SMED30025898

Overview
NameSMED30025898
Smed IDSMED30025898
Length (bp)867
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025898 (SMED30025898) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025898 (SMED30025898) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025898

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30025898SMESG000051187.1 dd_Smed_v4_16909_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025898SMESG000051187.1 dd_Smed_v6_16909_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025898 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001486:45013..52651 +4270
Homology
BLAST of SMED30025898 vs. TrEMBL
Match: A0A5J4NY81 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0005698 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 5.832e-14
Identity = 29/81 (35.80%), Postives = 42/81 (51.85%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFE 381
            N   W  QS Q+KNADI++  +              N KG         T+P+S+ YRYH + CLS  ++K+Y+ E +RFE
Sbjct:  223 NLAFWIQQSFQLKNADILFLME--------------NDKGTYGWILFVVTMPISLFYRYHCTVCLSQCFNKLYEDETQRFE 289          

HSP 2 Score: 42.3578 bits (98), Expect = 5.832e-14
Identity = 20/42 (47.62%), Postives = 26/42 (61.90%), Query Frame = 3
Query:   12 LEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            LE+IQ  IQTH + D+F RCS        KPGR ++  L+GI
Sbjct:  181 LELIQILIQTHMIQDSFHRCSDKVKHQITKPGRQSIVALLGI 222          
BLAST of SMED30025898 vs. TrEMBL
Match: A0A5J4NC21 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0005650 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 6.696e-13
Identity = 30/85 (35.29%), Postives = 51/85 (60.00%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLR 393
            N  +W + S Q+K+ D+++     I   +F QD++  ++GL    F+   LP+ ML+RYHSS CL+  + ++Y+ E  R+E  LR
Sbjct:  268 NFSLWMIYSFQVKHNDVLF----RISWNKF-QDAD--LRGL--HMFVTVVLPMVMLFRYHSSVCLAISFVRIYEDEVTRYESMLR 343          

HSP 2 Score: 44.2838 bits (103), Expect = 6.696e-13
Identity = 19/45 (42.22%), Postives = 27/45 (60.00%), Query Frame = 3
Query:    3 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            S  LE+IQ  +QT+F+ D F RC +     + KPGRT + IL  +
Sbjct:  223 STLLELIQAMVQTYFIHDMFYRCCHHKIYQQTKPGRTVIVILSAL 267          
BLAST of SMED30025898 vs. TrEMBL
Match: A0A5J4P2A0 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0000801 PE=4 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 7.370e-13
Identity = 55/195 (28.21%), Postives = 92/195 (47.18%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSE----NNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLR---AGNTHKESQIMSEFMKKSTESGKQVSFENNDTKLL----------EDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLK 672
            N  +W + S Q+KN  I+           F Q++E    + ++GL +  F++  LP+ ML+RYHSS CL+    ++Y+ E  R+E  LR    G T        EF++K +   + + +E   + LL          ED   G+ +K  G  P  T    E    RR T   +E+A  ++ + E + +L ++ LK
Sbjct:  519 NFSLWMIYSFQVKNNSIL-----------FKQNAEAVEASGLQGLTI--FIRVVLPMVMLFRYHSSVCLAISVVRIYEDEVARYESMLRWVKQGTTR-------EFLQKQSFDFRHI-WETGGSSLLNTTKDVQLSSEDPVEGKLTKLDGT-PKQTTTKSEGHGGRRNTEFTLEVARTRLAAIEENHRLTEQKLK 691          

HSP 2 Score: 39.2762 bits (90), Expect = 7.370e-13
Identity = 17/45 (37.78%), Postives = 26/45 (57.78%), Query Frame = 3
Query:    3 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            S  LE++Q  +QT+F+ D F RC +     + KPGR  + IL  +
Sbjct:  474 SILLELMQVIVQTYFIHDMFYRCCHHEVYQQTKPGRAVIIILSAL 518          
BLAST of SMED30025898 vs. TrEMBL
Match: A0A419PT59 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CSKR_10723s PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 1.218e-12
Identity = 31/81 (38.27%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFE 381
            N  +W  QS Q+KNADII           FL  +E +  G ++      T+P+S+ YRYH + CLS  ++K+Y+ E +RFE
Sbjct:  433 NLALWIQQSFQLKNADII-----------FLLPNEKDSYGWIL---FVVTMPISLFYRYHCTVCLSQCFNKLYEDETQRFE 499          

