFAREQREKRRRKLLMDQLIAHEAQEEAYREEQLINRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQHEERRLKDFQDALDREAALAKQAKIDFEEQFLKEKRFHDQIAVERAQARYEKHYSVCAEILDQIVDLSTKVADYRMLTNNLIPYKLMHDWKELFFNAKPIYEQAS----VK---------------TLPANPSREQLTELE-KRDLLDTNDYEEYKNMVGEWALPEEMVDNLPPSNNCILGHILHRLAEKSLPPRAESTTPELPSFAVKGCLLGKTLSGKTTILRSLQKDFPIQILSIDTLVQEAIQAFHDNE--KVSEVLPIQKNDEEDALPVLQEEIKESQDPQHVFSAGPVSDEVLPETEGETMLSANADK---TPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIPDVLLVDIIVNAINEIPVNQDCILDGFPMTLNQAQLLEEALTGCNRNLTEVERKKAQKSTLAIDPATSKEIPLPSPAFDFVILLDVSDTSSMSRMNDIIAEELSYKTAHEDISQRVAAENQDKDGDQNLRDQIQHRIIGFLDNWPLLEQWFSEPENILIKI---NAEIDKESLCEKVKEIL 878          

HSP 2 Score: 160.614 bits (405), Expect = 6.981e-38
Identity = 79/217 (36.41%), Postives = 134/217 (61.75%), Query Frame = 2
Query: 3098 VVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNI 3745
            V  VP+   P+PG  +WVY  +P+  E+      +WE + + Y N  K V R +R+D+  ++ Y++ I+ +F+ FL RPD KQ+++ Q+Q DFN + D+  +DEE + ELHQR+++L+D+L +I      +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY  M   + +ED +  F R+PL+++ S    +N + +L I
Sbjct:  998 VAIVPQ--PPKPGSEEWVYVNEPVPEEMPLFLVPYWELIENSYINTIKTVLRHLREDQHTVLAYLYEIRTSFQEFLKRPDHKQDFVAQWQADFNSLPDDLWDDEETKAELHQRVNDLRDRLWDICDARKEEAEQERLDIINESWLQDTLGMTMNHFFSLMQAELNRFQDTKRLLQDYYWGMESKIPVEDNK-RFTRIPLVQLDS---KDNSESQLRI 1208          

HSP 3 Score: 102.834 bits (255), Expect = 3.155e-20
Identity = 98/368 (26.63%), Postives = 162/368 (44.02%), Query Frame = 2
Query: 4424 AEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISM--------------------IPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGD-DPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
             EE  E K+      K K E++AALQ E    +   ++I  K    ++++      V++L   W+ ++ L+E  S +++  V RYHIE    ++ ++ L    F++N NI +                    + +E+ DS + Q +++ P+ I  +G++ FT                       +ID V L   +         P+  N    T+  +  +    + + E+V+WR FLL  S PWP P + EL+  L  FK +D++  G +T EQY    LWF        P +   P   NRQ  +   FF +F   + DP +L            +Y +ML++FA  C  +   G+ RALSVA G
Sbjct: 1332 TEEIAEIKRKNELRVKIKEEHLAALQFEEIATQFRLELIKTKALALLEDLVTKVVDVYKLMEKWLGERYLNEMASTEKLTDVARYHIETSTKIQNELYLSQEDFFINGNIKVFPDPPPSIRPPPVEKEEDGTLTIEQLDSLRDQFLDMAPKGI--IGNKAFTDI---------------------LIDLVTLNLGT------NNFPS--NWMHLTQPELQELTSLLTVNSEFVDWRKFLLVTSMPWPIPLEEELLETLQKFKAVDKEQLGTITFEQYMQAGLWFTGDEDIKIPENPLEPLPFNRQEHLIEFFFRLFADYEKDPPQL------------DYTQMLLYFA--CHPDTVEGVYRALSVAVG 1654          
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8C9J3|SPEF2_MOUSE (Sperm flagellar protein 2 OS=Mus musculus OX=10090 GN=Spef2 PE=1 SV=3)

HSP 1 Score: 361.688 bits (927), Expect = 6.664e-100
Identity = 276/910 (30.33%), Postives = 461/910 (50.66%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDT------QDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQD-VINEALEAFQ----------SNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFN-----KDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEE------------PNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKL--------------DNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMD 2584
            +S+ +   +FA  FSNGYLIGE+L K++L  +F + S+   + AKL+NF  L+P L LLG+ F+ +VA+ ++  K      L+YQL+IAL+ KK++  T L                        ++ + P QT++ L+ L                            ++E  R+ RLNR +     Q E M KI+AA+++IPKP  ++T++AI+  K +K +KE ED   E+  FE     ++ +D                            I++S+S T      Q   E +   S+ +YI++I+ RLE D  AR  REKRRR++L++ L +H  QEE  RE  +  RLMRQSQ ERRIAVQL+H+RHEK V+  NR+ RE Q++ERR K+F +AL++E  L +Q K+   +    E+++++    +    +Y+KHY +  +++  ++DL  K++++++LT   IP K++ +WK  F +G+PIY++T+ T    +                P E   + +    KKR LLD +D  +YK ++GEW + ++ +      NN IL  ++ RL   + P   N++   LP   +K  ++GK  SGK+ ++++L +N+  V ++  D ++ EA++AF           + E+ + + +++  + SK  +DK    V+ +  + + ++  V  N     +  ++F  +           S RA LG K    L  G+SI D LLV  +V  I+ IP    W++D FP T  QAKL E+A TGY+             P       T+++VS    S LD +ILL+ SD   LAR   I   +++ ++              DN    +++  ++Q  +  F +NWP L +++ +    L KV   N E+D
Sbjct:   15 VSRTVSPKSFAKAFSNGYLIGEVLFKFELQSDFAEFSESRGSTAKLNNFSRLQPTLHLLGLQFDQNVAQSIITEKPGAATKLLYQLYIALQKKKKTGLTGLE-----------------------IQTMQP-QTNLRLQTL----------------------------KSEAFREQRLNRRR-----QNEIMAKIQAAIIQIPKPESNRTLKAIEAQKLMKKKKEAEDVANEIKKFE----ALIKKDL--------------------------QIKESVSKTSLETTDQTTAELLNTYSDDDYIKKIQKRLEEDAFAREQREKRRRRLLMDQLMAHEAQEEAYREEQLIHRLMRQSQQERRIAVQLMHVRHEKEVLWQNRIFREKQFEERRLKDFQDALDREAALAKQAKIDFAEQTLREKEIHEKISVERAQQRYKKHYGICAEILDQMLDLCTKVADYRLLTNNLIPHKMMHDWKELFFSGIPIYEQTSLTHGQTE----------------PTEDHRAEV----KKRNLLDSKDYEDYKNMVGEWALPEDMVNSSPPSNNSILGHVLLRLIEKADPSASNAEATELPSLAVKGCILGKTLSGKTTVLKSL-QNDFPVHVLSIDTLVQEAIQAFHERQKSGKTPPTQEDDKRDPVVNQEKVSKT-QDKNVLAVSPVPGDRTSQKEGVKINEFEQFRSSDSFLSL-----------SMRAQLGAKSELMLRRGKSIPDILLVSILVNAIKEIPVDQSWVLDGFPITLNQAKLLEEALTGYKRKFLQLKKKKEQMPTLALDPSTSTEVSLLP-SALDFVILLDISDNSSLARTNDIIAKEISHEISHENVGRPGTGTSQDNKSEDRNLRDHIQHRIVGFLDNWPLLEEWFTQPKNILTKV---NAEID 800          

HSP 2 Score: 156.762 bits (395), Expect = 1.037e-36
Identity = 71/190 (37.37%), Postives = 123/190 (64.74%), Query Frame = 2
Query: 3134 GDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSM-VNLTLEDFRPEFLRLPLIEI 3700
            G  +WVY  +P+  EL S    +WE +   Y N+ K V R +R+ +  ++ Y++  + +F+ FL RPD KQ+++ Q+Q DFN + ++  EDEE + ELHQR+++L+D+L +I +    +A++E   + N  WL+D +G+  N + +LM +E +RFQD  R L+DYY++M   + LED + +F R+PL+++
Sbjct:  910 GTEEWVYVNEPIPEELPSFLVPYWELIEKSYINHIKTVLRHLRERQHNVLSYLYETRTSFQEFLRRPDHKQDFVSQWQADFNSVPEDLWEDEETKAELHQRVNDLRDRLWDICEARKEEAEQERLDIINESWLQDSIGITMNHFFSLMQAEVNRFQDTKRLLQDYYRAMESKIPLEDSK-KFTRVPLVQL 1098          

