Tudor domain-containing protein

Overview
NameTudor domain-containing protein
Smed IDSMED30025899
Length (bp)1605
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tudor domain-containing protein (SMED30025899) t-SNE clustered cells

Violin plots show distribution of expression levels for Tudor domain-containing protein (SMED30025899) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tudor domain-containing protein (SMED30025899) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tudor domain-containing protein (SMED30025899) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025899

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30025899SMESG000005854.1 SmedASXL_008591SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
posterior muscle cellSMED30025899SMESG000005854.1 dd_Smed_v4_4383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025899SMESG000005854.1 dd_Smed_v4_4383_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tudor domain-containing protein vs. Ensembl Human
Match: TDRD3 (tudor domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20612])

HSP 1 Score: 93.5893 bits (231), Expect = 2.191e-19
Identity = 88/330 (26.67%), Postives = 151/330 (45.76%), Query Frame = 2
Query:   41 LKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            L   GWY+++  +     + D + +  +I  I LNTD++  G+ ++     S  ++ L         +  C  V QI K+RNVAAP+ +++++    +L+  +TDG  +   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L           DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE + K + K   V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    9 LSQAGWYLSDEGIEACTSSPD-KVNVNDIILIALNTDLRTIGKKFLPSDINSGKVEKL---------EGPC--VLQIQKIRNVAAPKDNEESQAAPRMLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDS-NTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTL-QVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLL 324          
BLAST of Tudor domain-containing protein vs. Ensembl Human
Match: TDRD3 (tudor domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20612])

HSP 1 Score: 68.5514 bits (166), Expect = 1.787e-11
Identity = 63/233 (27.04%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  332 LLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            +L+  +TDG  +   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L           DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE + K + K   V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    1 MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDS-NTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTL-QVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLL 231          
BLAST of Tudor domain-containing protein vs. Ensembl Human
Match: TDRD3 (tudor domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20612])

HSP 1 Score: 68.5514 bits (166), Expect = 1.787e-11
Identity = 63/233 (27.04%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  332 LLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            +L+  +TDG  +   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L           DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE + K + K   V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    1 MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDS-NTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTL-QVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLL 231          
BLAST of Tudor domain-containing protein vs. Ensembl Human
Match: TDRD3 (tudor domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20612])

HSP 1 Score: 68.5514 bits (166), Expect = 1.787e-11
Identity = 63/233 (27.04%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  332 LLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            +L+  +TDG  +   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L           DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE + K + K   V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    1 MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDS-NTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTL-QVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLL 231          
BLAST of Tudor domain-containing protein vs. Ensembl Human
Match: TDRD3 (tudor domain containing 3 [Source:HGNC Symbol;Acc:HGNC:20612])

HSP 1 Score: 68.5514 bits (166), Expect = 1.787e-11
Identity = 63/233 (27.04%), Postives = 103/233 (44.21%), Query Frame = 2
Query:  332 LLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            +L+  +TDG  +   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L           DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE + K + K   V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    1 MLRLQMTDGHISCTAVEFSYMSKISLNTPPGTKVKLSGIVDIKNGFLLLNDS-NTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHVQVDSRELDRRKTL-QVTMPVKPTNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMNAAGNRNREVLQKEKSTKSEGKHEGVYRELVDEKALKHITEMGFSKEASRQALMDNGNNLEAALNVLL 231          
BLAST of Tudor domain-containing protein vs. Ensembl Celegans
Match: Y50D4C.3 (pep chromosome:WBcel235:V:939391:945244:-1 gene:WBGene00021748.1 transcript:Y50D4C.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y50D4C.3)

HSP 1 Score: 83.5741 bits (205), Expect = 9.184e-17
Identity = 66/221 (29.86%), Postives = 113/221 (51.13%), Query Frame = 2
Query:   32 LKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGE-SWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQD-NKNN--HPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSS------KTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKA 664
            +  L+ +GWYINE + +    +E +  +   I++++LN D++++GE S IN   K + +             F+   V Q+ + RNV+ P + ++ N+ +  H +++   TDG S++  L LQS   +  +  PG K++  G+   + G +IL  K +I  LGGKV ++I   ++ KSS      K+    G GA    PK+  FG K     Q  + FKA
Sbjct:    1 MDQLRKDGWYINESQTSQLFDDELLPKNGSEIEKVILNEDLRNFGEASIINLLKKEDFV-------------FEGPCVLQLLRYRNVSVPRIKEELNQTDPAHSIIRLFFTDGHSSISALLLQSIPGITSDTPPGTKILILGKVDVEGGFLILGKK-DIRILGGKVDEMIEKWNVEKSSVRAGGFKSSVGKGTGA----PKWISFG-KRGQKGQLEKGFKA 202          
BLAST of Tudor domain-containing protein vs. Ensembl Fly
Match: Tdrd3 (gene:FBgn0036450 transcript:FBtr0075691)

HSP 1 Score: 87.4261 bits (215), Expect = 1.117e-17
Identity = 66/243 (27.16%), Postives = 115/243 (47.33%), Query Frame = 2
Query:   26 QILKNLKTEGWYINELKL---TNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGR--GALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAV 739
            ++ K L+  GWY+ E  L   T  + +ED+    + I    LN D++  G   + P+ + +                    V Q+ +VRN+AAP+ ++++K    LL+  ++DG +++  L+L+   +LN NV PG K+ F  +        +L+    I  LGG+V  L     ++++      SGR     + PP +  FG K++ N +   NFK+L   D KD    +N +F   R  A+
Sbjct:    2 ELGKKLREVGWYLTEEGLKIVTTAVGSEDV----RKIVNDALNRDLRDIGGGAL-PAKREDAT-------------LPGKIVLQVQRVRNIAAPKANEESKAAPRLLQLDLSDGQNSIKALELEPVPQLNLNVAPGSKIYFKAEKLQLMQGFLLLKSSEIQLLGGRVDALYEKWDLARTMMRYARSGRPLNGTSAPPPWVAFGRKIDSNAESEMNFKSLGEGD-KDKPAKENEEFNAMRTEAI 225          
BLAST of Tudor domain-containing protein vs. Ensembl Zebrafish
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:402828])

HSP 1 Score: 90.8929 bits (224), Expect = 8.965e-19
Identity = 103/375 (27.47%), Postives = 171/375 (45.60%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEP-SYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI-----NASTDKYSLLDKFHSGGTSKFLKETAEK-----------RDQKDSNVAY-LMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDXXXXXXXXXXXXXANEDEDD 1078
            M  +   L  EGWY+ +  +     + + E  S  +I ++ LN D++  G+S++     S  I+ L         +  C  V Q+ K+RNVAA +  ++++    +L+  +TDG +    L+ +  SK++ N  PG KV   G    K+G ++L+D   I  LGG+V  +I      +S         GA   PP F PFG K      ++ + +   K L  S N      DN +F  +R AA+ E+ K+K+        NA  +  +    F S  T +  +E  EK           RD  D      +M  GF+     +AL  +N ++  AL++LL +        +++     R +GRGKGR+ +DED+
Sbjct:    1 MCDLSSALIKEGWYLTDEGIEECKSSSEKEKTSPTDIIQVALNNDLRPIGKSFLPADINSGRIEKL---------EGPC--VLQVQKIRNVAASKDHEESQAAPRMLRVQMTDGHTACTGLEFKQLSKISLNTPPGTKVKLLGVVQVKNG-ILLLDDSKIAVLGGEVDHMIEKWEFQRSLAKHSRRNIGAEGGPPPFVPFGQKCVHKEQVDSRALDQRKTL-QSTNAVKSADDNDEFEKQRTAAIAEVAKSKETRTFGGGGNAGGNLANPGSSFKSRDTYQRKREEREKPWTENKSDGVYRDLVDERALRDIMEMGFNREAARQALLDNNNNLEVALNLLLTRANQPRAAPVEQSRPPPRGKGRGKGRSRQDEDE 362          
BLAST of Tudor domain-containing protein vs. Ensembl Zebrafish
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:402828])