HSP 2 Score: 36.5798 bits (83), Expect = 1.218e-12
Identity = 17/42 (40.48%), Postives = 25/42 (59.52%), Query Frame = 3
Query:   12 LEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            LE++Q  +QT+ + D F RCS        KPGR ++  L+GI
Sbjct:  391 LELLQIVVQTYMIQDCFHRCSDKLTHQIIKPGRQSIVALLGI 432          
BLAST of SMED30025898 vs. TrEMBL
Match: A0A4S2LXR8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005503 PE=4 SV=1)

HSP 1 Score: 65.0846 bits (157), Expect = 1.280e-12
Identity = 31/81 (38.27%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFE 381
            N  +W  QS Q+KNADII           FL  +E +  G ++      T+P+S+ YRYH + CLS  ++K+Y+ E +RFE
Sbjct:  398 NLALWIQQSFQLKNADII-----------FLLPNEKDSYGWIL---FVVTMPISLFYRYHCTVCLSQCFNKLYEDETQRFE 464          

HSP 2 Score: 36.5798 bits (83), Expect = 1.280e-12
Identity = 17/42 (40.48%), Postives = 25/42 (59.52%), Query Frame = 3
Query:   12 LEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            LE++Q  +QT+ + D F RCS        KPGR ++  L+GI
Sbjct:  356 LELLQIVVQTYMIQDCFHRCSDKLTHQIIKPGRQSIVALLGI 397          
BLAST of SMED30025898 vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 465.307 bits (1196), Expect = 7.770e-163
Identity = 223/225 (99.11%), Postives = 223/225 (99.11%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESGKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 813
            N GMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTES KQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI
Sbjct:  358 NTGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 582          

HSP 2 Score: 98.5969 bits (244), Expect = 5.949e-23
Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 3
Query:    3 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI
Sbjct:  313 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 357          
BLAST of SMED30025898 vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 467.233 bits (1201), Expect = 1.699e-162
Identity = 223/225 (99.11%), Postives = 223/225 (99.11%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESGKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 813
            N GMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTES KQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI
Sbjct:  434 NTGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 658          

HSP 2 Score: 98.9821 bits (245), Expect = 5.933e-23
Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 3
Query:    3 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI
Sbjct:  389 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 433          
BLAST of SMED30025898 vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 467.233 bits (1201), Expect = 5.447e-162
Identity = 223/225 (99.11%), Postives = 223/225 (99.11%), Query Frame = 1
Query:  139 NAGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESGKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 813
            N GMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTES KQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI
Sbjct:  479 NTGMWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 703          

HSP 2 Score: 98.9821 bits (245), Expect = 5.849e-23
Identity = 45/45 (100.00%), Postives = 45/45 (100.00%), Query Frame = 3
Query:    3 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 137
            SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI
Sbjct:  434 SGFLEVIQNSIQTHFLIDAFRRCSYSNYQMENKPGRTALAILMGI 478          
BLAST of SMED30025898 vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 441.81 bits (1135), Expect = 1.866e-156
Identity = 213/215 (99.07%), Postives = 214/215 (99.53%), Query Frame = 1
Query:  169 QIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESGKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 813
            +IKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTES KQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI
Sbjct:  166 RIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 380          
BLAST of SMED30025898 vs. Planmine SMEST
Match: SMESG000051187.1 (SMESG000051187.1)