HSP 3 Score: 113.235 bits (282), Expect = 1.988e-23
Identity = 102/386 (26.42%), Postives = 172/386 (44.56%), Query Frame = 2
Query: 4385 TPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISM--------------------IPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFP------IPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASG 5464
            +P  EV+       E  E +K+N L L + K E++AALQ E    +   ++I LK    ++++      V++L   W+  + L+E  SI+++ ++ RYHIE    ++ +I L    FY+N +I +                    + +E+ D+ + Q +++ P+ I  +G+        KAF  +   + T +   +   +F            P +      L+      +  I    + + E+V+WR FL+  + PWP   + EL+  L  FK LD+  TG +T EQY    LWF       IP  P  P    +P   NRQ  +   FF +F            D +     ++Y +ML++FA  C  +   G+ RALSVA G
Sbjct: 1224 SPVAEVSPVTVTPEEMAEMEKRNELRL-RIKEEHLAALQTEEQAAQFRLELIKLKALSVLEDLVTKVIDVYRLMEKWLGKRYLNEMASIQKLTELARYHIETATKIQNEIYLSQEDFYINGDIKVFPDPSPPTRPPPVEREENGTLTIEQLDNLRDQFLDMAPKGI--IGN--------KAFSDILLDLITLN---LGTNNF------------PSSWMHLSQLD------LQEITSLLTVNTEFVDWRKFLMVTAMPWPMALEDELLDTLQRFKALDEAQTGTITYEQYKQAGLWFSGDEDIKIPENPLEP----LP--FNRQEHLIEFFFRLF-----------ADCEKEPPQLDYTQMLLYFA--CHPDTLEGVYRALSVAVG 1558          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A267ECL4 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034355g2 PE=4 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 1.805e-148
Identity = 351/958 (36.64%), Postives = 528/958 (55.11%), Query Frame = 2
Query:   14 ID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK---------QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDIL-PMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVL--TEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTING-----MEKKRELLDEEDILEYKQLIGEWE-IKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSN--------------------EEIEVETILSINENSKIDEDKTENQVTYI---------------NLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSK----------VSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDK-----------LDNTVVS--------KDVIANL---QTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLI 2632
            I+  NF   F+NGYLIGE+L KY+L D+FD+ SK   +E+K++NF  +EP+L LLG+ F+ S A+D+M  +      LMYQ+FIALENKK++N T ++M+T++  A  ++Q +ES++Y+QRLK++TPRQTD+ L+ELI ++  HQ  ++ +A K RI SAE HR + +  RQ +L+RSK ++  Q EQM KI+AA+V IPKPPP++T  A+   ++ + ++E   A++ LD FE +              G DR D   S + E+    +        L P+ + + SD  D   YIKP SN  YI +I+ RL  D +AR ARE+RRRKVLV+CL++H +QEE +RE  +A +LMRQSQ+ERRIAVQLL  R EK+V+K NR ERE QYQERRE EF  AL++E+ L E+ +    +  + E+ L +    Q +  ++ + Y      + D+VD++C+++E + L    G++P +  ++ K  F +G P+Y        V    +     + I D+  P   E    +      +E+K  + DE ++LEYK++ GEW+  +D  +      N ++ WIVDR+  +++P     + P  PPFP++AA+ GK FSGKS +IR L++NN+CVS     ++ EA++AF+ N                    +  E          S I    T                      +  A  E+GA +    +    P     P + +    RA +GEK+ A L  G+S+ D+LLVE ++E I R+P GTGWI+D FP  Y QAKLFEKA TG+EEP    SR+  +            +    SGLD +I  +  D  CL RA+   E     K              T V         KD   +L   Q  L+ +AE+WPKL KFY R   N+V+V   +  ++P  +YL+ E +LD+ +
Sbjct:   19 INPENFEKEFANGYLIGEVLHKYELQDDFDRFSKSKVSESKINNFTRIEPVLHLLGVPFDTSTARDIMTEEPGTATRLMYQIFIALENKKKANLTGVAMETMRPAAPAKLQSMESLIYRQRLKQVTPRQTDLNLQELIDRFHQHQVRLEERALKGRIESAEAHRRDNQDRRQKQLDRSKQVQLMQAEQMAKIQAAIVHIPKPPPNRTAAAMDHRRQQRRRQEAAAAMQALDGFEERLSRTLQPTGDSGAAGPDRPDSSASGTSEDFEQPTGQQRGAATLQPLQQAATSDPTD---YIKPASNDAYIAKIRRRLAEDAEARAARERRRRKVLVDCLRAHEQQEELQREASLAGKLMRQSQLERRIAVQLLQARREKDVLKRNRRERERQYQERREAEFQEALDREKALAERARAEYEEEFQQERLLREEAAKQRRQRQWERRYGHCWLAVSDLVDVACRVAELRELEGPGGRVPHRKYRDLKALFTSGQPVY-------PVAGGPAAPQAALAIDDLEAPDGAEPMETDADPNLVLEEKEAVQDEAELLEYKEMQGEWQPPEDCEMQSAPVSNPVVGWIVDRVHAIANPPTPPPEAPQFPPFPVRAAICGKLFSGKSSVIRRLIENNRCVSFDVNTLVEEAMDAFKLNELEPLPTPPPTPPPEPEPEEKPAEASATTVGESGSAIQLASTSGAAMATGAAAATSQTTLTAESSATAGAEDGATTPQSQQPPPPPPEPPKPQLTR----RAKIGEKLTALLRRGKSVTDELLVELLIEAIHRVPAGTGWILDGFPGNYAQAKLFEKALTGFEEPTKAGSRKKKAGSLATNPKPAPAAPEPASGLDLVIDFSVDDAWCLKRALGRVEQPGTGKEFHLETKQPPEGSATGVQGEEKVQPVKDPAYDLDQVQKRLSAYAESWPKLEKFYQRFG-NVVRV---DASLEPEALYLETERLLDEFV 958          

HSP 2 Score: 183.341 bits (464), Expect = 2.551e-42
Identity = 92/258 (35.66%), Postives = 151/258 (58.53%), Query Frame = 2
Query: 3143 DWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLI 3916
            +W + +  +  EL+      W+++ D Y +  K VFR +R  ++  + Y + +++ F  +L RPD  Q  L  FQKDFNEI  + R DEEV  +LHQR+ EL+++L++I+ +    A+ + + ++   W+EDR+GL++N Y+ L+  E DRFQD V+F+KDYYK M     E ++P+FLRLP++E+P  ++        +  S+++     A S                   +  +E +ELTDEEIEAMF+TKIP++
Sbjct: 1130 EWEFVDLAIPEELAKALSPLWDAIEDGYVSTAKSVFRRLRLVKDSAVVYFYQVRRDFLEYLQRPDNHQVLLTAFQKDFNEIPQDLRYDEEVVADLHQRLEELRERLVDITDKRKEQAEAKKEAIEQCGWVEDRLGLLTNLYIELLQGEMDRFQDTVKFMKDYYKGMDTPIPEPYKPDFLRLPIVELPYERDPARSGDGSSRGSSRHQSPAKAAS------PVAKKAGGGGKNKEPVDEARELTDEEIEAMFRTKIPVL 1381          

HSP 3 Score: 171.785 bits (434), Expect = 9.278e-39
Identity = 132/472 (27.97%), Postives = 235/472 (49.79%), Query Frame = 2
Query: 4430 ETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIA-SDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKS-LKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDS 5839
            ETEE++  RL  E+ + EY  +L+ E    R   ++ +      ++++K   +   +  + WI  +LL E   I +  ++ R+ IE + P+ E++EL  + F LN    ++P   +        ++ P+        +F+I  ++     F+ +       +++ +FV ++ + + +  DP  LP        T + +  +A++ S D+EYV+WR FLLA S+PWPWP+Q +L+  L  FK+LDQ + G+VTREQYDFI+LWF     P+TP + + PK I+R    K+L F+ F      NE      + R+ Y++   +L+H A   + + Y G +RALSVA+   +PH P+   +     +   D +  D  ++ ++I  +Y VL +GR    +  ++  D             L +  L +IY  L   D    P++ L+KH + +E  +  + +  V  + F   D 
Sbjct: 1539 ETEEEQARRLTKERMREEYFYSLEHEARAARARMELCVAVAARVLQDLKQKQELASKDLADWIGARLLRESELIDQACELIRHAIESRGPIVERLELSASDFLLNSEFKVVPDPPKPVRPPPVEQLEPD--------WFSIKAIRDLLGRFKGVAP--DGLLAINEFVSVLMEEVNSHQDPDLLPE--QWQHCTAAQLQELAQSMSSDQEYVSWRAFLLAISQPWPWPSQQDLLDTLLKFKDLDQTDCGYVTREQYDFIELWFSPGPPPSTPEEPTKPKQISRLEGFKHLLFEFFA-----NE------EGRMAYLD---LLLHCA--ASPSPYVGFLRALSVANDSHIPHCPIAGYEELTAVEPQADEVPADCEDSLVKIDAVYYVLGYGR----NITEDTTDFSDLVDTEVTQECLTRPMLGAIYQQLGSEDLDPLPYTKLIKHVSFVELLLQARQYKRVSVRDFLAADG 1978          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A267EP00 (Calponin-homology (CH) domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig034355g1 PE=4 SV=1)

HSP 1 Score: 519.235 bits (1336), Expect = 2.321e-148
Identity = 352/954 (36.90%), Postives = 533/954 (55.87%), Query Frame = 2
Query:   14 ID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK---------QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDIL-PMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVL--TEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTING-----MEKKRELLDEEDILEYKQLIGEWE-IKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDK-TENQVTYINLNASMEEGAVSFN----------------KDENNFTPIVNEIPTIVKKT--------------SQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSK----------VSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDK-----------LDNTVVS--------KDVIANL---QTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLI 2632
            I+  NF   F+NGYLIGE+L KY+L D+FD+ SK   +E+K++NF  +EP+L LLG+ F+ S A+D+M  +      LMYQ+FIALENKK++N T ++M+T++  A  ++Q +ES++Y+QRLK++TPRQTD+ L+ELI ++  HQ  ++ +A K RI SAE HR + +  RQ +L+RSK ++  Q EQM KI+AA+V IPKPPP+ T  A+   ++ + ++E   A++ LD FE +              G DR D   S + E+    +        L P+ + + SD  D   YIKP SN  YI +I+ RL  D +AR ARE+RRRKVLV+CL++H +QEE +RE  +A +LMRQSQ+ERRIAVQLL  R EK+V+K NR ERE QYQERRE EF  AL++E+ L E+ +    +  + E+ L +    Q +  ++ + Y      + D+VD++C+++E + L    G++P +  ++ K  F +G P+Y        V    +     + I D+  P   E    +      +E+K  + DE ++LEYK++ GEW+  +D  +      N ++ WIVDR+  +++P     + P  PPFP++AA+ GK FSGKS +IR L++NN+CVS     ++ EA++AF+ NE   + T           E+K  E   T +  + S  + A +                    E++ T    +  T  +                ++RA +GEK+ A L  G+S+ D+LLVE ++E I R+P GTGWI+D FP  Y QAKLFEKA TG+EEP    SR+  +            +    SGLD +I  +  D  CL RA+   E     K              T V         KD   +L   Q  L+ +AE+WPKL KFY R   N+V+V   +  ++P  +YL+ E +LD+ +
Sbjct:   54 INPENFEKEFANGYLIGEVLHKYELQDDFDRFSKSKVSESKINNFTRIEPVLHLLGVPFDTSTARDIMTEEPGTATRLMYQIFIALENKKKANLTGVAMETMRPAAPAKLQSMESLIYRQRLKQVTPRQTDLNLQELIDRFHQHQVRLEERALKGRIESAEAHRRDNQDRRQKQLDRSKQVQLMQAEQMAKIQAAIVHIPKPPPNHTAAAMDHRRQQRRRQEAAAAMQALDGFEERLSRTLQPTGDSGAAGPDRPDSSASGTSEDFEQPTGQQRGAATLQPLQQAATSDPTD---YIKPASNDAYIAKIRRRLAEDAEARAARERRRRKVLVDCLRAHEQQEELQREASLAGKLMRQSQLERRIAVQLLQARREKDVLKRNRRERERQYQERREAEFQEALDREKALAERARAEYEEEFQQERLLREEAAKQRRQRQWERRYGHCWLAVSDLVDVACRVAELRELEGPGGRVPHRKYRDLKALFTSGQPVY-------PVAGGPAAPQAALAIDDLEAPDGAEPMETDADPNLVLEEKEAVQDEAELLEYKEMQGEWQPPEDCEMQSAPVSNPVVGWIVDRVHAIANPPTPPPEAPQFPPFPVRAAICGKLFSGKSSVIRRLIENNRCVSFDVNTLVEEAMDAFKLNELEPLPTPPPTPPPEPEPEEKPAEASATTVGESGSAVQLASTSGAAMATGAAAATSQTTLTAESSATAGAEDGATTPQSQQPPPPPPEPPKPQLTRRAKIGEKLTALLRRGKSVTDELLVELLIEAIHRVPAGTGWILDGFPGNYAQAKLFEKALTGFEEPTKAGSRKKKAGSLATNPKPAPAAPEPASGLDLVIDFSVDDAWCLKRALGRVEQPGTGKEFHLETKQPPEGSATGVQGEEKVQPVKDPAYDLDQVQKRLSAYAESWPKLEKFYQRFG-NVVRV---DASLEPEALYLETERLLDEFV 993          

