AP_endonuc_2 domain-containing protein

Overview
NameAP_endonuc_2 domain-containing protein
Smed IDSMED30025895
Length (bp)984
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of AP_endonuc_2 domain-containing protein (SMED30025895) t-SNE clustered cells

Violin plots show distribution of expression levels for AP_endonuc_2 domain-containing protein (SMED30025895) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of AP_endonuc_2 domain-containing protein (SMED30025895) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for AP_endonuc_2 domain-containing protein (SMED30025895) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025895

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025895SMESG000044611.1 SMESG000044612.1 SmedASXL_015135SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025895SMESG000044612.1 SMESG000044611.1 dd_Smed_v4_1939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025895SMESG000044612.1 SMESG000044611.1 dd_Smed_v4_1939_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
whole organismSMED30025895SMESG000044611.1 Contig22562newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30025895SMESG000044611.1 Contig22562uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30025895SMESG000044612.1 SMESG000044611.1 Contig38443newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30025895SMESG000044612.1 SMESG000044611.1 Contig38443newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30025895SMESG000044612.1 SMESG000044611.1 Contig38443uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30025895SMESG000044612.1 SMESG000044611.1 Contig38443uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Celegans
Match: apn-1 (DNA-(apurinic or apyrimidinic site) lyase [Source:UniProtKB/Swiss-Prot;Acc:Q10002])

HSP 1 Score: 291.582 bits (745), Expect = 1.232e-96
Identity = 139/301 (46.18%), Postives = 204/301 (67.77%), Query Frame = 1
Query:   34 SNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIK 936
            +  ++R+    + +K S   +K+ +G HVS + GL +A YNA   G ++FA+F+RNQR W+ K +S+E+V  +     +    LD +VPHGSYL+N GSP+ + L+KSR   ++E +  +KLGI  +NFHPGST G   + E +  IA++++  + K+EN+I++LE M+ QG++IGG FEEL+ II +V  K+R+GVC+DTCH FA G+ +     YE +M+ F   +G  YLKAIH+NDSKGD G+ LDRHE IG+GKIG   FE ++ND RL  IPMILETP E  Y E++ ++Y + K
Sbjct:   97 AQKKSRETVGVEVLKTSEGSSKM-LGFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPMSEEVVENWWKAVRETNFPLDQIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMTTIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIFAGGYDIRTQKAYEEVMKNFGEVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAFELLMNDNRLDGIPMILETP-EGKYPEEMMIMYNMDK 395          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Celegans
Match: apn-1 (DNA-(apurinic or apyrimidinic site) lyase [Source:UniProtKB/Swiss-Prot;Acc:Q10002])

HSP 1 Score: 291.582 bits (745), Expect = 1.232e-96
Identity = 139/301 (46.18%), Postives = 204/301 (67.77%), Query Frame = 1
Query:   34 SNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIK 936
            +  ++R+    + +K S   +K+ +G HVS + GL +A YNA   G ++FA+F+RNQR W+ K +S+E+V  +     +    LD +VPHGSYL+N GSP+ + L+KSR   ++E +  +KLGI  +NFHPGST G   + E +  IA++++  + K+EN+I++LE M+ QG++IGG FEEL+ II +V  K+R+GVC+DTCH FA G+ +     YE +M+ F   +G  YLKAIH+NDSKGD G+ LDRHE IG+GKIG   FE ++ND RL  IPMILETP E  Y E++ ++Y + K
Sbjct:   97 AQKKSRETVGVEVLKTSEGSSKM-LGFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPMSEEVVENWWKAVRETNFPLDQIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMTTIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIFAGGYDIRTQKAYEEVMKNFGEVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAFELLMNDNRLDGIPMILETP-EGKYPEEMMIMYNMDK 395          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-141o9.10 (si:ch211-141o9.10 [Source:ZFIN;Acc:ZDB-GENE-130603-5])