HSP 1 Score: 90.8929 bits (224), Expect = 9.855e-19
Identity = 103/375 (27.47%), Postives = 171/375 (45.60%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEP-SYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI-----NASTDKYSLLDKFHSGGTSKFLKETAEK-----------RDQKDSNVAY-LMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDXXXXXXXXXXXXXANEDEDD 1078
            M  +   L  EGWY+ +  +     + + E  S  +I ++ LN D++  G+S++     S  I+ L         +  C  V Q+ K+RNVAA +  ++++    +L+  +TDG +    L+ +  SK++ N  PG KV   G    K+G ++L+D   I  LGG+V  +I      +S         GA   PP F PFG K      ++ + +   K L  S N      DN +F  +R AA+ E+ K+K+        NA  +  +    F S  T +  +E  EK           RD  D      +M  GF+     +AL  +N ++  AL++LL +        +++     R +GRGKGR+ +DED+
Sbjct:    1 MCDLSSALIKEGWYLTDEGIEECKSSSEKEKTSPTDIIQVALNNDLRPIGKSFLPADINSGRIEKL---------EGPC--VLQVQKIRNVAASKDHEESQAAPRMLRVQMTDGHTACTGLEFKQLSKISLNTPPGTKVKLLGVVQVKNG-ILLLDDSKIAVLGGEVDHMIEKWEFQRSLAKHSRRNIGAEGGPPPFVPFGQKCVHKEQVDSRALDQRKTL-QSTNAVKSADDNDEFEKQRTAAIAEVAKSKETRTFGGGGNAGGNLANPGSSFKSRDTYQRKREEREKPWTENKSDGVYRDLVDERALRDIMEMGFNREAARQALLDNNNNLEVALNLLLTRANQPRAAPVEQSRPPPRGKGRGKGRSRQDEDE 362          
BLAST of Tudor domain-containing protein vs. Ensembl Zebrafish
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:402828])

HSP 1 Score: 85.5001 bits (210), Expect = 5.508e-17
Identity = 101/362 (27.90%), Postives = 164/362 (45.30%), Query Frame = 2
Query:   86 YLKNEDIEP----------SYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI-----NASTDKYSLLDKFHSGGTSKFLKETAEK-----------RDQKDSNVAY-LMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDXXXXXXXXXXXXXANEDEDD 1078
            YL +E IE           S  +I ++ LN D++  G+S++     S  I+ L         +  C  V Q+ K+RNVAA +  ++++    +L+  +TDG +    L+ +  SK++ N  PG KV   G    K+G ++L+D   I  LGG+V  +I      +S         GA   PP F PFG K      ++ + +   K L  S N      DN +F  +R AA+ E+ K+K+        NA  +  +    F S  T +  +E  EK           RD  D      +M  GF+     +AL  +N ++  AL++LL +        +++     R +GRGKGR+ +DED+
Sbjct:   13 YLTDEGIEECKSSSEKEKTSPTDIIQVALNNDLRPIGKSFLPADINSGRIEKL---------EGPC--VLQVQKIRNVAASKDHEESQAAPRMLRVQMTDGHTACTGLEFKQLSKISLNTPPGTKVKLLGVVQVKNG-ILLLDDSKIAVLGGEVDHMIEKWEFQRSLAKHSRRNIGAEGGPPPFVPFGQKCVHKEQVDSRALDQRKTL-QSTNAVKSADDNDEFEKQRTAAIAEVAKSKETRTFGGGGNAGGNLANPGSSFKSRDTYQRKREEREKPWTENKSDGVYRDLVDERALRDIMEMGFNREAARQALLDNNNNLEVALNLLLTRANQPRAAPVEQSRPPPRGKGRGKGRSRQDEDE 361          
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Match: slc9a7 (solute carrier family 9 member A7 [Source:Xenbase;Acc:XB-GENE-487749])

HSP 1 Score: 91.2781 bits (225), Expect = 9.918e-19
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-DDINASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RN++AP+ +++++    +L+  +TDG ++   ++L   SK++ N  PG K+   G    K+G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG +     +++ +E+ + K L +S     + G+N +F  +R AA+ E+ K+K+        +  S L+    G  +K  F KE   + + K   V           ++   GFS     +AL   + +V  AL+ LL
Sbjct:   86 VLQIQKIRNISAPKDNEESQAAPRMLRLQLTDGHTSCTAIELNYLSKISLNTPPGTKIKLLGTIEVKNGY-LLLDDTNTVVLGGEVEHLIEKWELQRSLSKHSRSNIGIEGGPPPFVPFGQRCASVASVDSKELDSRKTLQASSVTKPV-GENDEFEKQRTAAIAEVAKSKETKTFGGGGNAGSNLNPGAGGSRNKEVFQKEKIIRAEGKSEGVYRELVDEKALRHITEMGFSKDAARQALMDHSNNVEAALNSLL 339          
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Match: slc9a7 (solute carrier family 9 member A7 [Source:Xenbase;Acc:XB-GENE-487749])

HSP 1 Score: 90.8929 bits (224), Expect = 1.185e-18
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-DDINASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RN++AP+ +++++    +L+  +TDG ++   ++L   SK++ N  PG K+   G    K+G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG +     +++ +E+ + K L +S     + G+N +F  +R AA+ E+ K+K+        +  S L+    G  +K  F KE   + + K   V           ++   GFS     +AL   + +V  AL+ LL
Sbjct:   40 VLQIQKIRNISAPKDNEESQAAPRMLRLQLTDGHTSCTAIELNYLSKISLNTPPGTKIKLLGTIEVKNGY-LLLDDTNTVVLGGEVEHLIEKWELQRSLSKHSRSNIGIEGGPPPFVPFGQRCASVASVDSKELDSRKTLQASSVTKPV-GENDEFEKQRTAAIAEVAKSKETKTFGGGGNAGSNLNPGAGGSRNKEVFQKEKIIRAEGKSEGVYRELVDEKALRHITEMGFSKDAARQALMDHSNNVEAALNSLL 293          
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Match: slc9a7 (solute carrier family 9 member A7 [Source:Xenbase;Acc:XB-GENE-487749])

HSP 1 Score: 90.8929 bits (224), Expect = 1.248e-18
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-DDINASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RN++AP+ +++++    +L+  +TDG ++   ++L   SK++ N  PG K+   G    K+G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG +     +++ +E+ + K L +S     + G+N +F  +R AA+ E+ K+K+        +  S L+    G  +K  F KE   + + K   V           ++   GFS     +AL   + +V  AL+ LL
Sbjct:   35 VLQIQKIRNISAPKDNEESQAAPRMLRLQLTDGHTSCTAIELNYLSKISLNTPPGTKIKLLGTIEVKNGY-LLLDDTNTVVLGGEVEHLIEKWELQRSLSKHSRSNIGIEGGPPPFVPFGQRCASVASVDSKELDSRKTLQASSVTKPV-GENDEFEKQRTAAIAEVAKSKETKTFGGGGNAGSNLNPGAGGSRNKEVFQKEKIIRAEGKSEGVYRELVDEKALRHITEMGFSKDAARQALMDHSNNVEAALNSLL 288          
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Match: slc9a7 (solute carrier family 9 member A7 [Source:Xenbase;Acc:XB-GENE-487749])