HSP 2 Score: 183.726 bits (465), Expect = 2.218e-42
Identity = 92/258 (35.66%), Postives = 151/258 (58.53%), Query Frame = 2
Query: 3143 DWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLI 3916
            +W + +  +  EL+      W+++ D Y +  K VFR +R  ++  + Y + +++ F  +L RPD  Q  L  FQKDFNEI  + R DEEV  +LHQR+ EL+++L++I+ +    A+ + + ++   W+EDR+GL++N Y+ L+  E DRFQD V+F+KDYYK M     E ++P+FLRLP++E+P  ++        +  S+++     A S                   +  +E +ELTDEEIEAMF+TKIP++
Sbjct: 1165 EWEFVDLAIPEELAKALSPLWDAIEDGYVSTAKSVFRRLRLVKDSAVVYFYQVRRDFLEYLQRPDNHQVLLTAFQKDFNEIPQDLRYDEEVVADLHQRLEELRERLVDITDKRKEQAEAKKEAIEQCGWVEDRLGLLTNLYIELLQGEMDRFQDTVKFMKDYYKGMDTPIPEPYKPDFLRLPIVELPYERDPARSGDGSSRGSSRHQSPAKAAS------PVAKKAGGGGKNKEPVDEARELTDEEIEAMFRTKIPVL 1416          

HSP 3 Score: 171.785 bits (434), Expect = 8.916e-39
Identity = 132/472 (27.97%), Postives = 235/472 (49.79%), Query Frame = 2
Query: 4430 ETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIA-SDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKS-LKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDS 5839
            ETEE++  RL  E+ + EY  +L+ E    R   ++ +      ++++K   +   +  + WI  +LL E   I +  ++ R+ IE + P+ E++EL  + F LN    ++P   +        ++ P+        +F+I  ++     F+ +       +++ +FV ++ + + +  DP  LP        T + +  +A++ S D+EYV+WR FLLA S+PWPWP+Q +L+  L  FK+LDQ + G+VTREQYDFI+LWF     P+TP + + PK I+R    K+L F+ F      NE      + R+ Y++   +L+H A   + + Y G +RALSVA+   +PH P+   +     +   D +  D  ++ ++I  +Y VL +GR    +  ++  D             L +  L +IY  L   D    P++ L+KH + +E  +  + +  V  + F   D 
Sbjct: 1573 ETEEERARRLTKERMREEYFYSLEHEARAARARMELCVAVAARVLQDLKQKQELASKDLADWIGARLLRESELIDQACELIRHAIESRGPIVERLELSASDFLLNSEFKVVPDPPKPVRPPPVEQLEPD--------WFSIKAIRDLLGRFKGVAP--DGLLAINEFVSVLMEEVNSHQDPDLLPE--QWQHCTAAQLQELAQSMSSDQEYVSWRAFLLAISQPWPWPSQQDLLDTLLKFKDLDQTDCGYVTREQYDFIELWFSPGPPPSTPEEPTKPKQISRLEGFKHLLFEFFA-----NE------EGRMAYLD---LLLHCA--ASPSPYVGFLRALSVANDSHIPHCPIAGYEELTAVEPLADEVPADCEDSLVKIDAVYYVLGYGR----NITEDTTDFSDLVDTEVTQECLTRPMLGAIYQQLGSEDLDPLPYTKLIKHVSFVELLLQARQYKRVSVRDFLAADG 2012          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A1I8H3U3 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 5.509e-148
Identity = 351/954 (36.79%), Postives = 534/954 (55.97%), Query Frame = 2
Query:   14 ID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK---------QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDIL-PMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVL--TEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTING-----MEKKRELLDEEDILEYKQLIGEWE-IKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDK-TENQVTYINLNASMEEGAVSFN----------------KDENNFTPIVNEIPTIVKKT--------------SQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSK----------VSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDK-----------LDNTVVS--------KDVIANL---QTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLI 2632
            I+  NF   F+NGYLIGE+L KY+L D+F++ SK   +E+K++NF  +EP+L LLG+ F+ S A+D+M  +      LMYQ+FIALENKK++N T ++M+T++  A  ++Q +ES++Y+QRLK++TPRQTD+ L+ELI ++  HQ  ++ +A K RI SAE HR + +  RQ +L+RSK ++  Q EQM KI+AA+V IPKPPP++T  A+   ++ + ++E   A++ LD FE +              G DR D   S + E+    +        L P+ + + SD  D   YIKP SN  YI +I+ RL  D +AR ARE+RRRKVLV+CL++H +QEE +RE  +A +LMRQSQ+ERRIAVQLL  R EK+V+K NR ERE QYQERRE EF  AL++E+ L E+ +    +  + E+ L +    Q +  ++ + Y      + D+VD++C+++E + L    G++P +  ++ K  F +G P+Y        V    +     + I D+  P   E    +      +E+K  + DE ++LEYK++ GEW+  +D  +      N ++ WIVDR+  +++P     + P  PPFP++AA+ GK FSGKS +IR L++NN+CVS     ++ EA++AF+ NE   + T           E+K  E   T +  + S  + A +                    E++ T    +  T  +                ++RA +GEK+ A L  G+S+ D+LLVE ++E I R+P GTGWI+D FP  Y QAKLFEKA TG+EEP    SR+  +            +    SGLD +I  +  D  CL RA+   E     K              T V         KD   +L   Q  L+ +AE+WPKL KFY R   N+V+V   +  ++P  +YL+ E +LD+ +
Sbjct:   39 INPENFEKEFANGYLIGEVLHKYELQDDFERFSKSKVSESKINNFTRIEPVLHLLGVPFDTSTARDIMTEEPGTATRLMYQIFIALENKKKANLTGVAMETMRPAAPAKLQSMESLIYRQRLKQVTPRQTDLNLQELIDRFHQHQVRLEERALKGRIESAEAHRRDNQDRRQKQLDRSKQVQLMQAEQMAKIQAAIVHIPKPPPNRTAAAMDHRRQQRRRQEAAAAMQALDGFEERLSRTLQPTGDSGAAGPDRPDSSASGTSEDFEQPTGQQRGAATLQPLQQAATSDPTD---YIKPASNDAYIAKIRRRLAEDAEARAARERRRRKVLVDCLRAHEQQEELQREASLAGKLMRQSQLERRIAVQLLQARREKDVLKRNRRERERQYQERREAEFQEALDREKALAERARAEYEEEFQQERLLREEAAKQRRQRQWERRYGHCWLAVSDLVDVACRVAELRELEGPGGRVPHRKYRDLKALFTSGQPVY-------PVAGGPAAPQAALAIDDLEAPDGAEPMETDADPNLVLEEKEAVQDEAELLEYKEMQGEWQPPEDCEMQSAPVSNPVVGWIVDRVHAIANPPTPPPEAPQFPPFPVRAAICGKLFSGKSSVIRRLIENNRCVSFDVNTLVEEAMDAFKLNELEPLPTPPPTPPPEPEPEEKPAEASATTVGESGSAVQLASTSGAAMATGAAAATSQTTLTAESSATAGAEDGATTPQSQQPPPPPPEPPKPQLTRRAKIGEKLTALLRRGKSVTDELLVELLIEAIHRVPAGTGWILDGFPGNYAQAKLFEKALTGFEEPTKAGSRKKKAGSLATNPKPAPAAPEPASGLDLVIDFSVDDAWCLKRALGRVEQPGTGKEFHLETKQPPEGSATGVQGEEKVQPVKDPAYDLDQVQKRLSAYAESWPKLEKFYQRFG-NVVRV---DASLEPEALYLETERLLDEFV 978          

HSP 2 Score: 185.652 bits (470), Expect = 5.036e-43
Identity = 93/258 (36.05%), Postives = 152/258 (58.91%), Query Frame = 2
Query: 3143 DWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLI 3916
            +W + +  +  EL+      W+++ D Y +  K VFR +R  ++  + Y + +++ F  +L RPD  Q  L  FQKDFNEI  + R DEEV  +LHQR+ EL+++L++I+ +    A+ + + ++   W+EDR+GL++N Y+ L+  E DRFQD V+F+KDYYK M     E ++P+FLRLP++E+P  ++A       +  S+++     A S                   +  +E +ELTDEEIEAMF+TKIP++
Sbjct: 1150 EWEFVDLAIPEELAKALSPLWDAIEDGYVSTAKSVFRRLRLVKDSAVVYFYQVRRDFLEYLQRPDNHQVLLTAFQKDFNEIPQDLRYDEEVVADLHQRLEELRERLVDITDKRKEQAEAKKEAIEQCGWVEDRLGLLTNLYIELLQGEMDRFQDTVKFMKDYYKGMDTPIPEPYKPDFLRLPIVELPYERDAARSGDGSSRGSSRHQSPAKAAS------PVAKKAGGGGKNKEPVDEARELTDEEIEAMFRTKIPVL 1401          