HSP 1 Score: 303.523 bits (776), Expect = 2.074e-102
Identity = 144/292 (49.32%), Postives = 202/292 (69.18%), Query Frame = 1
Query:   70 SIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGEN--IYKEQIDLLYKLIKE 939
            + K      K +IGAHVSIS G++KA  ++  +G  AFALFL +QR W+   +  +   KF+    ++     +++PHGSYL+NCGSPK+D+  KS+ + ++EL  CD LG+  FNFHPG+    +S  + ++ IA ++N    ++  VI +LENMS QG TIGG+F EL+ II +V +K+R+GVCLDTCHAFAAG+ +  P G   M++EFD  +GL YL+A+HLNDSKG  G+HLDRHEDIG G+IG+  F ++VN+PRL NIP+ILETPG     Y EQI+LLY L ++
Sbjct:    2 ACKRKMKPQKKYIGAHVSISGGIWKAVESSVAMGGHAFALFLGSQRSWTRPVLDSKAAVKFQQACAEHGFDPVHILPHGSYLMNCGSPKEDVFSKSQAMLVDELSRCDALGLSQFNFHPGAAMD-SSPEKCMEKIAQAINHAHQQTPAVITVLENMSGQGSTIGGQFSELKGIIDRVRDKSRVGVCLDTCHAFAAGYDISPPGGVNNMLDEFDRVVGLHYLRAVHLNDSKGKLGSHLDRHEDIGHGQIGITAFREIVNEPRLDNIPLILETPGRQGFEYAEQIELLYSLCEK 292          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-141o9.10 (si:ch211-141o9.10 [Source:ZFIN;Acc:ZDB-GENE-130603-5])

HSP 1 Score: 303.523 bits (776), Expect = 2.074e-102
Identity = 144/292 (49.32%), Postives = 202/292 (69.18%), Query Frame = 1
Query:   70 SIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGEN--IYKEQIDLLYKLIKE 939
            + K      K +IGAHVSIS G++KA  ++  +G  AFALFL +QR W+   +  +   KF+    ++     +++PHGSYL+NCGSPK+D+  KS+ + ++EL  CD LG+  FNFHPG+    +S  + ++ IA ++N    ++  VI +LENMS QG TIGG+F EL+ II +V +K+R+GVCLDTCHAFAAG+ +  P G   M++EFD  +GL YL+A+HLNDSKG  G+HLDRHEDIG G+IG+  F ++VN+PRL NIP+ILETPG     Y EQI+LLY L ++
Sbjct:    2 ACKRKMKPQKKYIGAHVSISGGIWKAVESSVAMGGHAFALFLGSQRSWTRPVLDSKAAVKFQQACAEHGFDPVHILPHGSYLMNCGSPKEDVFSKSQAMLVDELSRCDALGLSQFNFHPGAAMD-SSPEKCMEKIAQAINHAHQQTPAVITVLENMSGQGSTIGGQFSELKGIIDRVRDKSRVGVCLDTCHAFAAGYDISPPGGVNNMLDEFDRVVGLHYLRAVHLNDSKGKLGSHLDRHEDIGHGQIGITAFREIVNEPRLDNIPLILETPGRQGFEYAEQIELLYSLCEK 292          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Zebrafish
Match: BX323878.4 (si:ch211-141o9.10 [Source:NCBI gene;Acc:558198])

HSP 1 Score: 304.679 bits (779), Expect = 3.605e-102
Identity = 142/281 (50.53%), Postives = 200/281 (71.17%), Query Frame = 1
Query:  103 FIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGEN--IYKEQIDLLYKLIKE 939
            +IGAHVSIS G++KA  ++  +G  AFALFL +QR W+   +  +   KF+    ++     +++PHGSYL+NCGSPK+D+  KS+ + ++EL  CD LG+  FNFHPG+    +S  + ++ IA ++N    ++  VI +LENMS QG TIGG+F EL+ II +V +K R+GVCLDTCHAFAAG+ +  P G + M++EFD  +GL YL+A+HLNDSKG  G+HLDRHEDIG G+IG+  F+++VN+PRL NIP+ILETPG     Y EQI+LLY L ++
Sbjct:   58 YIGAHVSISGGIWKAVESSVAMGGHAFALFLGSQRSWTRPVLDSKAAVKFQQACAEHGFDPVHILPHGSYLMNCGSPKEDVFSKSQAMLVDELSRCDALGLSQFNFHPGAAMD-SSPEKCMEKIAQAINHAHQQTPAVITVLENMSGQGSTIGGQFSELKGIIDRVRDKTRVGVCLDTCHAFAAGYDISPPGGVKNMLDEFDRVVGLHYLRAVHLNDSKGKLGSHLDRHEDIGHGQIGITAFQEIVNEPRLDNIPLILETPGRQGFEYAEQIELLYSLCEK 337          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Xenopus
Match: nubp2 (nucleotide binding protein 2 [Source:Xenbase;Acc:XB-GENE-999229])