HSP 1 Score: 90.8929 bits (224), Expect = 1.377e-18
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-DDINASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RN++AP+ +++++    +L+  +TDG ++   ++L   SK++ N  PG K+   G    K+G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG +     +++ +E+ + K L +S     + G+N +F  +R AA+ E+ K+K+        +  S L+    G  +K  F KE   + + K   V           ++   GFS     +AL   + +V  AL+ LL
Sbjct:   35 VLQIQKIRNISAPKDNEESQAAPRMLRLQLTDGHTSCTAIELNYLSKISLNTPPGTKIKLLGTIEVKNGY-LLLDDTNTVVLGGEVEHLIEKWELQRSLSKHSRSNIGIEGGPPPFVPFGQRCASVASVDSKELDSRKTLQASSVTKPV-GENDEFEKQRTAAIAEVAKSKETKTFGGGGNAGSNLNPGAGGSRNKEVFQKEKIIRAEGKSEGVYRELVDEKALRHITEMGFSKDAARQALMDHSNNVEAALNSLL 288          
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Match: slc9a7 (solute carrier family 9 member A7 [Source:Xenbase;Acc:XB-GENE-487749])

HSP 1 Score: 90.5077 bits (223), Expect = 1.653e-18
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-DDINASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RN++AP+ +++++    +L+  +TDG ++   ++L   SK++ N  PG K+   G    K+G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG +     +++ +E+ + K L +S     + G+N +F  +R AA+ E+ K+K+        +  S L+    G  +K  F KE   + + K   V           ++   GFS     +AL   + +V  AL+ LL
Sbjct:   54 VLQIQKIRNISAPKDNEESQAAPRMLRLQLTDGHTSCTAIELNYLSKISLNTPPGTKIKLLGTIEVKNGY-LLLDDTNTVVLGGEVEHLIEKWELQRSLSKHSRSNIGIEGGPPPFVPFGQRCASVASVDSKELDSRKTLQASSVTKPV-GENDEFEKQRTAAIAEVAKSKETKTFGGGGNAGSNLNPGAGGSRNKEVFQKEKIIRAEGKSEGVYRELVDEKALRHITEMGFSKDAARQALMDHSNNVEAALNSLL 307          
BLAST of Tudor domain-containing protein vs. Ensembl Mouse
Match: Tdrd3 (tudor domain containing 3 [Source:MGI Symbol;Acc:MGI:2444023])

HSP 1 Score: 98.5969 bits (244), Expect = 3.907e-21
Identity = 94/330 (28.48%), Postives = 152/330 (46.06%), Query Frame = 2
Query:   41 LKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQ----EIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            L   GWY+++ +      +   + S  +I  I LNTD++  G+ ++        ++ L         +  C  V QI KVRNVAAP+ +++++    +L+  +TDG ++   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  GA   PP F PFG K   NVQ    E+   K L  S        DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE A K + K+  V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    9 LSQAGWYLSD-EGVEACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKL---------EGPC--VLQIQKVRNVAAPKDNEESQAAPRMLRVQMTDGHTSCTAVEFSYISKISLNTPPGTKVKLSGTVDIKNGFLLLSDS-NTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGGPPPFLPFGQKCASNVQVDSRELDRRKTLQVS-LPAKPANDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNIGAAGHRNREVLQKEKASKSESKNEGVYRELVDEKALKHITEMGFSKEASRQALMDNANNLEAALNVLL 324          
BLAST of Tudor domain-containing protein vs. Ensembl Mouse
Match: Tdrd3 (tudor domain containing 3 [Source:MGI Symbol;Acc:MGI:2444023])

HSP 1 Score: 98.2117 bits (243), Expect = 5.057e-21
Identity = 94/330 (28.48%), Postives = 152/330 (46.06%), Query Frame = 2
Query:   41 LKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQ----EIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            L   GWY+++  +     +   + S  +I  I LNTD++  G+ ++        ++ L         +  C  V QI KVRNVAAP+ +++++    +L+  +TDG ++   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  GA   PP F PFG K   NVQ    E+   K L  S        DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE A K + K+  V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    9 LSQAGWYLSDEGV-EACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKL---------EGPC--VLQIQKVRNVAAPKDNEESQAAPRMLRVQMTDGHTSCTAVEFSYISKISLNTPPGTKVKLSGTVDIKNGFLLLSDS-NTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGGPPPFLPFGQKCASNVQVDSRELDRRKTLQVS-LPAKPANDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNIGAAGHRNREVLQKEKASKSESKNEGVYRELVDEKALKHITEMGFSKEASRQALMDNANNLEAALNVLL 324          
BLAST of Tudor domain-containing protein vs. Ensembl Mouse
Match: Tdrd3 (tudor domain containing 3 [Source:MGI Symbol;Acc:MGI:2444023])

HSP 1 Score: 97.0561 bits (240), Expect = 1.057e-20
Identity = 94/323 (29.10%), Postives = 148/323 (45.82%), Query Frame = 2
Query:   86 YLKNEDIEP--------SYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQ----EIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            YL +E +E         S  +I  I LNTD++  G+ ++        ++ L         +  C  V QI KVRNVAAP+ +++++    +L+  +TDG ++   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  GA   PP F PFG K   NVQ    E+   K L  S        DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE A K + K+  V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    9 YLSDEGVEACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKL---------EGPC--VLQIQKVRNVAAPKDNEESQAAPRMLRVQMTDGHTSCTAVEFSYISKISLNTPPGTKVKLSGTVDIKNGFLLLSDS-NTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGGPPPFLPFGQKCASNVQVDSRELDRRKTLQVS-LPAKPANDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNIGAAGHRNREVLQKEKASKSESKNEGVYRELVDEKALKHITEMGFSKEASRQALMDNANNLEAALNVLL 318          
BLAST of Tudor domain-containing protein vs. Ensembl Mouse
Match: Tdrd3 (tudor domain containing 3 [Source:MGI Symbol;Acc:MGI:2444023])

HSP 1 Score: 81.2629 bits (199), Expect = 3.682e-17
Identity = 49/128 (38.28%), Postives = 71/128 (55.47%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQ 643
            V QI KVRNVAAP+ +++++    +L+  +TDG ++   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  GA   PP F PFG K   NVQ
Sbjct:   59 VLQIQKVRNVAAPKDNEESQAAPRMLRVQMTDGHTSCTAVEFSYISKISLNTPPGTKVKLSGTVDIKNGFLLLSDS-NTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGGPPPFLPFGQKCASNVQ 185          
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q91W18|TDRD3_MOUSE (Tudor domain-containing protein 3 OS=Mus musculus OX=10090 GN=Tdrd3 PE=1 SV=4)