HSP 3 Score: 175.252 bits (443), Expect = 7.237e-40
Identity = 137/490 (27.96%), Postives = 241/490 (49.18%), Query Frame = 2
Query: 4385 TPSKEVNLNLPQEAEE---TEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIA-SDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKS-LKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDS 5839
             P+ EV    P  A E   TEE++  RL  E+ + EY  +L+ E    R   ++ +      ++++K   +   +  + WI  +LL E   I +  ++ R+ IE + P+ E++EL  + F LN    ++P   +        ++ P+        +F+I  ++     F+ +       +++ +FV ++ + + +  DP  LP        T + +  +A++ S D+EYV+WR FLLA S+PWPWP+Q +L+  L  FK+LDQ + G+VTREQYDFI+LWF     P+TP + + PK I+R    K+L F+ F      NE      + R+ Y++   +L+H A   + + Y G +RALSVA+   +PH P+   +     +   D +  D  ++ ++I  +Y VL +GR    +  ++  D             L +  L +IY  L   D    P++ L+KH + +E  +  + +  V  + F   D 
Sbjct: 1542 APAGEVEAATPDPAAEPLETEEERARRLTKERMREEYFYSLEHEARAARARMELCVAVAARVLQDLKQKQELASKDLADWIGARLLRESELIDQACELIRHAIESRGPIVERLELSASDFLLNSEFKVVPDPPKPVRPPPVEQLEPD--------WFSIKAIRDLLGRFKGVAP--DGLLAINEFVSVLMEEVNSHQDPDLLPE--QWQHCTAAQLQELAQSMSSDQEYVSWRAFLLAISQPWPWPSQQDLLDTLLKFKDLDQTDCGYVTREQYDFIELWFSPGPPPSTPEEPTKPKQISRLEGFKHLLFEFFA-----NE------EGRMAYLD---LLLHCA--ASPSPYVGFLRALSVANDSHIPHCPIAGYEELTAVEPLADEVPADCEDSLVKIDAVYYVLGYGR----NITEDTTDFSDLVDTEVTQECLTRPMLGAIYQQLGSEDLDPLPYTKLIKHVSFVELLLQARQYKRVSVRDFLAADG 1999          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A1I8I8A2 (Calponin-homology (CH) domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 514.998 bits (1325), Expect = 5.082e-147
Identity = 351/957 (36.68%), Postives = 526/957 (54.96%), Query Frame = 2
Query:   14 ID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERK---------QRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDIL-PMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVL--TEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTING-----MEKKRELLDEEDILEYKQLIGEWE-IKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSN--------------------EEIEVETILSINENSKIDEDKTENQVTYI---------------NLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSK----------VSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDK-----------LDNTVVS--------KDVIANL---QTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDL 2629
            I+  NF   F+NGYLIGE+L KY+L D+FD+ SK   +E+K++NF  +EP+L LLG+ F+ S A+D+M  +      LMYQ+FIALENKK++N T ++M+T++  A  ++Q +ES++Y+QRLK++TPRQTD+ L+ELI ++  HQ  ++ +A K RI SAE HR + +  RQ +L+RSK ++  Q EQM KI+AA+V IPKPPP++T  A+   ++ + ++E   A++ LD FE +              G DR D   S + E+    +        L P+ + + SD  D   YIKP SN  YI +I+ RL  D +AR ARE+RRRKVLV+CL++H +QEE +RE  +A +LMRQSQ+ERRIAVQLL  R EK+V+K NR ERE QYQERRE EF  AL++E+ L E+ +    +  + E+ L +    Q +  ++ + Y      + D+VD++C+++E + L    G++P +  ++ K  F +G P+Y        V    +     + I D+  P   E    +      +E+K  + DE ++LEYK++ GEW+  +D  +      N ++ WIVDR+  +++P     + P  PPFP++AA+ GK FSGKS +IR L++NN+CVS      + EA++AF+ N                    +  E          S I    T                      +  A  E+GA +    +    P     P + +    RA +GEK+ A L  G+S+ D+LLVE ++E I R+P GTGWI+D FP  Y QAKLFEKA TG+EEP    SR+  +            +    SGLD +I  +  D  CL RA+   E     K              T V         KD   +L   Q  L+ +AE+WPKL KFY R   N+V+V   +  ++P  +YL+ E +LD+ 
Sbjct:   19 INPENFEKEFANGYLIGEVLHKYELQDDFDRFSKSKVSESKINNFTRIEPVLHLLGVPFDTSTARDIMTEEPGTATRLMYQIFIALENKKKANLTGVAMETMRPAAPAKLQSMESLIYRQRLKQVTPRQTDLNLQELIDRFHQHQVRLEERALKGRIESAEAHRRDNQDRRQKQLDRSKQVQLMQAEQMAKIQAAIVHIPKPPPNRTAAAMDHRRQQRRRQEAAAAMQALDGFEERLSRTLQPTGDSGAAGPDRPDSSASGTSEDFEQPTGQQRGAATLQPLQQAATSDPTD---YIKPASNDAYIAKIRRRLAEDAEARAARERRRRKVLVDCLRAHEQQEELQREASLAGKLMRQSQLERRIAVQLLQARREKDVLKRNRRERERQYQERREAEFQEALDREKALAERARAEYEEEFQQERLLREEAAKQRRQRQWERRYGHCWLAVSDLVDVACRVAELRELEGPGGRVPHRKYRDLKALFTSGQPVY-------PVAGGPAAPQAALAIDDLEAPDGAEPMETDADPNLVLEEKEAVQDEAELLEYKEMQGEWQPPEDCEMQSAPVSNPVVGWIVDRVHAIANPPTPPPEAPQFPPFPVRAAICGKLFSGKSSVIRRLIENNRCVSF----DVEEAMDAFKLNELEPLPTPPPTPPPEPEPEEKPAEASATTVGESGSAIQLASTSGAAMATGAAAATSQTTLTAESSATAGAEDGATTPQSQQPPPPPPEPPKPQLTR----RAKIGEKLTALLRRGKSVTDELLVELLIEAIHRVPAGTGWILDGFPGNYAQAKLFEKALTGFEEPTKAGSRKKKAGSLATNPKPAPAAPEPASGLDLVIDFSVDDAWCLKRALGRVEQPGTGKEFHLETKQPPEGSATGVQGEEKVQPVKDPAYDLDQVQKRLSAYAESWPKLEKFYQRFG-NVVRV---DASLEPEALYLETERLLDEF 953          

HSP 2 Score: 183.726 bits (465), Expect = 2.396e-42
Identity = 92/258 (35.66%), Postives = 151/258 (58.53%), Query Frame = 2
Query: 3143 DWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLI 3916
            +W + +  +  EL+      W+++ D Y +  K VFR +R  ++  + Y + +++ F  +L RPD  Q  L  FQKDFNEI  + R DEEV  +LHQR+ EL+++L++I+ +    A+ + + ++   W+EDR+GL++N Y+ L+  E DRFQD V+F+KDYYK M     E ++P+FLRLP++E+P  ++        +  S+++     A S                   +  +E +ELTDEEIEAMF+TKIP++
Sbjct: 1120 EWEFVDLAIPEELAKALSPLWDAIEDGYVSTAKSVFRRLRLVKDSAVVYFYQVRRDFLEYLQRPDNHQVLLTAFQKDFNEIPQDLRYDEEVVADLHQRLEELRERLVDITDKRKEQAEAKKEAIEQCGWVEDRLGLLTNLYIELLQGEMDRFQDTVKFMKDYYKGMDTPIPEPYKPDFLRLPIVELPYERDPARSGDGSSRGSSRHQSPAKAAS------PVAKKAGGGGKNKEPVDEARELTDEEIEAMFRTKIPVL 1371          

HSP 3 Score: 172.17 bits (435), Expect = 7.746e-39
Identity = 132/472 (27.97%), Postives = 235/472 (49.79%), Query Frame = 2
Query: 4430 ETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIA-SDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKS-LKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDS 5839
            ETEE++  RL  E+ + EY  +L+ E    R   ++ +      ++++K   +   +  + WI  +LL E   I +  ++ R+ IE + P+ E++EL  + F LN    ++P   +        ++ P+        +F+I  ++     F+ +       +++ +FV ++ + + +  DP  LP        T + +  +A++ S D+EYV+WR FLLA S+PWPWP+Q +L+  L  FK+LDQ + G+VTREQYDFI+LWF     P+TP + + PK I+R    K+L F+ F      NE      + R+ Y++   +L+H A   + + Y G +RALSVA+   +PH P+   +     +   D +  D  ++ ++I  +Y VL +GR    +  ++  D             L +  L +IY  L   D    P++ L+KH + +E  +  + +  V  + F   D 
Sbjct: 1529 ETEEERARRLTKERMREEYFYSLEHEARAARARMELCVAVAARVLQDLKQKQELASKDLADWIGARLLRESELIDQACELIRHAIESRGPIVERLELSASDFLLNSEFKVVPDPPKPVRPPPVEQLEPD--------WFSIKAIRDLLGRFKGVAP--DGLLAINEFVSVLMEEVNSHQDPDLLPE--QWQHCTAAQLQELAQSMSSDQEYVSWRAFLLAISQPWPWPSQQDLLDTLLKFKDLDQTDCGYVTREQYDFIELWFSPGPPPSTPEEPTKPKQISRLEGFKHLLFEFFA-----NE------EGRMAYLD---LLLHCA--ASPSPYVGFLRALSVANDSHIPHCPIAGYEELTAVEPLADEVPADCEDSLVKIDAVYYVLGYGR----NITEDTTDFSDLVDTEVTQECLTRPMLGAIYQQLGSEDLDPLPYTKLIKHVSFVELLLQARQYKRVSVRDFLAADG 1968          
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Match: A0A0B7AEF7 (CH_2 domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF110112 PE=4 SV=1)

HSP 1 Score: 477.633 bits (1228), Expect = 3.083e-140
Identity = 324/919 (35.26%), Postives = 504/919 (54.84%), Query Frame = 2
Query:   80 YDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVG-RDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKR-ELLDEEDILEYKQLIGEWEIKDES--LAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQ------SNEEIEVETILSINENSKIDEDKTENQV--------TYINLNASMEEG----AVSFNKDENNFTPIVNEIPTIVK-----------KTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTS-------------KHSGLDTLILLNTSDRDCLARAM---------KISENQLNDKLDNTVVSKDVI-------------ANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLI 2632
            Y L D+FD+ S    A++KL+NF  LEP+L LLGI F+ + A+D+M  K      L+YQ++IAL NKK++N T ++M+T+QA A  ++  IESVL+++RLK  TPRQTD++L+ L+ ++ +HQ  M+  A K+R   +E    + ++ RQN ++RS+ LR++Q E + KI AA +++PKPPPS+T  AIQ  K ++ +KE ++ +  + NFE K + ++   D   D                   D+  + RKS +D +++I  +   SN EYI +I+ RL+ D  AR  REKRRRKVL + +K+H  QEE  RE M+  RL+RQSQ ERRI VQLL  RHEK VI+ NR  RE QYQERREK+F  AL++E E   Q +    + ++A+QDL+D    Q   ++YR+HY M  +++ DIVD + ++  ++ LT   +P K+++EWKL F +G P++++ T                       P  RE +    +E++R +LLDE D LEY  + G+W +  ES  +    R N ++  I+ RL  ++HP       P  P FPI+A +VGK FSGK+  I  L   N    +VP+ ++ EA++AF+      ++EEI+ +    I + S ++  ++E+++        T    N+S+       A S   D   ++ + + + + V            + + RA LG K    L  G  ++DQ++V+ +VE IR+IPDG GWIID FP+TY QAK  EKA  G +   +   + +     +S               SG+DT+IL +  D  CL RA          K    + N   + +                      +QT +T F +NWPKL KFY ++    +K VD++ EM+   V+L+ E IL++ I
Sbjct:    1 YQLQDDFDQFSHSRAADSKLNNFSRLEPMLNLLGIPFDTNYARDIMTEKHGTATRLLYQMYIALNNKKKANLTQVAMKTLQASAPAKLGSIESVLFKERLKHATPRQTDIDLQALVSRFHEHQIRMEKMAFKDRFEESERLNLQKQRERQNLIDRSRMLREKQTELVAKINAATIQMPKPPPSQTYGAIQVQKDIRRKKEAQETISAIQNFEEKLKAILPPSDECSDF------------------DVQYIARKS-ADQEELIHTMNIGSNNEYIGKIRKRLQEDAMAREEREKRRRKVLSDQMKAHLTQEEARREEMMVNRLLRQSQQERRIVVQLLLSRHEKEVIRQNRTLREKQYQERREKDFQEALDREAEAAAQYRQDYAEQIKADQDLHDYIAVQRAEIRYRRHYNMCAEVVSDIVDFASRVVMYRELTNNLLPAKLMREWKLLFKHGQPLFEQVT-----------------------PESREYTAKQILEEERQQLLDEGDFLEYMSMSGDW-LPPESCDVKEAPRDNPVISHIIQRLFNIAHPPSPPPPAPEFPSFPIRACIVGKAFSGKTTCIERLAMENNFTILVPEALVQEAVQAFKDGEVETADEEIQADLSDDIADTSFVEMIQSEHEIENEEVKKDTQSAPNSSVVNSQQIRANSNLPDSEEYSNVESSVQSKVTLEEIKPKHFGPELTLRAKLGAKAMKCLKKGLPVDDQVVVDILVEAIRKIPDGIGWIIDGFPNTYNQAKCLEKALNGCDASTTGKKKESKDAHKSSLLPQVHQKQKLPIPPSGIDTVILFDVRDELCLKRAAGRYKQLQAEKTFHQEFNPPPEGSATGVGTTEKVQPVSDPSYDQEQIQTRITGFLDNWPKLHKFYTKLGN--LKTVDASLEME--SVFLETEKILEETI 872          