HSP 1 Score: 290.812 bits (743), Expect = 2.761e-96
Identity = 140/280 (50.00%), Postives = 193/280 (68.93%), Query Frame = 1
Query:   94 NKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETP-GENIYKEQIDLLYKL 930
            +K F+GAHVSI  G++ A   A  IGA A  +FL +QR W  K++ D+   +F+   ++       ++PH  YL+N GSPK D+LQKS+ + ++EL  C +LG+  +N HPGS  G  S ++ ++LIAD +NL  ++   VIV+LENMSCQG T+GG+FEEL+ II  V +K+RIGVCLDTCHAFAAG  L K  G E M++EF+  +GL +LKAIHLNDS+G+ G  LDRHE+IG G IGL  F  ++N+PR   IPMILETP   + + ++I+LLY L
Sbjct:   70 SKKFVGAHVSIQGGIWNAVLVARQIGASAIGMFLGSQRTWKSKALDDKAAERFQRTCKELGFKSRYILPHSPYLMNLGSPKPDVLQKSQAMLVDELHKCHQLGLTMYNIHPGSCVGAMSVSKCLELIADGINLAHAQVPGVIVVLENMSCQGSTVGGRFEELRGIIDLVVDKSRIGVCLDTCHAFAAGHDLSKKAGLEHMLDEFNKVVGLSFLKAIHLNDSQGELGCKLDRHENIGHGHIGLEGFRHVMNEPRFNGIPMILETPLSSDDHAKEIELLYSL 349          
BLAST of AP_endonuc_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q10002|APN1_CAEEL (DNA-(apurinic or apyrimidinic site) lyase OS=Caenorhabditis elegans OX=6239 GN=apn-1 PE=2 SV=2)

HSP 1 Score: 291.582 bits (745), Expect = 1.568e-95
Identity = 139/301 (46.18%), Postives = 204/301 (67.77%), Query Frame = 1
Query:   34 SNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIK 936
            +  ++R+    + +K S   +K+ +G HVS + GL +A YNA   G ++FA+F+RNQR W+ K +S+E+V  +     +    LD +VPHGSYL+N GSP+ + L+KSR   ++E +  +KLGI  +NFHPGST G   + E +  IA++++  + K+EN+I++LE M+ QG++IGG FEEL+ II +V  K+R+GVC+DTCH FA G+ +     YE +M+ F   +G  YLKAIH+NDSKGD G+ LDRHE IG+GKIG   FE ++ND RL  IPMILETP E  Y E++ ++Y + K
Sbjct:   97 AQKKSRETVGVEVLKTSEGSSKM-LGFHVSAAGGLEQAIYNARAEGCRSFAMFVRNQRTWNHKPMSEEVVENWWKAVRETNFPLDQIVPHGSYLMNAGSPEAEKLEKSRLAMLDECQRAEKLGITMYNFHPGSTVGKCEKEECMTTIAETIDFVVEKTENIILVLETMAGQGNSIGGTFEELKFIIDKVKVKSRVGVCIDTCHIFAGGYDIRTQKAYEEVMKNFGEVVGWNYLKAIHINDSKGDVGSKLDRHEHIGQGKIGKAAFELLMNDNRLDGIPMILETP-EGKYPEEMMIMYNMDK 395          
BLAST of AP_endonuc_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7M8B4|END4_WOLSU (Probable endonuclease 4 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) OX=273121 GN=nfo PE=3 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 1.389e-89
Identity = 129/281 (45.91%), Postives = 186/281 (66.19%), Query Frame = 1
Query:   97 KIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIKE 939
            K F+GAHVS S G+  A  NA  IGAKAFALF +NQRQWS K++ +E + +FK+  +   I+   V+PH SYL+N G P +  L KSR  F++E+R C++LG+   NFHPGS  G  S +E +  +A+S+NL +  +  VI ++EN + QG  +G  F  L  II QV +K+R+G+C+DTCH F+AG+ +   + YE  M   D ++G  YLK +HLNDSK    + +DRH  +G G++G+  FE ++NDPR+  IP+ILET  E ++ ++I LLY LIKE
Sbjct:    2 KKFVGAHVSASGGVRNAPLNAQKIGAKAFALFTKNQRQWSAKALEEEEIEQFKANLKAAGIAPSCVLPHDSYLINLGHPGEAELAKSREAFLDEMRRCEQLGLDRLNFHPGSHLGAISESECLSRVAESINLALEATSGVIAVIENTAGQGSNVGYDFRHLGEIIDQVHDKSRVGICIDTCHMFSAGYDIRTREAYEASMAILDREVGWCYLKGMHLNDSKVKFQSRVDRHHSLGMGELGIAPFEFIMNDPRMDGIPLILETIDEALWAQEITLLYSLIKE 282          
BLAST of AP_endonuc_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q30PH2|END4_SULDN (Probable endonuclease 4 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) OX=326298 GN=nfo PE=3 SV=1)