HSP 1 Score: 98.2117 bits (243), Expect = 3.537e-20
Identity = 94/330 (28.48%), Postives = 152/330 (46.06%), Query Frame = 2
Query:   41 LKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQ----EIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            L   GWY+++  +     +   + S  +I  I LNTD++  G+ ++        ++ L         +  C  V QI KVRNVAAP+ +++++    +L+  +TDG ++   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  GA   PP F PFG K   NVQ    E+   K L  S        DN +F  +R AA+ E+ K+K+            S L+   +G  ++    KE A K + K+  V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:    9 LSQAGWYLSDEGV-EACTSSPGKGSINDIILIALNTDLRTIGKKFLPSDINGGKVEKL---------EGPC--VLQIQKVRNVAAPKDNEESQAAPRMLRVQMTDGHTSCTAVEFSYISKISLNTPPGTKVKLSGTVDIKNGFLLLSDS-NTTVLGGEVEHLIDKWALQRSLLKHNRSNIGAEGGPPPFLPFGQKCASNVQVDSRELDRRKTLQVS-LPAKPANDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNIGAAGHRNREVLQKEKASKSESKNEGVYRELVDEKALKHITEMGFSKEASRQALMDNANNLEAALNVLL 324          
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5ZMS6|TDRD3_CHICK (Tudor domain-containing protein 3 OS=Gallus gallus OX=9031 GN=TDRD3 PE=2 SV=1)

HSP 1 Score: 97.0561 bits (240), Expect = 7.047e-20
Identity = 84/330 (25.45%), Postives = 154/330 (46.67%), Query Frame = 2
Query:   41 LKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSK----FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            L   GWY+++  +   + N   + +  +I  + LNTD++  G+ ++        ++ L         +  C  V QI K+RNV+AP+ +++++    +L+  +TDG ++   ++  S SK++ N  PG K+  +G    ++G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L  ++    +  DN +F  +R AA+ E+ K+K+          S  +   S G ++    F KE   K + K+  V           ++   GFS     +AL  ++ ++  AL+ LL
Sbjct:    9 LSESGWYLSDEGIETCI-NSSEKVNTNDIILVALNTDLRTIGKKFLPSDINGGKVEKL---------EGPC--VLQIQKIRNVSAPKDNEESQAAPRMLRLQMTDGHTSCTAIEYNSMSKISLNTPPGTKIKLSGIIEVRNGF-LLLDDSNTAVLGGEVEHLIEKWELQRSLAKHSRSNIGTEGGPPPFLPFGQKCASHMQVDSRELDRRKTLQMTNTAKPVT-DNDEFEKQRTAAIAEVAKSKETKTFGGGGGSSRSNLTVSAGGNRNRELFQKEKITKPEGKNEGVYRELVDEKALKHITEMGFSKEAARQALMDNSNNLEAALNFLL 324          
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6P1U3|TDRD3_XENTR (Tudor domain-containing protein 3 OS=Xenopus tropicalis OX=8364 GN=tdrd3 PE=2 SV=2)

HSP 1 Score: 90.8929 bits (224), Expect = 7.296e-18
Identity = 72/256 (28.12%), Postives = 124/256 (48.44%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-DDINASTDKYSLLDKFHSGGTSK--FLKETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RN++AP+ +++++    +L+  +TDG ++   ++L   SK++ N  PG K+   G    K+G  +L+D  N   LGG+V  LI    + +S      S  G    PP F PFG +     +++ +E+ + K L +S     + G+N +F  +R AA+ E+ K+K+        +  S L+    G  +K  F KE   + + K   V           ++   GFS     +AL   + +V  AL+ LL
Sbjct:   35 VLQIQKIRNISAPKDNEESQAAPRMLRLQLTDGHTSCTAIELNYLSKISLNTPPGTKIKLLGTIEVKNGY-LLLDDTNTVVLGGEVEHLIEKWELQRSLSKHSRSNIGIEGGPPPFVPFGQRCASVASVDSKELDSRKTLQASSVTKPV-GENDEFEKQRTAAIAEVAKSKETKTFGGGGNAGSNLNPGAGGSRNKEVFQKEKIIRAEGKSEGVYRELVDEKALRHITEMGFSKDAARQALMDHSNNVEAALNSLL 288          
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6NYG6|TDRD3_DANRE (Tudor domain-containing protein 3 OS=Danio rerio OX=7955 GN=tdrd3 PE=2 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 1.391e-17
Identity = 102/375 (27.20%), Postives = 171/375 (45.60%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEP-SYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI-----NASTDKYSLLDKFHSGGTSKFLKETAEK-----------RDQKDSNVAY-LMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDXXXXXXXXXXXXXANEDEDD 1078
            M  +   L  EGWY+ +  +     + + E  S  +I ++ LN D++  G+S++     S  I+ L         +  C  V Q+ K+RNVAA +  ++++    +L+  +TDG +    L+ +  SK++ N  PG KV   G    K+G ++L+D   I  LGG+V  +I      +S         GA   PP F PFG K      ++ + +   K L  S N      DN +F  +R AA+ E+ K+K+        NA  +  +    + S  T +  +E  EK           RD  D      +M  GF+     +AL  +N ++  AL++LL +        +++     R +GRGKGR+ +DED+
Sbjct:    1 MCDLSSALIKEGWYLTDEGIEECKSSSEKEKTSPTDIIQVALNNDLRPIGKSFLPADINSGRIEKL---------EGPC--VLQVQKIRNVAASKDHEESQAAPRMLRVQMTDGHTACTGLEFKQLSKISLNTPPGTKVKLLGVVQVKNG-ILLLDDSKIAVLGGEVDHMIEKWEFQRSLAKHSRRNIGAEGGPPPFVPFGQKCVHKEQVDSRALDQRKTL-QSTNAVKSADDNDEFEKQRTAAIAEVAKSKETRTFGGGGNAGGNLANPGSSYKSRDTYQRKREEREKPWTENKSDGVYRDLVDERALRDIMEMGFNREAARQALLDNNNNLEVALNLLLTRANQPRAAPVEQSRPPPRGKGRGKGRSRQDEDE 362          
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2HJG4|TDRD3_BOVIN (Tudor domain-containing protein 3 OS=Bos taurus OX=9913 GN=TDRD3 PE=2 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.886e-17
Identity = 74/257 (28.79%), Postives = 121/257 (47.08%), Query Frame = 2
Query:  260 VFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNK----LNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDI--NASTDKYSLLDKFHSGGTSKFL--KETAEKRDQKDSNV----------AYLMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            V QI K+RNVAAP+ +++++    +L+  +TDG  +   ++    SK++ N  PG KV  +G    K+G ++L D  N T LGG+V  LI    + +S      S  G    PP F PFG K    + ++ +E+   K L           DN +F  +R AA+ E+ K+K+            S L+   +G  ++ +  KE A K + K   V           ++   GFS     +AL  +  ++  AL++LL
Sbjct:   48 VLQIQKIRNVAAPKDNEESQAAPRMLRLQMTDGHISCTAVEFSYLSKISLNTPPGTKVKLSGAVDIKNGFLLLNDS-NTTVLGGEVEHLIEKWELQRSLSKHNRSNIGTEGGPPPFVPFGQKCVSHIQVDSRELDRRKTL-QVTMPVKPPNDNDEFEKQRTAAIAEVAKSKETKTFGGGGGGARSNLNMHAAGNRNREILQKEKANKSEGKHEGVYRELVDEKALRHITEMGFSKEASRQALMDNGNNLEAALNVLL 302          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A5K3EG35 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 6.815e-29
Identity = 129/518 (24.90%), Postives = 229/518 (44.21%), Query Frame = 2
Query:   32 LKNLKTEGWYINE--LKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNH-------PLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGN-KLNINVQEIRNFK-------------------ALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNIL--DKDXXXXXXXXXXXXXANED-------------EDDAWFDPAQYAAKVGLAVRPNT-TTSLAELM---------GTKXXXXXXXXXXXXHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKC----LKVKYIYNGEMIETNATSLKMVTGEKVLEHMVP 1411
            + NL   GW ++E  L + + L NE    ++      LLNTD++ YG  W++     +V+D                 V Q+ ++RN+A  + ++D + +         LLK  +TDG  T+  LD+ ++ KL+    PG K+  TG+   + G +IL  + N   L G V  L R   +++ ++  R S +   + PP F PFG+ + +  +     F                    A+ S+   ++ MGD+SDF  +R+    EI    Q  + ++ +  ++   F  GG SKF +E      ++D N+A L+S G+   E   AL+ +  ++ GA+D L  ++    L+I    +D+   R+ G G+ R  E+             EDD WFDP   A + GL  +P++    L+E M           K        +  S   +  + +G   LA +M G ++ A ++ +LP++     + V     G+      + L+ +   +V   M+P
Sbjct:    3 VTNLVPPGWLVSEKYLSVLSSLPNEAAALTH------LLNTDMREYGVPWLDSKKGKDVLDADGQ-------------VLQVVQIRNIAISQAEEDFQTSSDTAGGVSRLLKLTLTDGKHTISALDIDNSPKLSYETPPGTKIRLTGRIQVRVGFLILR-RNNFDVLKGSVDSLYREWLLTRDARGLRRSQQTGPDAPPPFVPFGSPEASAMIDSYNQFLNRLRSRNRRPEDTFDSLKLAMNSTTKVNSPMGDDSDFQQRRR----EILAEAQSAL-STGEAAAVQHTFRVGG-SKFQQERVNMAIERDRNLAQLVSMGYQPHEASVALEEAKNNLEGAIDRLTSRQFGRSLDIRRETRDHGRGRRGGGGRVRGPEEGRGQRGRGPHFDIEDDPWFDPVAAAEQSGLRGKPSSGPVPLSEFMENPPPSAVQSKKDIQWRTGVAAQSASQSTRLPQGTILLAPVMSGEFEAARLIGMLPDRVEGEHVAVVSYLQGDEEHVPVSMLRTMEKGEVTADMLP 494          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A068YBL2 (Ubiquitin associated translation elongation factor EF1B OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000961700 PE=4 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 9.630e-28
Identity = 139/515 (26.99%), Postives = 224/515 (43.50%), Query Frame = 2
Query:   53 GWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQD------NKNNHP-LLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPF----------------GNKLNINVQEIRNFKALPSSDNKDNIM-----GDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNI-------LDKDXXXXXXXXXXXXXANED-EDDAWFDPAQYAAKVGLAVRP-NTTTSLAELM----GTKXXXXXXXXXXXXHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLK-----VKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNS 1459
            GW I E K    L      PS Q +   LLNTD+K YG  WI      + +D                 V QI +VRN+A  E ++D      N  + P LL+  +TDG S +  LD+ ++ KL+    PG K+  +G+   + G +IL  + N   L G V  L R   +++ +K  R S R   + PP F  F                 N  N + +    F +L  + N  + +     GD SDF  KR+    EI    Q+ ++ ST    +  KF  GG SKF +   +   ++D N+A L+S G+   E + AL+ S   ++GA++ L+ ++ + H +        +D+     R+      + N D E+D  FD    A + GL  RP +    L+E M      +        +++S      +  G    A++M G Y+ A +V +LP+K        V Y+ + E  E   + L+ +   +V E ++P  P     RH+   +S
Sbjct:   10 GWSIAE-KFHRLLSQL---PSQQEVLVHLLNTDMKEYGVGWIESKRGKDSLDADGR-------------VLQIARVRNIAISEAEEDTQTGLGNTGSGPRLLRLTLTDGKSNISALDVDNSPKLSIETPPGTKIRLSGRVQIRIGFLILR-RNNFEVLQGSVSLLCREWLLTRDAKGARRSHRTGPDAPPPFVAFDTPEASAMIDSHNEFLDNLWNRDRRPKDTFDSLKLAMNATSRIGAASTGDESDFQQKRR----EIVADAQNSLSISTTAL-VQHKFKIGG-SKFQQARIDMAVERDLNLARLVSMGYQPHEANTALEESKNSLDGAINRLMVRQPDRHPSFPYGARSDVDRGRGHGRRGAERSRKFNLDIEEDPRFDSVAAAERAGLRGRPLSGPVPLSEFMDQALPQRPGPSKPLITKSSAPTRLRLAPGTVLQARVMSGDYEAARLVGLLPSKVAGERVALVAYLESEEQEEVPVSMLRTLDNTEVTEDILPVAPS-STPRHTETLHS 499          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A4S2LUH2 (UBA domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_004779 PE=4 SV=1)