HSP 2 Score: 103.219 bits (256), Expect = 5.141e-18
Identity = 46/117 (39.32%), Postives = 74/117 (63.25%), Query Frame = 2
Query: 3074 PSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQE 3424
            P  + ++E + +     P+PGD DW+Y +  ++ EL+ V    WE + + Y NN K VFR +R +RE I +Y   I+K +  +L +PD KQEY+ Q+QK +NE+ D+ R+D+EV+ E
Sbjct:  998 PDILPESETIILVAPIPPKPGDDDWIYVDFNIDLELAKVLSLHWEEMENAYVNNLKTVFRNIRSERENIFKYFFQIRKDYVTYLQKPDCKQEYITQWQKIYNEVADDMRDDDEVKAE 1114          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000045470.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:7147195:7159672:1 gene:ENSAMXG00000035687.1 transcript:ENSAMXT00000045470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.821 bits (364), Expect = 9.740e-35
Identity = 99/312 (31.73%), Postives = 170/312 (54.49%), Query Frame = 2
Query:  887 NKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDES--LAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLI 1816
            N +Y+++I+ RLE D +AR  REKRRR+ L+  L +H+  EE  RE  +  RLMRQSQ E+R+AVQL+ +R +K V++ NR+ ++ Q++E+R  +    L++E  ++EQ +L   + L  E++L+    A+    K++KH  +   ++  IVDL+ K +E+++LT   IP K+++EWK  + +G P+YD     + V+  +                               +L+++D  EY  + GEW   +E   +      N+IL  +V RL+ + +P       P  P F ++A V+GK  SGK+  +
Sbjct:  189 NSDYVQKIRQRLEEDANAREQREKRRRRALIQQLHTHHTHEEMIREEQLIGRLMRQSQQEKRMAVQLMQIRQQKEVLRQNRILQQRQFEEQRLADLQQILDQEM-VLEQTRLERQEELCKERELHACLAAERAQSKHQKHLNICRGILDQIVDLATKSAEYRLLTANVIPGKMLREWKELYFSGEPLYDGVKVEQEVEVEKQ-----------------------------NILNQQDYSEYTNMTGEWAWPEEEGEIKAPPPNNDILGHVVARLRDIVNPPGPGDPPPLFPSFTLRACVLGKLCSGKTSCL 470          

HSP 2 Score: 87.8113 bits (216), Expect = 7.434e-17
Identity = 56/124 (45.16%), Postives = 82/124 (66.13%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQ 373
            LS+ ++ ++F+  FS+GYL+GEIL +Y L D+F   +K  T  AKL+NF  LEP L LLG+ F+  VAK VM  +      L+YQL++ L+ KKRS  T  +M+T+Q  ATT++  IE+ +Y Q
Sbjct:   15 LSKVVEPHSFSKDFSSGYLLGEILSRYQLQDDFQHFTKNGTGNAKLNNFTRLEPSLLLLGVAFDLGVAKSVMRGQPGAATRLLYQLYVLLQKKKRSGLTGTAMETMQPTATTRLHRIENHIYNQ 138          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Match: spef2 (sperm flagellar 2 [Source:NCBI gene;Acc:553375])

HSP 1 Score: 230.335 bits (586), Expect = 7.178e-61
Identity = 179/640 (27.97%), Postives = 294/640 (45.94%), Query Frame = 2
Query:  893 EYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRE-LLDEEDILEYKQLIGEWEIKDESLAGIDRKNN-ILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQS------------------NEEIEVETILSINENSKIDEDKTENQV---TYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGY----EEPNSRSSRRTNSKVSTSKHS-----------------GLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIAN-------------LQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQK 2641
            EY+  I+ RL+ D  AR  REKRRR VLV  L++  + EE +R   +  RLMRQSQ E+R+AVQLL  R  K  ++ NRLER  Q  ERR +EF+ AL+ +            +    E++L+    A+    ++  H +M   ++  +VDL+ + +E++ LT   I K++++EW+  F+  +P+YD                          P +   ST++   K+ +  LDE+D L+Y  + GEW+  D S A     NN +L  +V  +  L  P    +    LPP  I+A V+GK FSGK+  ++ L +    V++    ++ E++E +                    +EE +   +   ++N +  +  T  +V   TY+   AS     +         TP+ N    +V+       LG + +  L  G  + DQLLV  +++ +R +P+ TGWI+D FP+T QQAKL EKA TG+    EE NS+   +  S  ++ K S                  LD  ++L  SD     RA   S   L     + + ++ V +              L+  L  F ++WP L +++   +  L  V     + DP  +Y  ++ I +  +  K
Sbjct:  192 EYVGEIRRRLQEDGQARNQREKRRRAVLVQQLQAQRDMEELDRVEELVGRLMRQSQQEQRVAVQLLLTRQHKETVRQNRLERHYQLAERRHREFLEALDADAARSRWESEEKREQAERERELHAHLLAERMAARHAWHKQMCMGIVLHVVDLATRQAEYRELTGRDIQKQLLREWRELFVLELPVYDPPD-----------------------PKDTSESTVSMAHKEAQAALDEQDFLDYLGMKGEWQAVDGSSAMEPPPNNAVLGHVVRHICTLVRPPRSLAPPVALPPSSIRACVLGKPFSGKTSCLQRLSQECGLVTLNVSALLLESMETYNHWFNNNNKNQIGSFLRERLSEEDDERIVAEGDDNHEEADPVTHAEVWHRTYVAAGAS----TLQLPALTKCVTPLSNITSNVVE-------LGRQASEVLAQGGVVPDQLLVFLVLQALRELPEQTGWILDGFPATVQQAKLLEKALTGWDEDLEEGNSKEMGQQGSGTASGKVSLLVQDPFAPPKAPPPPPALDLALVLTLSDSAAFERAESTSCEDLRAHTQHLLANEKVYSRNHDTDNTERKRKLLKCRLVGFEKHWPDLEQWFGPRHGVLQSVC---AQTDPDLLYQGMKRIFEQTLLHK 794          

HSP 2 Score: 127.102 bits (318), Expect = 2.392e-29
Identity = 64/199 (32.16%), Postives = 113/199 (56.78%), Query Frame = 2
Query: 3086 EKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVV---RFLKDYYKSMVNLTLEDFRPE 3673
            E   V +VP    P PG  +W Y ++PL  E+++    FW+++   Y +NCK VF  +R++RE I+ +++ I++ F  FL RPD KQE++ ++Q + NE+    R D++ + E+HQR  +LK++L +I+     +A+KEL ++ ++ WL  R+   +N Y+ LM       +  V   R L+  +    +L L    P+
Sbjct:  913 EPIAVETVP--PGPTPGSSEWEYVDQPLTLEMATYLGGFWDNMERTYISNCKTVFHNLRREREAIVHHLYDIRQEFVEFLRRPDHKQEFVQRWQIELNELPGYLRGDDDTRAEMHQRAQDLKEKLWDITDGRKEEAEKELLSVMHDGWLNARLAAFANHYITLMQVRHHSHRGAVIPSRPLRAPHLDCPSLCLPRHAPK 1109          

HSP 3 Score: 98.9821 bits (245), Expect = 8.321e-21
Identity = 82/355 (23.10%), Postives = 154/355 (43.38%), Query Frame = 2
Query: 4385 TPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLIND-SLIASDPKTLPT-FINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIR 5443
            TPS  V + + +E  E   +KQ +  + +   E+  AL+ E + LR     +  +    I  ++      +Q     +  +  +E  SI+++  V +         + ++ L  + FYL+    M       +  +    + P         YFT+ QL +F++    +    +  IS  DF+  ++D     +  + LP  ++N+   + + I  IA       E ++WR  L+  + PWP P+ + L+A+LAA +  D +++GF+++EQYD I+LWF        PT+       +R   +K   F +  QG               E ++Y+ ML++ A  C  +   G  R
Sbjct: 1228 TPSPSVPMQVEEENPEVVAEKQRKAKMHQ---EHACALKHEETCLRQRLDTVKEQALSAIGALRAASAEAYQAMQDSLGQRYRAEMHSIEQLLDVIQ-GAVESGTYQPELVLQQDSFYLSTEARMYEEPPPPAPPQPSEPLHPH--------YFTVEQLMSFHRHL--LEAAPAGYISTFDFIDFLHDLGSGGTGSECLPAAWLNM---SRTQIAAIAHEVQGGVELLDWRRLLVLAAWPWPLPSVTRLLAVLAACRKADPESSGFLSQEQYDQIELWF----KDAVPTEDKC-DLYDRLGNLKQALFTLLGQG---------------EKIDYKSMLLYLA--CGEDGQDGFYR 1543          

HSP 4 Score: 59.3066 bits (142), Expect = 9.752e-9
Identity = 39/143 (27.27%), Postives = 79/143 (55.24%), Query Frame = 2
Query:  245 LMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQ---------QTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAI 646
            L+YQL ++L+  +R+  TA ++  +Q PA  ++  + + +YQ +LK    RQ ++ L++L   ++            Q ++ +  +E+ L  +  RE+ + H++         R+ Q E M +++AA V++P PP ++T+QAI
Sbjct:    2 LLYQLHVSLQRMRRAGLTAAALLGMQQPAPARLHALGTEMYQHQLKGKVARQVEVNLQQLTSTFEQRAREREAGRVMQELKQREAREQTLMEQRKREQAKLHQK---------RRRQDELMAQLQAATVRLPAPPLNRTLQAI 135          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Nematostella
Match: EDO31300 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYA2])