HSP 1 Score: 266.929 bits (681), Expect = 2.232e-87
Identity = 127/277 (45.85%), Postives = 185/277 (66.79%), Query Frame = 1
Query:  103 FIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLI 933
            F+GAHVS S G+F A  NA  IGAKAFALF +NQRQWS K    E + KFK+  EK+ I   +V+PH SYL+N G P+ D  +KS + F++E++ C  LG+   NFHPGS     S  E +  I++S+N  + K+  V +++EN + QG  +G KFE L  II +V +K+R+GVC+DTCH F+AG+ +   + Y++   EFD  +G KYL  +H+NDSK   G+H+DRH  +G G+IGL  F+ ++ND R+ +IP+ILET  ++I+ ++I LLY  +
Sbjct:    4 FVGAHVSASGGVFNAVENAQKIGAKAFALFTKNQRQWSAKEFDSETIDKFKTALEKSGILPRHVLPHDSYLINLGHPELDAREKSLDAFLDEVQRCSLLGLDRLNFHPGSHLKKISEDECLANISESMNRVLDKTSGVSLVIENTAGQGSNLGWKFEHLAQIIDKVEDKSRVGVCIDTCHMFSAGYDIRTREAYDKSWGEFDKIVGFKYLMGMHINDSKAKFGSHVDRHNSLGVGEIGLDTFKFIMNDERMDDIPLILETIDDSIWAQEIRLLYSFV 280          
BLAST of AP_endonuc_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A4SDE2|END4_CHLPM (Probable endonuclease 4 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) OX=290318 GN=nfo PE=3 SV=1)