HSP 1 Score: 128.642 bits (322), Expect = 1.927e-27
Identity = 132/457 (28.88%), Postives = 209/457 (45.73%), Query Frame = 2
Query:   32 LKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKN------NHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQE-----------IRN-------FKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTK-QDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNS-HLN----ILDKDXXXXXXXXXXXXXANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKXXXXXXXXXXXXHFNANMIHR-------GFNCLAQIMDGSYQQAVVV 1291
            L+ + T GW I++   +  LK  D   + Q    +LL++D++ +G  WI    K E +D                 + Q+ + RN+A P  D+D+ N         LL+ A+TDG STV  LD+ +N +L+ N  PG K+   G      G +IL  K ++  LGG V +LI+   ++K +K     GR     PP F PFG++   ++ E           +RN       FK    S   +     ++ F ++R+  + E+++TK ++   A + K     +F +GG SKF    AEK    D  +A L+S  +       ALK   GD   ALD LL K+ +S +LN     L    R   +  RG     ++EDD  FDP   AA  GL  R    T L++L+   +++   +    S+   +   R       G+  LAQ M G Y++A ++
Sbjct:  732 LEEVTTLGWSISQKSFSEQLKKVD-NGNRQEFLTLLLDSDLREFGVPWIADRKKQEQLD-------------AGGRIVQVVRCRNIAIPLADEDHTNVTVPYTGPRLLRLALTDGRSTVTALDVDNNERLSMNTLPGTKLRLMGTIPLCLGFLIL-QKQHVQVLGGNVANLIKEWTMTKLAKD--CEGRLRSGAPP-FVPFGSREASDLVESECGFLSSLNVMRNPEGGYDSFKTASKSTAAEQENEFDAGFMERRKDIIAEVQQTKFENSSAAGSVKKPAYMRFQTGG-SKFANLQAEKTQAYDEALAQLVSLNYPMPLAVSALKLHKGDYKAALDYLLAKQMSSANLNGRGVGLRSTRRRGGRPSRGGISGPDEEDDPRFDPVAAAAAAGLPRRSAGLTRLSDLLPVTAATHVNTLPSASNSRPSGSGRTLICLPVGYPILAQNMAGEYEEAQLI 1169          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A419PVL2 (Tudor domain-containing protein 3 OS=Clonorchis sinensis OX=79923 GN=TDRD3 PE=4 SV=1)