HSP 1 Score: 362.073 bits (928), Expect = 4.487e-106
Identity = 246/670 (36.72%), Postives = 383/670 (57.16%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNK---KLKIQKEGEDALKELDN-FERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDI--IEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDE-SLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYIN 1990
            LS+++D +NFA  F+ G+L+GE+L+K+ L ++F   S+ +T+++KL+NF  LEP LKLL + ++ +VA+ +M    S +  LMYQLFIAL  K +   T ++M+T++     +++ IES +Y++RLK++T RQ D+  + L+++YQ  Q+  +  A + R    E  R+  +  RQ  L +S+  + +Q+E M KI  A VKIPKPP S+ I      K   ++K+      +L  + + + R +  +   +R                   +  D+  +I       +    +  IKP +N+EYI +I+ RL+ D  AR  REKRRR+VL+  +K+H  QEE  RE M+  RLMRQSQ ERRIAVQL+  RHEK VI+ NR+ RE QY ERR K+F +ALE+E EL  Q K+  L+  R  ++L D    +    KY KHY+   +++ +IVD SCK+ E++ LTE  IP K+ +EWK  F+ G+P+Y+E              LT   IQ      ERE+       +K  LLDE D +EYK L+GEW   +E  + G  + N +L  I+ RL  +  P ++    P  PPFPIKA  +GK FSGKS +++ LV+ ++ V +   D+++EA+EA ++ E +  E       +S  D+ K E    +++
Sbjct:   15 LSRYVDQSNFAKEFATGFLLGELLEKHGLQNDFAAFSQSTTSDSKLNNFTRLEPTLKLLEVPYDTNVARAIMNESQSAITRLMYQLFIALGKKSKMGLTGVAMETMRPSGPVKLENIESGMYKERLKQLTKRQVDLNFENLVQRYQAKQKQQEDLAFRARFEEEEKMRKYQQAQRQRGLEKSRQAKNKQQEMMDKIRDATVKIPKPPGSRAISLWPSKKNDAQIKVIVNTAKSLWPMQSQYHRGKVTMTEANR------------------DVPIDVEGLISSPPPPKRFPDPLGVIKPSANEEYINKIRTRLDEDAVARKEREKRRRRVLIEQMKAHEAQEEAHREEMLVNRLMRQSQQERRIAVQLMQTRHEKEVIRQNRIFREQQYAERRLKDFDDALEREAELCRQAKVEYLEETRKAKELRDKLAEERAQAKYNKHYKTCMEVLSEIVDFSCKVGEYRELTEKLIPPKLFREWKDLFLQGIPLYEE-----------KACLTAAEIQK-----EREIEV-----EKENLLDEGDFMEYKNLMGEWVPPEELQIPGPPKDNAVLGHIIQRLFNIVSPPEKPPPPPEFPPFPIKACFLGKFFSGKSSVVKKLVEYHRLVRLSMDDLVSEAIEANKNGETV-TEPDPDPTPHSSGDQPKGERPGNWLS 644          

HSP 2 Score: 85.5001 bits (210), Expect = 1.450e-16
Identity = 48/136 (35.29%), Postives = 73/136 (53.68%), Query Frame = 2
Query: 2084 KTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYE-----------EPNSRSSRRTNSKVSTSKH---------SGLDTLILLNTSDRDCLARAMKISENQLND 2431
            K + R+ LG K    L  G++  DQLLV+ +VE +R +P+GTGWI+D FPST  QAKL EKA +GY+           +  ++ ++   S+++   H         SG+D +IL +  D   L RA   + N + D
Sbjct:  726 KPTLRSKLGGKAYTFLKKGKATPDQLLVDIMVEAVRNVPEGTGWIMDGFPSTVSQAKLLEKALSGYDAQKEVKDAKAAKEATKVNKSRKSRLAPDPHPAPEQPPLKSGVDLVILFDLPDEVALMRAEGRTYNPVTD 861          
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Match: spef2 (sperm flagellar 2 [Source:NCBI gene;Acc:101158702])

HSP 1 Score: 229.95 bits (585), Expect = 3.345e-60
Identity = 171/601 (28.45%), Postives = 300/601 (49.92%), Query Frame = 2
Query:  899 IERIKARLESDKDARIAREKRR---RKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEI-KDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSR-SSRRTNSKVSTSKHSG-------LDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLI--KQKFIPEPL 2659
            ++ I+ RL   K+  +A E+RR    + LV   K+   Q+E +R+  +  RL RQ++ E+R+  QLL +R +K VI+ NRL  E QYQERREK+F  AL +E  L +Q K    + +R + +      A+ +  K +KH+   + ++  IVDL+ K+ +++ LTE  IP++ +++WK     G+P+Y+ +           G   ++     IL +++           +E L+  D  EY ++IG+W   +D     +   NNIL+ +V +L+ ++             PF IKA V+G   SGK+  +  + +           +I EAL+A+   EE+              ++ K +N+             ++  +K + N    V E  + + K S RALLG  ++ EL  G +I ++LL+E +   IR++P  +GWI+D FPS    A L EKA  G EE     +S +TN     +  +        LD +++LN  D   + RA + ++ + +   +  V     +A +   +T F + WP L K+YC   +N++  VD++  +D  ++Y +V++IL  ++  KQ+  P P+
Sbjct:    1 MQEIRQRL---KETALASERRRIRQDRFLVEQFKAQAAQQELQRDEQLVKRLTRQTKQEQRLVTQLLQIRMQKEVIRENRLFVEQQYQERREKDFREALNREAVLAQQEKAAREEEIRKDVEWCARVSAERRQSKRKKHFNYCKALLNQIVDLATKVGDYRQLTENTIPEQTMRDWKELLFKGLPLYEPS----------HGLSLELSASKYILDLKK---------LPQEALNNLDYDEYARMIGDWAWPEDAGEIKVPSANNILENVVRKLKNIASSSTVEPPSSECSPFIIKACVLGNICSGKTSCLARIAEALSIFVFSSSTLIEEALKAYHDGEEV-------------TEQRKDKNK---------KRRASIRLSKHDIN----VLESRSCITKPSPRALLGAAVDKELKRGNAIPNELLMEIMTHAIRQVPAHSGWILDGFPSDINLAHLLEKALGGSEEEGKEVASDQTNVIADCNPPTPPPPPAPVLDVVLMLNIPDECAVRRAYRQADTEASQPAEKAV----YLAEITHRITAFRDAWPALEKWYCG-KQNILVNVDAD--VDEDELYNKVKLILQQVMEKKQRGGPSPM 546          

HSP 2 Score: 119.013 bits (297), Expect = 3.425e-26
Identity = 60/191 (31.41%), Postives = 111/191 (58.12%), Query Frame = 2
Query: 3176 ELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRP--EFLRLPLIEIPSIQEANNDQQELN 3742
            E++ + +  W+S+ + Y NN K V +++R  R  I+  + +I++ ++  L R + KQE++  +QKDFN I D+ RED+E+Q ELH+R+ EL ++L +I+ +     D+    L ++ WLE+   ++ N +  LM  E +RF   +  L+ Y+ S+    +  F P  E   +PL+EIP ++  N  +  ++
Sbjct:  633 EIAPLLWPLWDSVCNSYVNNIKKVMQQLRSQRTVILHELSSIREGYKHCLGRSNLKQEFVCHWQKDFNSIPDDLREDDEIQPELHRRLDELCERLWDITDKCREQDDQRKAALLSDEWLEEHAAVLINSHSMLMQVELNRFHQTLYILRIYFLSLAQKQV-TFEPLSENTYIPLLEIPEVKAENESENPMD 822          

HSP 3 Score: 77.7962 bits (190), Expect = 1.356e-13
Identity = 83/333 (24.92%), Postives = 145/333 (43.54%), Query Frame = 2
Query: 4481 EYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPT-FINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGD-DPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSL 5473
            EYVAAL  E +  ++  +++   G   +  ++           T +  + L+E  SI++++++  +HI  K  L+ ++ L  + FYL  N  M        D        P+ +D       ++  L++ +    SI+     S S +D +     S I +   +LP  +++  +    I++ + EA     + ++WR FLL  S PWP P+ ++L+  L +FK  D + TGF+  EQY   +LW           D+S      R   +   FF +F  G   P +L            +Y  ML +F+     +   G +R LSV  GQ L
Sbjct:  959 EYVAALDHEGNRAKMRLELVKHHGLVMLHLLQRRAHRTLTQMETLLQARYLAEMKSIEQLKEMAHHHIAAKAKLQYEVVLDGSDFYLKENSQMAASLAPPPD--------PDLLDKPSGFMLSMGALESIHHQLSSISPSGFISSSSLDSLLKDLLS-IDTGRHSLPKLWVDNQTWLREIVSLLTEA----NDLIDWRQFLLYASLPWPVPSLAQLLFTLQSFKVADAKETGFINEEQYLQTELWLTYEGVQILSEDLSELPPHGRVANLTKFFFQLFADGSISPPQL------------DYVSMLQYFS--ADPDPRQGFVRGLSVVLGQPL 1264          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000078209.1 (SMESG000078209.1)

HSP 1 Score: 1742.24 bits (4511), Expect = 0.000e+0
Identity = 914/915 (99.89%), Postives = 914/915 (99.89%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLAXXXXXXXXXXXXXXXDDQKSEIDL 2746
            LSQFID NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDL
Sbjct:   15 LSQFIDENNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDL 929          

HSP 2 Score: 1613.59 bits (4177), Expect = 0.000e+0
Identity = 930/930 (100.00%), Postives = 930/930 (100.00%), Query Frame = 2
Query: 3071 QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGAXXXXXXXXXXXXXXVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTXXXXXXXXXXXXXXXXXXXXXXXXXXXDKTATNTXXXXXXXXXXXXXXXXXXXXXTPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS 5860
            QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPKKGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLEDIDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS
Sbjct: 1038 QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPKKGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLEDIDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS 1967          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000078209.1 (SMESG000078209.1)

HSP 1 Score: 1742.24 bits (4511), Expect = 0.000e+0
Identity = 914/915 (99.89%), Postives = 914/915 (99.89%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLAXXXXXXXXXXXXXXXDDQKSEIDL 2746
            LSQFID NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDL
Sbjct:   15 LSQFIDENNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDL 929          

HSP 2 Score: 1591.25 bits (4119), Expect = 0.000e+0
Identity = 922/930 (99.14%), Postives = 922/930 (99.14%), Query Frame = 2
Query: 3071 QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGAXXXXXXXXXXXXXXVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTXXXXXXXXXXXXXXXXXXXXXXXXXXXDKTATNTXXXXXXXXXXXXXXXXXXXXXTPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS 5860
            QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPKKGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFYLNP        EEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLEDIDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS
Sbjct: 1038 QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPKKGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFYLNP--------EEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLEDIDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS 1959          
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Match: SMESG000078209.1 (SMESG000078209.1)

HSP 1 Score: 1741.09 bits (4508), Expect = 0.000e+0
Identity = 914/915 (99.89%), Postives = 914/915 (99.89%), Query Frame = 2
Query:    2 LSQFID*NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMXXXXXXXXXXXXEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDXXXXXXXXXXXXXXNGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLAXXXXXXXXXXXXXXXDDQKSEIDL 2746
            LSQFID NNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDL
Sbjct:  123 LSQFIDENNFASTFSNGYLIGEILKKYDLMDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSILINLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKITPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRLNRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGEDALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRKSISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCLKSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLERETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKMMKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFINGVPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELLDEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENSKIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEAFQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDENNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKIRRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSKHSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSLTNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQKFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDL 1037          