HSP 1 Score: 265.003 bits (676), Expect = 1.046e-86
Identity = 127/275 (46.18%), Postives = 173/275 (62.91%), Query Frame = 1
Query:  106 IGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKL 930
            +GAHVSI+ G+  A  NA  IGAKAFALF RNQRQW    +    V  F+   E       +++PH SYL+N G+P  D L++SR  FIEE+   + LG+   NFHPGS        E + LIADS+NL I  ++ V  ++EN + QG  +G +FE L+ II ++ +++RIGVCLDTCH FA+G+ L   +  ER  EEFD  +G++YLK +HLND+    G+ LDRH  IGKG IG+  F  ++  P    IP+ILETP    +KE+I+LLY L
Sbjct:    4 VGAHVSIAGGVENAPLNATAIGAKAFALFTRNQRQWHSPPLQKASVDAFRRHCEAGGFDARHILPHDSYLINLGNPDPDKLERSRKAFIEEMERAETLGLVLLNFHPGSHLNAIGEEECLGLIADSINLAIKATDRVTAVIENTAGQGTNLGSRFEHLRAIIDRIEDRSRIGVCLDTCHLFASGYDLGTAEAAERTFEEFDRTVGMQYLKGMHLNDALRPLGSRLDRHACIGKGMIGIEGFRYIMQSPLFEEIPLILETPDSEGWKEEIELLYSL 278          
BLAST of AP_endonuc_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|A6LB99|END4_PARD8 (Probable endonuclease 4 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=nfo PE=3 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.029e-86
Identity = 123/278 (44.24%), Postives = 181/278 (65.11%), Query Frame = 1
Query:  103 FIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIK 936
            ++GAHVS   G+  A  NA+ IGAKAFALF RNQRQW  + +  + +  FK   E        ++PH SYL+N G+P  + LQKSR+ F++E+  C++LG+K  NFHPGS  G       +  IA+S+N+ ++++  V  ++EN + QG  +G  FE++  II++V +K+R+GVCLDT H  AAG+ +  P+G+      FD  +G  YL+ +HLNDSK + G+ +DRHE IGKG +GL  F  ++ DPR  N+P+ILETP E ++ E+I LLYK +K
Sbjct:    3 YVGAHVSAVGGVENAPVNAHEIGAKAFALFTRNQRQWKSQPLKADSIHLFKERCEAYGYDPGCILPHDSYLINLGNPDAEGLQKSRDAFLDEMTRCEQLGLKMLNFHPGSHLGKMEVDTCLSRIAESINITLAQTSGVCAVIENTAGQGSNLGYTFEQIAYIINEVEDKSRVGVCLDTAHTLAAGYDIKTPEGFAETFRHFDEVVGFSYLRGMHLNDSKKELGSRVDRHESIGKGLMGLDTFRMIMVDPRFDNMPLILETPDEALWPEEIQLLYKQLK 280          
BLAST of AP_endonuc_2 domain-containing protein vs. TrEMBL
Match: A0A1S3HJ88 (uncharacterized protein LOC106155683 OS=Lingula unguis OX=7574 GN=LOC106155683 PE=3 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 9.441e-109
Identity = 160/280 (57.14%), Postives = 204/280 (72.86%), Query Frame = 1
Query:   97 KIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIK 936
            K F+GAHVSI+ GL KA  NA  IGA+A  +FL++QRQW+ K + D+   KF+   E+++     ++PHGSYLLNCGSP  + LQKSR   I+ELR C+KLG+  +NFHPGSTCG  S  + +  IA S+N    K++ VI ++ENM  QG+TIGG FEEL+ II +V +KAR+GVCLDTCHAFAAG+ L+   G+ RMMEEF   IG KYLKA+H+NDSKG CG HLDRHE+IGKG IGL  F + +NDP+L NIP ILETP E  Y ++ID LY L+K
Sbjct:   66 KKFVGAHVSIAGGLHKAVENAVDIGAEAIGMFLKSQRQWASKPLDDKAAEKFREACEEHQFPPHLILPHGSYLLNCGSPNPETLQKSRESLIDELRRCEKLGLSLYNFHPGSTCGEISVEQCLDRIATSINQAHRKTKYVITVIENMCGQGNTIGGSFEELRGIIDRVEDKARVGVCLDTCHAFAAGYDLNTAQGFHRMMEEFKKIIGFKYLKALHVNDSKGKCGCHLDRHENIGKGHIGLEGFRRFMNDPKLNNIPFILETP-ECDYGKEIDKLYSLVK 344          
BLAST of AP_endonuc_2 domain-containing protein vs. TrEMBL
Match: A0A2B4SLS6 (Putative endonuclease 4 OS=Stylophora pistillata OX=50429 GN=nfo PE=3 SV=1)

HSP 1 Score: 330.872 bits (847), Expect = 4.118e-108
Identity = 152/279 (54.48%), Postives = 205/279 (73.48%), Query Frame = 1
Query:  103 FIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETP--GENIYKEQIDLLYKLI 933
             IGAHVSI  GL  A   A  IGAKAFA+FLR+QRQW+ K + D+    FK    K   S  +++PHG YL+NCGSP ++ L KSR   ++EL+ C++LG+  +NFHPGSTCG  +  E+I  IA+S+N    +++ V+ +LENMSCQG+TIGGKFEEL+ II QV +K+R+GVCLDTCHAFAAG+ +    G+E+MM+EF+  +GL+YL+ +HLNDSKG+ G HLDRHE+IGKGKIG+  F +++ DPR   IPMILETP   ENIY+++I  LY ++
Sbjct:  121 LIGAHVSIGGGLHNAVSEALSIGAKAFAMFLRSQRQWASKPLQDKDAELFKEACSKANFSPRSILPHGIYLMNCGSPDEETLSKSRVTLVDELKRCERLGLSLYNFHPGSTCGKITVEESIARIAESINQAHQETKYVVTVLENMSCQGNTIGGKFEELRDIIDQVQDKSRVGVCLDTCHAFAAGYDIASEKGFEKMMDEFETTVGLQYLQGVHLNDSKGELGCHLDRHENIGKGKIGVEAFRRVMRDPRFNGIPMILETPYVSENIYQKEIKQLYAMM 399          
BLAST of AP_endonuc_2 domain-containing protein vs. TrEMBL
Match: A0A293L652 (AP_endonuc_2 domain-containing protein (Fragment) OS=Ornithodoros erraticus OX=265619 PE=3 SV=1)