HSP 1 Score: 127.102 bits (318), Expect = 2.376e-27
Identity = 131/463 (28.29%), Postives = 209/463 (45.14%), Query Frame = 2
Query:   14 RQMNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKN------NHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQE-----------IRN-------FKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINAS-TDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNS-HLN----ILDKDXXXXXXXXXXXXXANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKXXXXXXXXXXXXHFNANMIHR-------GFNCLAQIMDGSYQQAVVV 1291
            R     L+ L T GW I++   +  LK  D   + +    +LL++D++ +G  WI    K E +D                 + Q+ + RN+A P  D+D+ N         LL+ A+TDG STV  LD+ +N +L+ N  PG K+   G      G +IL  K ++  LGG V +LI+   ++K +K     GR     PP F PFG+    ++ +           +RN       FK    S   +     ++ F ++R+  + E+++TK ++ +A+ + K     +F +GG SKF    AEK    D  +A L+S  +       ALK   GD   ALD LL K+ +S +LN     L    R   +  RG     ++EDD  FDP   AA  GL       T L++L+    ++   +    S+   ++  R       G   LAQ M G Y++A ++
Sbjct:    4 RHFQGTLEELTTLGWSISQKSFSEQLKKVD-NGNRREFLTLLLDSDLREFGVPWIADHKKQEQLDAGGR-------------IVQVVRCRNIAIPLADEDHTNLTGPYTGPRLLRLALTDGRSTVTALDVDNNERLSMNTPPGTKLRLMGTIPLCLGFLIL-QKQHVQVLGGNVANLIKEWTMTKLAKD--CEGRLRSGAPP-FVPFGSHEAADLVQSECRFLSSLNVMRNPEGGYDSFKTASKSTAAEKGNEFDAGFMERRKDIIAEVQQTKCENSSAADSVKKPAYMRFQTGG-SKFADLQAEKTQAYDEALAQLVSLNYPMPLAASALKLHKGDYKAALDYLLAKQISSTNLNGRGAGLRSTRRRGGRPSRGGISGPDEEDDPRFDPVAAAAAAGLPRHSAGLTRLSDLLPVTMTNHVNTAPSASNSRPSVCGRTPICLPVGCPILAQNMAGEYEEAQLI 447          
BLAST of Tudor domain-containing protein vs. TrEMBL
Match: A0A068WH24 (Ubiquitin associated translation elongation factor EF1B OS=Echinococcus granulosus OX=6210 GN=EgrG_000961700 PE=4 SV=1)

HSP 1 Score: 123.25 bits (308), Expect = 2.926e-26
Identity = 129/491 (26.27%), Postives = 214/491 (43.58%), Query Frame = 2
Query:  110 PSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQD------NKNNHP-LLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPF----------------GNKLNINVQEIRNFKALPSSDNKDNIM-----GDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNI-------LDKDXXXXXXXXXXXXXANED-EDDAWFDPAQYAAKVGLAVRP-NTTTSLAELMGTKXXXXXXXXXXXXHFNAN----MIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLK-----VKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHS 1444
            PS + +   LLNTD+K YG  WI      + +D                 V QI +VRN+A  E ++D      N  + P LL+  +TDG S +  LD+ ++ KL+    PG K+  +G+   + G +IL  + N   L G V  L R   +++ +K  R S R   + PP F  F                 N  N + +    F +L  + N  + +     GD SDF  KR+    EI    Q+ ++ ST    +  KF  GG SKF +   +   ++D N+A L+S G+   E + AL+ S  +++GA++ L+ ++ + H +        +++     R+      + N D E+D  FD    A + GL  RP +    L+E M                 ++      +  G    A++M G Y+ A +V +LP+K        V Y+ + E  E   + L+ +   +V E ++P  P     RH+
Sbjct:   25 PSQREVLAHLLNTDMKEYGVGWIESKRGKDSLDADGR-------------VLQIARVRNIAISEAEEDIQTGLGNTGSGPRLLRLTLTDGKSNISALDVDNSPKLSIETPPGTKIRLSGRVQIRIGFLILR-RNNFEVLQGSVSLLCREWLLTRDAKGARRSHRTGPDAPPPFVAFDTPEASAMVDSHNEFLDNLWNRDRRPKDTFDSLKLAMNATSRIDAASTGDESDFQQKRR----EIVADAQNSLSISTTAL-VQHKFKIGG-SKFQQAQIDMAVERDLNLAQLVSMGYQPHEANTALEESKNNLDGAINRLMVRQPDRHPSFPYGARSDVERGRGHGRRGAERSRKFNLDIEEDPRFDSVAAAGRAGLRGRPLSGPVPLSEFMDQALPQRPGPSKPLITTSSAPTRLRLAPGTVLQARVMSGDYEAARLVGLLPSKVAGERVALVAYLESEEQEEVPVSMLRTLDNTEVTEDILPVAPS-STPRHT 494          
BLAST of Tudor domain-containing protein vs. Ensembl Cavefish
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:103034277])

HSP 1 Score: 105.145 bits (261), Expect = 2.209e-23
Identity = 94/340 (27.65%), Postives = 160/340 (47.06%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-----DDINASTDKYSLLDKFHSGGTSKFLKETAEK-----------RDQKDSNVAY-LMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            M+++   L  EGWY+ E  +     +E  + +  +I  + LN+D++  G+S++     S  ++ L         +  C  V QI ++RNV+AP+ ++D++    +L+  +TDG +    L+ +  SK++ N  PG KV   G    K+G+ +L+D   I  LGG+V  +I    + +S      S  GA   PP F PFG K      ++ + +   K L SS N      +N +F  +R AA+ EI K+K+        NA ++  +    F +  T +  +E  EK           R+  D      +M  GF+     +AL  +N +V  AL+ LL
Sbjct:    1 MSELSAALGREGWYLTEEGIEECKSSEKEKVTVTDIINVALNSDLRPIGKSFLPADINSGRVEKL---------EGPC--VLQIQRIRNVSAPKENEDSQAAPRMLRVQMTDGQTMCTGLEFKHLSKISLNTPPGTKVKLLGTVQMKNGL-LLLDDSKIAVLGGEVDHMIEKWELQRSLAKHSRSNVGAEGGPPPFLPFGQKCLRQEEVDSRTLDQRKTLQSS-NAAKTASENDEFEKQRIAAIAEIAKSKEMRTFGGGGNAGSNLTNPGSSFKNRDTYQKRREEREKTWTESKPEGVYRELVDERALRDIMEMGFNKEAARQALLDNNNNVEVALNALL 327          
BLAST of Tudor domain-containing protein vs. Ensembl Cavefish
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:103034277])

HSP 1 Score: 105.145 bits (261), Expect = 2.417e-23
Identity = 94/340 (27.65%), Postives = 160/340 (47.06%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ-----DDINASTDKYSLLDKFHSGGTSKFLKETAEK-----------RDQKDSNVAY-LMSNGFSFFEVDKALKSSNGDVNGALDILL 976
            M+++   L  EGWY+ E  +     +E  + +  +I  + LN+D++  G+S++     S  ++ L         +  C  V QI ++RNV+AP+ ++D++    +L+  +TDG +    L+ +  SK++ N  PG KV   G    K+G+ +L+D   I  LGG+V  +I    + +S      S  GA   PP F PFG K      ++ + +   K L SS N      +N +F  +R AA+ EI K+K+        NA ++  +    F +  T +  +E  EK           R+  D      +M  GF+     +AL  +N +V  AL+ LL
Sbjct:    1 MSELSAALGREGWYLTEEGIEECKSSEKEKVTVTDIINVALNSDLRPIGKSFLPADINSGRVEKL---------EGPC--VLQIQRIRNVSAPKENEDSQAAPRMLRVQMTDGQTMCTGLEFKHLSKISLNTPPGTKVKLLGTVQMKNGL-LLLDDSKIAVLGGEVDHMIEKWELQRSLAKHSRSNVGAEGGPPPFLPFGQKCLRQEEVDSRTLDQRKTLQSS-NAAKTASENDEFEKQRIAAIAEIAKSKEMRTFGGGGNAGSNLTNPGSSFKNRDTYQKRREEREKTWTESKPEGVYRELVDERALRDIMEMGFNKEAARQALLDNNNNVEVALNALL 327          
BLAST of Tudor domain-containing protein vs. Ensembl Medaka
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:101155265])