HSP 1 Score: 442.195 bits (1136), Expect = 5.878e-156
Identity = 213/215 (99.07%), Postives = 214/215 (99.53%), Query Frame = 1
Query:  169 QIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESGKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 813
            +IKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTES KQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI
Sbjct:  211 RIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPLSMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKSTESVKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATIKNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGKGYFNRKEELYNKTSDTESAYSI 425          
The following BLAST results are available for this feature:
BLAST of SMED30025898 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NY815.832e-1435.80Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A5J4NC216.696e-1335.29Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A5J4P2A07.370e-1328.21Uncharacterized protein OS=Paragonimus westermani ... [more]
A0A419PT591.218e-1238.27Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4S2LXR81.280e-1238.27Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of SMED30025898 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025898 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051187.17.770e-16399.11SMESG000051187.1[more]
SMESG000051187.11.699e-16299.11SMESG000051187.1[more]
SMESG000051187.15.447e-16299.11SMESG000051187.1[more]
SMESG000051187.11.866e-15699.07SMESG000051187.1[more]
SMESG000051187.15.878e-15699.07SMESG000051187.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025898 ID=SMED30025898|Name=SMED30025898|organism=Schmidtea mediterranea sexual|type=transcript|length=867bp
TCTCTGGCTTCTTGGAAGTTATTCAAAACTCAATACAAACTCATTTTTTA
ATTGATGCTTTCAGAAGATGTAGTTATTCAAATTATCAAATGGAGAATAA
ACCCGGGCGGACCGCTTTGGCAATCCTAATGGGAATAAAACGCAGGAATG
TGGTTTCTACAAAGCCTTCAAATAAAAAATGCGGATATCATATACTACAA
AGATCATCATATCAAAATGTATAGATTCCTACAGGATAGTGAGAATAATG
TAAAAGGATTGTTGGTACGTTTTTTCTTACAAACGACCTTACCATTGTCC
ATGCTTTATCGTTATCATTCATCAGCATGTTTGTCAGATATATACTCAAA
AATGTATCAAACCGAAGCAAAGAGATTCGAAATTCATCTAAGAGCTGGAA
ATACACACAAAGAGTCTCAAATAATGTCAGAATTCATGAAAAAATCAACC
GAAAGTGGTAAACAGGTTTCATTTGAAAATAACGATACAAAGCTGTTAGA
AGACACTTCACGTGGACAAAGATCTAAATCAGTTGGGATGATTCCTGCAA
ATACGATAGAACACGTGGAAAGAAAAATGAACAGACGAGCAACTATAAAA
AACATGGAAATAGCTCACAAACAAATTATTTCAACCGAATTATCCTTACA
ATTATTCAAAAAAAATTTAAAGCCAAAACCAGCTGATCAATACAAAACCA
AAAGTAGAGAAAAAAGAATGCCAAATATCCAGAATATGGTGGGAAAGGGA
TATTTTAACAGAAAAGAAGAATTGTATAACAAAACTAGCGACACTGAAAG
TGCATATTCAATCTAATTGAATTTATATTTTACTTGATATAAATATAATC
TTCATCTTTGAAACTTA
back to top

protein sequence of SMED30025898-orf-1

>SMED30025898-orf-1 ID=SMED30025898-orf-1|Name=SMED30025898-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MWFLQSLQIKNADIIYYKDHHIKMYRFLQDSENNVKGLLVRFFLQTTLPL
SMLYRYHSSACLSDIYSKMYQTEAKRFEIHLRAGNTHKESQIMSEFMKKS
TESGKQVSFENNDTKLLEDTSRGQRSKSVGMIPANTIEHVERKMNRRATI
KNMEIAHKQIISTELSLQLFKKNLKPKPADQYKTKSREKRMPNIQNMVGK
GYFNRKEELYNKTSDTESAYSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR004878Otopetrin
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004878OtopetrinPFAMPF03189Otopetrincoord: 2..65
e-value: 3.8E-12
score: 45.8
IPR004878OtopetrinPANTHERPTHR21522OTOPETRINcoord: 3..67
NoneNo IPR availablePANTHERPTHR21522:SF58coord: 3..67