HSP 2 Score: 1592.02 bits (4121), Expect = 0.000e+0
Identity = 922/930 (99.14%), Postives = 922/930 (99.14%), Query Frame = 2
Query: 3071 QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSXXXXXXXXXXXXXXXXXENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGAXXXXXXXXXXXXXXVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTXXXXXXXXXXXXXXXXXXXXXXXXXXXDKTATNTXXXXXXXXXXXXXXXXXXXXXTPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHXXXXXXXXXXXXXXNNKFYLNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKXXXXXXXXXXXTIQEDSSETNIRIQDLYKVLSFGRRKFSSFXXXXXXXXXXXXXXXXXAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS 5860
            QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPKKGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFYLNP        EEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLEDIDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS
Sbjct: 1146 QPSEIEKAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNCKHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEIDDEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLEDRVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLPLIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGENQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPIKGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCFTLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPKKGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETEEDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYDSVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFYLNP--------EEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQSITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEAFSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTREQYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNELSEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPVMFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLEDIDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMSCQWFGHVEFQSFFPDDSFRLSADS 2067          
The following BLAST results are available for this feature:
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPEF22.894e-11432.79sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:262... [more]
SPEF21.202e-10932.72sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:262... [more]
SPEF22.780e-10932.79sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:262... [more]
SPEF21.081e-10832.72sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:262... [more]
SPEF22.337e-7734.94sperm flagellar 2 [Source:HGNC Symbol;Acc:HGNC:262... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spef21.966e-10231.44sperm flagellar 2 [Source:NCBI gene;Acc:553375][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SPEF28.964e-11233.03sperm flagellar 2 [Source:NCBI gene;Acc:100491905][more]
SPEF21.432e-11132.83sperm flagellar 2 [Source:NCBI gene;Acc:100491905][more]
SPEF23.322e-10833.06sperm flagellar 2 [Source:NCBI gene;Acc:100491905][more]
SPEF23.383e-9534.85sperm flagellar 2 [Source:NCBI gene;Acc:100491905][more]
SPEF21.571e-8535.31sperm flagellar 2 [Source:NCBI gene;Acc:100491905][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Spef24.535e-10630.66sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:24437... [more]
Spef29.527e-10130.33sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:24437... [more]
Spef26.094e-10030.55sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:24437... [more]
Spef21.051e-9633.49sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:24437... [more]
Spef27.458e-8234.38sperm flagellar 2 [Source:MGI Symbol;Acc:MGI:24437... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q9R095|SPEF2_RAT9.879e-11232.60Sperm flagellar protein 2 OS=Rattus norvegicus OX=... [more]
sp|Q2IA00|SPEF2_PIG1.292e-10932.03Sperm flagellar protein 2 OS=Sus scrofa OX=9823 GN... [more]
sp|Q9C093|SPEF2_HUMAN5.774e-10932.72Sperm flagellar protein 2 OS=Homo sapiens OX=9606 ... [more]
sp|Q8C9J3|SPEF2_MOUSE6.664e-10030.33Sperm flagellar protein 2 OS=Mus musculus OX=10090... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267ECL41.805e-14836.64Calponin-homology (CH) domain-containing protein O... [more]
A0A267EP002.321e-14836.90Calponin-homology (CH) domain-containing protein (... [more]
A0A1I8H3U35.509e-14836.79Calponin-homology (CH) domain-containing protein O... [more]
A0A1I8I8A25.082e-14736.68Calponin-homology (CH) domain-containing protein O... [more]
A0A0B7AEF73.083e-14035.26CH_2 domain-containing protein (Fragment) OS=Arion... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000045470.19.740e-3531.73pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spef27.178e-6127.97sperm flagellar 2 [Source:NCBI gene;Acc:553375][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO313004.487e-10636.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spef23.345e-6028.45sperm flagellar 2 [Source:NCBI gene;Acc:101158702][more]
back to top
BLAST of Calponin-homology (CH) domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000078209.10.000e+099.89SMESG000078209.1[more]
SMESG000078209.10.000e+099.89SMESG000078209.1[more]
SMESG000078209.10.000e+099.89SMESG000078209.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025902 ID=SMED30025902|Name=Calponin-homology (CH) domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5948bp
TTTATCTCAATTTATAGATTAAAATAATTTTGCTTCAACATTTTCCAACG
GTTATTTAATTGGCGAAATTTTAAAAAAATATGATTTAATGGATAATTTT
GATAAACTGTCAAAACGAAGCACCGCTGAAGCGAAATTGAGTAATTTCAT
ACTGTTGGAACCCATTTTGAAACTCCTTGGAATCAATTTCAATAATTCTG
TTGCTAAAGATGTTATGGAATCAAAATTTAGTATTCTCATCAATCTCATG
TATCAACTTTTTATAGCTTTGGAAAATAAAAAGCGATCCAACACTACTGC
ATTGTCGATGCAAACAATTCAGGCTCCGGCTACTACACAAATTCAGGAAA
TAGAGAGTGTTTTATATCAACAACGTTTGAAAAAAATAACACCTCGTCAA
ACCGACATGGAGTTGAAAGAGTTGATTAAAAAGTATCAAGATCACCAGCA
AACAATGCAAATGAAAGCTGAAAAGGAGCGAATATTGAGTGCAGAAGGTC
ATCGAGAAGAGACAGAGAAACATCGACAGAATCGTTTGAATCGCAGTAAA
TTTTTACGACAAGAACAACGTGAACAAATGAGAAAAATCGAAGCTGCTGT
TGTTAAGATTCCGAAACCGCCACCAAGTAAAACAATACAAGCGATTCAAA
AAAATAAAAAATTAAAAATACAGAAGGAAGGTGAAGATGCTCTTAAAGAA
CTTGACAATTTTGAAAGAAAACAAAGAAATGTTGTTGGGCGAGACAGAAT
AGACGACGAATTGTCATTTAGCCGAGAAGAGTCGTTCAGTATTTCTGAAA
ATGGTATTACTGACGATATTCTACCGATGATTAGGAAATCTATTAGCGAT
ACTCAAGATATCATAGAGTACATAAAACCAAAAAGTAATAAAGAATATAT
TGAAAGAATCAAAGCTCGTTTGGAAAGTGATAAAGACGCAAGAATCGCTA
GAGAAAAACGCAGACGAAAAGTTCTGGTGAATTGTCTTAAATCTCACTAT
GAACAGGAAGAAAATGAAAGAGAAAATATGATCGCAATGAGATTAATGCG
TCAATCGCAAATGGAAAGACGAATTGCTGTACAACTTCTCCACTTGAGGC
ATGAAAAAAATGTTATTAAATCTAATCGTCTAGAGAGAGAAACCCAATAT
CAGGAAAGGCGAGAAAAAGAATTCATAAATGCACTAGAAAAAGAGCGAGA
ACTAATTGAACAAATGAAATTGGTCAATTTGGATAATTTAAGGGCCGAGC
AAGACCTTTACGATATGAAGAAGGCTCAACACAAAATGATGAAATACCGG
AAACATTATGAAATGGCCGAAAAGATGATATATGATATTGTTGATTTAAG
TTGTAAAATGAGCGAGTTTAAAGTTCTAACGGAGGGTAAAATTCCAAAAA
AGATAATTAAAGAATGGAAGTTGTCTTTTATTAATGGAGTTCCGATTTAC
GATGAAACCACCGAAACGGAAAATGTGAAGAAATCCCAATCTGGTGAATT
GACACAAGTAGTTATTCAAGATATCATTTTACCAATTGAGCGGGAAATGT
CAACCATAAATGGTATGGAAAAGAAAAGGGAACTGTTAGATGAGGAAGAC
ATACTTGAGTACAAGCAATTAATCGGTGAATGGGAAATAAAGGATGAAAG
TTTAGCGGGAATAGATAGAAAAAATAACATTCTCGATTGGATTGTTGATC
GTTTGCAAATTTTAAGCCATCCTGTTGATGAAAATTCCAAAATCCCGACT
TTACCGCCATTTCCAATCAAAGCAGCTGTAGTTGGGAAATGTTTCAGTGG
GAAATCTATGTTAATTAGAAATTTAGTTAAAAATAATAAATGTGTATCTA
TTGTTCCGCAAGATGTAATTAATGAAGCTCTAGAAGCTTTCCAATCCAAC
GAAGAAATTGAAGTAGAAACAATTTTATCTATCAATGAAAATAGCAAAAT
TGATGAAGATAAAACTGAAAATCAAGTCACTTATATTAATCTCAACGCAA
GTATGGAAGAGGGGGCCGTATCATTCAATAAAGACGAAAACAATTTCACG
CCAATTGTCAATGAAATTCCTACTATTGTTAAAAAGACTTCTCAAAGAGC
ATTATTGGGCGAGAAAATTAACGCAGAACTTATGAATGGCAGATCTATTA
ATGATCAGTTATTAGTGGAAACTATCGTTGAAAAAATAAGACGCATTCCG
GATGGAACTGGGTGGATAATTGATGATTTTCCTTCTACTTATCAGCAAGC
AAAGCTGTTTGAAAAAGCAGCAACTGGTTATGAAGAACCGAATTCAAGAT
CCAGCAGGAGAACAAATTCAAAGGTTTCGACATCAAAACACAGTGGACTA
GATACTTTGATATTGTTAAATACTTCTGATCGAGATTGCCTGGCTAGAGC
CATGAAGATTTCTGAAAATCAACTTAATGACAAATTGGATAACACTGTTG
TCAGTAAAGATGTTATAGCTAATTTGCAAACAAGTCTCACAAATTTTGCG
GAGAACTGGCCAAAATTGTCTAAGTTTTATTGTCGAATTAATGAGAATCT
AGTAAAGGTAGTTGACTCCAATCAAGAGATGGATCCTACACAAGTCTATC
TTCAAGTTGAAATAATTCTAGATGATTTAATTAAACAAAAATTTATTCCC
GAACCATTAATGGATTCATTAGCTTTACCCTTAGTTGAAATCGAAGTTCC
AGTTGAAACGGTCATTCCTGATGATCAAAAGTCAGAAATCGATTTAAATA
GTGTTTCAAAAGAAGTAGTTTCATCTAAAAGGTCTGGCAGGAAATCAAAA
TCTTCATCGAGAGGAAGTAGTGCTGGAAGCAAATCCTCGGGTAAAAAAGT
TTCAGCCCGAAAAAGCCGAAGCAAATCTAAATCAGAAAGTGTGAATTCTA
AATTGGATCAAAAGTCTGTTAAAAAAGAAACTTTGAAGAAAAAAGAAAAG
GATATAGAAAAAAGGAAAGGTAGCAAAGGAAGTAAAGGTAGTAGATCAAG
TAGCAAAGGTAGCAAAGGTAGTAAAGGTAATCGAACAGGAAGTGGCAAAC
GTAAGAAATCTAAAGTATCTCAGCCGTCTGAAATTGAAAAGGCAGAAGTA
GTATCGGTTCCAGAAGTAACTGAACCTCAACCTGGCGATATAGATTGGGT
TTATGCTGAGAAACCTTTAAATCCAGAGCTGTCGTCAGTATTTTATCAAT
TTTGGGAATCCTTGAATGATGTATATGCAAACAATTGCAAACACGTCTTC
CGAGAAATGAGACAGGATCGTGAAGAAATTATTCGCTATATTCATACAAT
TAAAAAGGCTTTTCGAATGTTTCTAGATCGACCTGATGCTAAGCAAGAGT
ATCTAGATCAATTTCAGAAGGACTTTAATGAAATTGATGATGAGTGGAGA
GAAGACGAAGAAGTTCAACAAGAATTGCATCAAAGAATTTCTGAATTAAA
AGACCAACTTTTAGAAATCAGCCAAGAAAATCATGCGGATGCCGATAAAG
AACTGGACACTTTAAAAAACAACCGTTGGCTTGAGGATAGGGTTGGTCTT
ATCTCGAATCAGTACTTGAATCTGATGGCAAGTGAATTTGACCGATTCCA
AGATGTGGTGCGATTTTTGAAAGATTATTACAAGTCCATGGTTAATCTGA
CTCTTGAAGACTTCAGACCAGAATTTTTGAGATTACCTTTGATTGAGATT
CCAAGTATTCAAGAAGCAAACAATGATCAGCAAGAATTGAACATTGAATC
AAATAAAAATTCGGTCATCAATAATGCCACTAGTCCAACTACAAAAAAGG
CGGCACCGAAGCCAGCTGGTAAGGCTCAGCCGGGAGAAAATCAAGCTACA
GAAGAAAATAAAGAATTAACAGATGAAGAAATTGAAGCAATGTTCAAAAC
CAAAATCCCTTTGATAGAATATAGAACTCCTGGACCTCAGATTATTTCCT
CTGCTTTAACCAGTATTGCTGTTAGTGGAAAGCCAATTAAAGGAGATAAA
GCTGGTAGTTCTGGTGGCATTGCAAAATTACTTGGCGCTTCTAAACCCGA
CAAAAAATCAGAAAAGCCTTCGGAATTGTCGGTACCACCAAACGATTTGG
ATGAAAAACTATTATATGATACACTGCTGAGCTGTTTCACTCTCGCTGGT
GCAATTATTGAAATGGAAATTTCACAATCTGGTCAGAAGGATGAGAATAG
CAAAGCGCCAGCAAATACCGGTCCTGAAAAAGGAAAATCTGATAAAAAAG
GCAAAGGTGGAAAGAAAAGTAGAACTCCTACTCCAAAGAAAGGCTCTAAA
GACAAAACTGCAACTAATACTTCTGCGAAATCAAGATCTAGAAGCGGTTC
AGCGAAGAAAAAAGGCAAAGGAAAAGGAAAAGCGACTCCTTCGAAAGAAG
TCAATTTAAATTTGCCTCAGGAGGCTGAAGAAACAGAAGAAGATAAACAA
AATAGATTATTCCTTGAAAAATCAAAATTAGAATATGTAGCAGCTCTACA
AAAAGAACTTTCCATTTTACGAATTAATACGAAGGTCATTATGCTAAAGG
GTACAGAAGATATTAAAAACATTAAAAATATATATGATTCGGTTTTCCAA
TTATTTTCAACTTGGATCGCTGACAAGTTGTTATCAGAGGACATTAGTAT
AAAAGAAATAGAAAAGGTATTTCGATATCATATTGAAATAAAAAAACCAT
TGAAGGAAAAAATAGAGTTAATTAATAATAAATTTTATTTAAATCCGAAT
ATATCTATGATTCCAGTTGAGGAAGAAGATAGCGACAAAAAGCAAAGAGT
AGAAGTTCGTCCAGAGTCAATTGATGTCGTCGGTGATAGATATTTTACGA
TTTTCCAATTGAAGGCCTTTTATAAATTGTTTCAATCTATTACCACATTT
GATAGTGCTTCGATCTCTGTCATTGATTTCGTTAGATTGATCAACGACTC
TCTTATAGCTTCTGATCCGAAAACATTGCCAACCTTCATTAACCTTAACA
GTCATACTGAATCCATTATAACGAATATTGCAGAAGCGTTCAGTTGTGAC
AAAGAATATGTAAATTGGCGTCTATTTCTACTGGCCTGCAGTGAACCGTG
GCCATGGCCAACGCAAAGTGAGCTGATGGCAATGTTGGCGGCATTTAAAA
ATCTTGACCAGCAAAACACGGGCTTTGTAACAAGGGAACAGTATGATTTC
ATTGACTTGTGGTTCCCTATTCCCTCAACCCCTACAACACCAACTGATAT
GTCAATTCCGAAAACAATCAATCGTCAGAATGAAATAAAAAATTTGTTTT
TCGATATTTTTAAACAGGGAGATGATCCAAACGAACTGTCAGAAGTTGAT
GTTCAACATAGGATTGAATACATGAACTATGAAGAAATGTTGATGCATTT
TGCCATATTTTGTACAAATAATTTTTACTCTGGAATTATTCGAGCTTTGT
CAGTGGCGTCTGGTCAGTCATTGCCTCATATTCCTGTCATGTTCAAGGAC
TTGGAGTTACTGCCTGATGATGACCTCGACACGATTCAAGAAGACAGTTC
GGAGACTAATATTCGCATACAGGACCTATATAAAGTTCTTTCATTTGGCC
GCCGTAAATTTTCTTCCTTTGATGATAATTTGGAAGACATTGATTTAGAA
GATTCCGAAAGTGAACGAGATGCCGCTTTAATTAAAAGTTTAAAGTCAAT
TTACGATATTCTTATTGAATCTGATGAGTTGATTGCTCCATTTAGTTCAT
TATTAAAACATGAAGCCTTAATGGAGTGGTTTATGAGCTGCCAGTGGTTT
GGGCATGTCGAATTTCAGTCGTTCTTTCCCGATGACTCGTTTCGTTTGTC
TGCAGATTCCTAAATTAATTATAAAAAAAACTACTTTCTTCTATGTAGAT
TTCACTGAAAATTATTATTTTATTATTCAAAACCAATAAAATAAAGAC
back to top