HSP 1 Score: 98.5969 bits (244), Expect = 2.976e-21
Identity = 109/420 (25.95%), Postives = 186/420 (44.29%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPS----SKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQD------------------------DINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQ----KRTNSHLNILDKDXXXXXXXXXXXXXANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTK 1171
            M+ ++ +L  EGWY+ +  +   LK    + ++ +I  + L+TD++  G S I PS     K+E ++              C  V Q+ KVRN++AP+ +++++    +L+  +TDG +T   L+ +  SK++ N  PG KV   G    K+G ++L D  NI  LGG+V  ++    + +S      S  GA   PP F PFG K      ++ +E+   K L  + N      +N +F  +R AA+ E+ KTK+                         D N    +    +K  S     + +E  ++R  +D     LM  GF      +AL  +N +V  AL+ LL      R  S +   +K ++   +        NEDEDD            G+  RP+  ++L + + +K
Sbjct:    1 MSDLVDSLIKEGWYLTDEGIEE-LKGSAEKLTHSDIIHVALDTDLRPIG-SKILPSDINSGKTEKLEG------------PC--VLQVQKVRNISAPKDNEESQGAPRMLRLQMTDGHTTCVGLEFKHLSKISLNTPPGTKVKLLGTVQVKNGCLLLEDS-NILVLGGEVEHMVEKWELQRSLAKHSRSNIGAEGGPPPFVPFGQKCARKDEVDSRELDQRKTL-QTQNVVKSPDENDEFEKQRTAAIAEVAKTKEGPRSFGGGGNAGSNLSNAASSSRSRDANQQRRREDKFEKTESRPEGNY-RELVDERALRD-----LMEMGFDREAARQALLDNNNNVEVALNSLLTGSSGGRPGSTVAESNK-SQPRGRGKGRGRSRNEDEDD------------GVGGRPSGPSTLFDFLESK 383          
BLAST of Tudor domain-containing protein vs. Ensembl Medaka
Match: tdrd3 (tudor domain containing 3 [Source:NCBI gene;Acc:101155265])

HSP 1 Score: 97.4413 bits (241), Expect = 7.932e-21
Identity = 76/256 (29.69%), Postives = 130/256 (50.78%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPS----SKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKL----NINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQ 763
            M+ ++ +L  EGWY+ +  +   LK    + ++ +I  + L+TD++  G S I PS     K+E +            +  C  V Q+ KVRN++AP+ +++++    +L+  +TDG +T   L+ +  SK++ N  PG KV   G    K+G ++L D  NI  LGG+V  ++    + +S      S  GA   PP F PFG K      ++ +E+   K L  + N      +N +F  +R AA+ E+ KTK+
Sbjct:    1 MSDLVDSLIKEGWYLTDEGIEE-LKGSAEKLTHSDIIHVALDTDLRPIG-SKILPSDINSGKTEKL------------EGPC--VLQVQKVRNISAPKDNEESQGAPRMLRLQMTDGHTTCVGLEFKHLSKISLNTPPGTKVKLLGTVQVKNGCLLLEDS-NILVLGGEVEHMVEKWELQRSLAKHSRSNIGAEGGPPPFVPFGQKCARKDEVDSRELDQRKTL-QTQNVVKSPDENDEFEKQRTAAIAEVAKTKE 238          
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Match: SMESG000005854.1 (SMESG000005854.1)

HSP 1 Score: 911.368 bits (2354), Expect = 0.000e+0
Identity = 501/518 (96.72%), Postives = 503/518 (97.10%), Query Frame = 2
Query:    2 ILFKRQMNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDXXXXXXXXXXXXXANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKXXXXXXXXXXXXHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYXXXXXXXXXXXXXXXXXXXXXXXXFHHGY 1555
            ILFKRQMNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIK+ILLNTDIKHYGESWINPSSKSE               FQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDNRGNRKRGRGKGRANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKSSSDGRSDSQNSHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYNNYRGGSANRGRG+GNPNRRRGGRFHHGY
Sbjct:  235 ILFKRQMNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKKILLNTDIKHYGESWINPSSKSE---------------FQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDNRGNRKRGRGKGRANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKSSSDGRSDSQNSHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYNNYRGGSANRGRGQGNPNRRRGGRFHHGY 737          
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Match: SMESG000005854.1 (SMESG000005854.1)