protein sequence of SMED30025902-orf-1

>SMED30025902-orf-1 ID=SMED30025902-orf-1|Name=SMED30025902-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1925bp
MDNFDKLSKRSTAEAKLSNFILLEPILKLLGINFNNSVAKDVMESKFSIL
INLMYQLFIALENKKRSNTTALSMQTIQAPATTQIQEIESVLYQQRLKKI
TPRQTDMELKELIKKYQDHQQTMQMKAEKERILSAEGHREETEKHRQNRL
NRSKFLRQEQREQMRKIEAAVVKIPKPPPSKTIQAIQKNKKLKIQKEGED
ALKELDNFERKQRNVVGRDRIDDELSFSREESFSISENGITDDILPMIRK
SISDTQDIIEYIKPKSNKEYIERIKARLESDKDARIAREKRRRKVLVNCL
KSHYEQEENERENMIAMRLMRQSQMERRIAVQLLHLRHEKNVIKSNRLER
ETQYQERREKEFINALEKERELIEQMKLVNLDNLRAEQDLYDMKKAQHKM
MKYRKHYEMAEKMIYDIVDLSCKMSEFKVLTEGKIPKKIIKEWKLSFING
VPIYDETTETENVKKSQSGELTQVVIQDIILPIEREMSTINGMEKKRELL
DEEDILEYKQLIGEWEIKDESLAGIDRKNNILDWIVDRLQILSHPVDENS
KIPTLPPFPIKAAVVGKCFSGKSMLIRNLVKNNKCVSIVPQDVINEALEA
FQSNEEIEVETILSINENSKIDEDKTENQVTYINLNASMEEGAVSFNKDE
NNFTPIVNEIPTIVKKTSQRALLGEKINAELMNGRSINDQLLVETIVEKI
RRIPDGTGWIIDDFPSTYQQAKLFEKAATGYEEPNSRSSRRTNSKVSTSK
HSGLDTLILLNTSDRDCLARAMKISENQLNDKLDNTVVSKDVIANLQTSL
TNFAENWPKLSKFYCRINENLVKVVDSNQEMDPTQVYLQVEIILDDLIKQ
KFIPEPLMDSLALPLVEIEVPVETVIPDDQKSEIDLNSVSKEVVSSKRSG
RKSKSSSRGSSAGSKSSGKKVSARKSRSKSKSESVNSKLDQKSVKKETLK
KKEKDIEKRKGSKGSKGSRSSSKGSKGSKGNRTGSGKRKKSKVSQPSEIE
KAEVVSVPEVTEPQPGDIDWVYAEKPLNPELSSVFYQFWESLNDVYANNC
KHVFREMRQDREEIIRYIHTIKKAFRMFLDRPDAKQEYLDQFQKDFNEID
DEWREDEEVQQELHQRISELKDQLLEISQENHADADKELDTLKNNRWLED
RVGLISNQYLNLMASEFDRFQDVVRFLKDYYKSMVNLTLEDFRPEFLRLP
LIEIPSIQEANNDQQELNIESNKNSVINNATSPTTKKAAPKPAGKAQPGE
NQATEENKELTDEEIEAMFKTKIPLIEYRTPGPQIISSALTSIAVSGKPI
KGDKAGSSGGIAKLLGASKPDKKSEKPSELSVPPNDLDEKLLYDTLLSCF
TLAGAIIEMEISQSGQKDENSKAPANTGPEKGKSDKKGKGGKKSRTPTPK
KGSKDKTATNTSAKSRSRSGSAKKKGKGKGKATPSKEVNLNLPQEAEETE
EDKQNRLFLEKSKLEYVAALQKELSILRINTKVIMLKGTEDIKNIKNIYD
SVFQLFSTWIADKLLSEDISIKEIEKVFRYHIEIKKPLKEKIELINNKFY
LNPNISMIPVEEEDSDKKQRVEVRPESIDVVGDRYFTIFQLKAFYKLFQS
ITTFDSASISVIDFVRLINDSLIASDPKTLPTFINLNSHTESIITNIAEA
FSCDKEYVNWRLFLLACSEPWPWPTQSELMAMLAAFKNLDQQNTGFVTRE
QYDFIDLWFPIPSTPTTPTDMSIPKTINRQNEIKNLFFDIFKQGDDPNEL
SEVDVQHRIEYMNYEEMLMHFAIFCTNNFYSGIIRALSVASGQSLPHIPV
MFKDLELLPDDDLDTIQEDSSETNIRIQDLYKVLSFGRRKFSSFDDNLED
IDLEDSESERDAALIKSLKSIYDILIESDELIAPFSSLLKHEALMEWFMS
CQWFGHVEFQSFFPDDSFRLSADS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR010441CH_2
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0019205nucleobase-containing compound kinase activity
Vocabulary: biological process
TermDefinition
GO:0006139nucleobase-containing compound metabolic process
GO:0016310phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0031514motile cilium