HSP 1 Score: 902.123 bits (2330), Expect = 0.000e+0
Identity = 495/512 (96.68%), Postives = 497/512 (97.07%), Query Frame = 2
Query:   20 MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKRILLNTDIKHYGESWINPSSKSEVIDYLYN**IINFDQFQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDXXXXXXXXXXXXXANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKXXXXXXXXXXXXHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYXXXXXXXXXXXXXXXXXXXXXXXXFHHGY 1555
            MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIK+ILLNTDIKHYGESWINPSSKSE               FQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDNRGNRKRGRGKGRANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKSSSDGRSDSQNSHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYNNYRGGSANRGRG+GNPNRRRGGRFHHGY
Sbjct:    1 MNQILKNLKTEGWYINELKLTNYLKNEDIEPSYQNIKKILLNTDIKHYGESWINPSSKSE---------------FQCFGVFQINKVRNVAAPEVDQDNKNNHPLLKFAITDGVSTVHLLDLQSNSKLNRNVDPGCKVIFTGQSSFKSGMVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPFGNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQDDINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFEVDKALKSSNGDVNGALDILLQKRTNSHLNILDKDNRGNRKRGRGKGRANEDEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKSSSDGRSDSQNSHFNANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATSLKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYNNYRGGSANRGRGQGNPNRRRGGRFHHGY 497          
The following BLAST results are available for this feature:
BLAST of Tudor domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TDRD32.191e-1926.67tudor domain containing 3 [Source:HGNC Symbol;Acc:... [more]
TDRD31.787e-1127.04tudor domain containing 3 [Source:HGNC Symbol;Acc:... [more]
TDRD31.787e-1127.04tudor domain containing 3 [Source:HGNC Symbol;Acc:... [more]
TDRD31.787e-1127.04tudor domain containing 3 [Source:HGNC Symbol;Acc:... [more]
TDRD31.787e-1127.04tudor domain containing 3 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Y50D4C.39.184e-1729.86pep chromosome:WBcel235:V:939391:945244:-1 gene:WB... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Tdrd31.117e-1727.16gene:FBgn0036450 transcript:FBtr0075691[more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tdrd38.965e-1927.47tudor domain containing 3 [Source:NCBI gene;Acc:40... [more]
tdrd39.855e-1927.47tudor domain containing 3 [Source:NCBI gene;Acc:40... [more]
tdrd35.508e-1727.90tudor domain containing 3 [Source:NCBI gene;Acc:40... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a79.918e-1928.13solute carrier family 9 member A7 [Source:Xenbase;... [more]
slc9a71.185e-1828.13solute carrier family 9 member A7 [Source:Xenbase;... [more]
slc9a71.248e-1828.13solute carrier family 9 member A7 [Source:Xenbase;... [more]
slc9a71.377e-1828.13solute carrier family 9 member A7 [Source:Xenbase;... [more]
slc9a71.653e-1828.13solute carrier family 9 member A7 [Source:Xenbase;... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tdrd33.907e-2128.48tudor domain containing 3 [Source:MGI Symbol;Acc:M... [more]
Tdrd35.057e-2128.48tudor domain containing 3 [Source:MGI Symbol;Acc:M... [more]
Tdrd31.057e-2029.10tudor domain containing 3 [Source:MGI Symbol;Acc:M... [more]
Tdrd33.682e-1738.28tudor domain containing 3 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Tudor domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91W18|TDRD3_MOUSE3.537e-2028.48Tudor domain-containing protein 3 OS=Mus musculus ... [more]
sp|Q5ZMS6|TDRD3_CHICK7.047e-2025.45Tudor domain-containing protein 3 OS=Gallus gallus... [more]
sp|Q6P1U3|TDRD3_XENTR7.296e-1828.13Tudor domain-containing protein 3 OS=Xenopus tropi... [more]
sp|Q6NYG6|TDRD3_DANRE1.391e-1727.20Tudor domain-containing protein 3 OS=Danio rerio O... [more]
sp|Q2HJG4|TDRD3_BOVIN1.886e-1728.79Tudor domain-containing protein 3 OS=Bos taurus OX... [more]
back to top
BLAST of Tudor domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EG356.815e-2924.90Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068YBL29.630e-2826.99Ubiquitin associated translation elongation factor... [more]
A0A4S2LUH21.927e-2728.88UBA domain-containing protein OS=Opisthorchis feli... [more]
A0A419PVL22.376e-2728.29Tudor domain-containing protein 3 OS=Clonorchis si... [more]
A0A068WH242.926e-2626.27Ubiquitin associated translation elongation factor... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdrd32.209e-2327.65tudor domain containing 3 [Source:NCBI gene;Acc:10... [more]
tdrd32.417e-2327.65tudor domain containing 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tudor domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tdrd32.976e-2125.95tudor domain containing 3 [Source:NCBI gene;Acc:10... [more]
tdrd37.932e-2129.69tudor domain containing 3 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Tudor domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000005854.10.000e+096.72SMESG000005854.1[more]
SMESG000005854.10.000e+096.68SMESG000005854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025899 ID=SMED30025899|Name=Tudor domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1605bp
AATTCTTTTTAAAAGGCAAATGAATCAAATTCTTAAAAATTTAAAAACCG
AAGGATGGTATATTAATGAGTTAAAACTAACAAATTATTTGAAAAATGAA
GATATTGAACCGAGTTATCAAAATATAAAAAGAATTCTTCTCAATACTGA
TATTAAGCACTATGGGGAATCGTGGATTAATCCATCTTCAAAATCTGAGG
TTATAGACTATTTATATAATTAATAAATCATAAATTTTGATCAGTTTCAA
TGCTTTGGAGTTTTTCAGATCAATAAAGTCAGGAATGTAGCAGCACCAGA
GGTTGATCAAGATAACAAAAATAATCATCCATTATTAAAATTTGCAATAA
CTGACGGCGTGTCAACAGTTCATCTATTAGACTTACAATCAAATTCAAAG
CTTAATCGTAACGTTGATCCTGGTTGTAAGGTTATATTTACTGGACAATC
ATCATTTAAAAGTGGAATGGTAATCTTAATGGACAAAGTGAATATTACTT
GCCTTGGAGGAAAGGTTCTAGACCTAATTAGAGCGGAACATATCAGTAAA
AGCAGCAAAACCGATCGATTTTCAGGCCGTGGAGCATTAAACGACCCACC
GAAATTCACCCCTTTTGGGAATAAACTAAACATCAATGTCCAGGAAATTC
GAAATTTTAAGGCCTTACCAAGTAGTGACAACAAAGATAACATAATGGGA
GATAATTCAGATTTCGGTGATAAAAGGCAAGCAGCAGTTGATGAAATAAA
AAAAACGAAGCAGGATGATATAAATGCATCAACAGATAAATATAGCTTAT
TGGACAAATTTCACTCTGGAGGTACGTCTAAATTCCTGAAAGAAACTGCT
GAAAAACGAGATCAAAAAGATTCAAATGTGGCATATTTAATGTCAAATGG
ATTCAGTTTCTTCGAAGTCGACAAAGCATTAAAATCTAGTAATGGCGATG
TGAATGGTGCTCTTGATATTTTACTGCAAAAACGCACAAATTCTCATTTA
AATATATTGGACAAAGACAACAGAGGCAATAGAAAAAGAGGCCGTGGAAA
AGGTAGAGCAAATGAGGATGAAGATGATGCCTGGTTCGATCCGGCTCAAT
ATGCAGCAAAAGTGGGCCTAGCAGTGCGTCCGAACACAACCACCAGTCTG
GCAGAACTGATGGGAACTAAATCCAGTTCCGATGGCAGGTCTGATTCCCA
GAATAGTCATTTCAATGCCAACATGATTCACCGAGGCTTCAATTGCCTGG
CACAAATTATGGATGGATCGTATCAGCAGGCAGTTGTCGTCGATGTTTTG
CCGAATAAGTGCTTGAAGGTGAAATATATCTACAATGGGGAAATGATAGA
AACGAATGCGACATCGTTAAAGATGGTAACCGGAGAAAAAGTATTGGAAC
ATATGGTTCCGAATGTGCCTGATCCTCAGCTTGAACGTCATTCAACTGAT
TACAATAGTCAATCTTACAATAATTACCGCGGCGGTAGCGCTAATAGGGG
CCGAGGCCGAGGTAATCCTAATCGTAGAAGAGGAGGTCGATTTCATCACG
GATATTAATTTTATACCGTTAATTTTTCTTCAAATAAAATTTTATAAATT
CTTCC
back to top

protein sequence of SMED30025899-orf-1

>SMED30025899-orf-1 ID=SMED30025899-orf-1|Name=SMED30025899-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=364bp
MVILMDKVNITCLGGKVLDLIRAEHISKSSKTDRFSGRGALNDPPKFTPF
GNKLNINVQEIRNFKALPSSDNKDNIMGDNSDFGDKRQAAVDEIKKTKQD
DINASTDKYSLLDKFHSGGTSKFLKETAEKRDQKDSNVAYLMSNGFSFFE
VDKALKSSNGDVNGALDILLQKRTNSHLNILDKDNRGNRKRGRGKGRANE
DEDDAWFDPAQYAAKVGLAVRPNTTTSLAELMGTKSSSDGRSDSQNSHFN
ANMIHRGFNCLAQIMDGSYQQAVVVDVLPNKCLKVKYIYNGEMIETNATS
LKMVTGEKVLEHMVPNVPDPQLERHSTDYNSQSYNNYRGGSANRGRGRGN
PNRRRGGRFHHGY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR015940UBA
IPR013894RMI1_N
IPR009060UBA-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006397mRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015940Ubiquitin-associated domainSMARTSM00165uba_6coord: 134..171
e-value: 1.3E-4
score: 31.3
IPR015940Ubiquitin-associated domainPROSITEPS50030UBAcoord: 130..172
score: 11.342
NoneNo IPR availableGENE3DG3DSA:1.10.8.10coord: 116..194
e-value: 1.1E-6
score: 30.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..203
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..348
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 334..363
NoneNo IPR availableCDDcd14270UBAcoord: 138..167
e-value: 8.49187E-4
score: 34.2489
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 245..306
IPR009060UBA-like superfamilySUPERFAMILYSSF46934UBA-likecoord: 130..176