HSP 1 Score: 328.946 bits (842), Expect = 4.813e-107
Identity = 163/317 (51.42%), Postives = 216/317 (68.14%), Query Frame = 1
Query:   16 VKRLKPSNDENRKDTPT---------KSIKLSFDRNK---IFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKL 930
            VKR  P + E   + P          K++K+   +      F+GAHVSIS GL  A   A  +GA++F LFLR+QRQW+ K ++ E   +F+    +   +   ++PHGSYLLNCGSP  ++LQKSR   ++EL+ C+ LG+ Y+NFHPGSTCG  S  E I  IA+S+NL   ++  VI ++ENM  QGHTIGG F EL+ II +V +K+RIG+CLDTCHAFAAG+ L K +G+E MM +FD  IGL YLKA+HLNDSKG  G+HLDRHE+IGKG IGL  F +++NDPRL ++PMILETP E  Y ++I LLY L
Sbjct:  119 VKRELPPSPEKDSEQPPHKKVAPNNLKAVKVKGSKKPGQCKFVGAHVSISGGLEHAVTRAVELGAQSFGLFLRSQRQWACKPLTQESANRFREACHEYNFAPHQILPHGSYLLNCGSPDSEVLQKSRATLVDELKRCEMLGLVYYNFHPGSTCGTISIEECIDRIAESINLAHRETSYVIAVVENMCRQGHTIGGDFRELKGIIDRVKDKSRIGICLDTCHAFAAGYDLSKEEGFEEMMSDFDSIIGLSYLKAVHLNDSKGKLGSHLDRHENIGKGSIGLEGFRRIMNDPRLDHLPMILETP-EMDYAKEIVLLYSL 434          
BLAST of AP_endonuc_2 domain-containing protein vs. TrEMBL
Match: A0A2R5LNS3 (Putative ap endonuclease (Fragment) OS=Ornithodoros turicata OX=34597 PE=3 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 6.227e-107
Identity = 163/320 (50.94%), Postives = 221/320 (69.06%), Query Frame = 1
Query:    7 FTMVKRLK-PSNDENRKDTPTKSIKLSFDRN-KI----------FIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKL 930
             + VKR + PS +++ ++TP K +  +  R  K+          F+GAHVS+S GL  A   A  +GA++F LFLR+QRQW+ K ++ E   +F+    +   +   ++PHGSYLLNCGS   ++LQKSR   ++EL+ C+ LG+ Y+NFHPGSTCG  S  E I  IA+S+NL   ++  VI ++ENM  QGHT+GG F EL+ II +V +K+RIGVCLDTCHAFAAG+ L K +G+E MM +FD  IGL YLKA+HLNDSKG  G+HLDRHE+IGKG IGL  F +++NDPRL ++PMILETP E  Y ++I LLY L
Sbjct:  118 ISKVKRERLPSAEKDNEETPPKKMASNNARTAKVKGSRKPGQCKFVGAHVSVSGGLEHAVTRAVELGAQSFGLFLRSQRQWACKPLTQETANRFRDACHEYNFAPHQILPHGSYLLNCGSSDPEVLQKSRATLVDELKRCEMLGLVYYNFHPGSTCGAISVEECIDRIAESINLAHKETSYVIAVVENMCRQGHTVGGDFRELKAIIDRVKDKSRIGVCLDTCHAFAAGYDLSKEEGFEEMMSDFDTIIGLPYLKALHLNDSKGKLGSHLDRHENIGKGSIGLEGFRRIMNDPRLDHLPMILETP-EMDYAKEIVLLYSL 436          
BLAST of AP_endonuc_2 domain-containing protein vs. TrEMBL
Match: A0A443SBE2 (Putative endonuclease 4-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_11387 PE=3 SV=1)

HSP 1 Score: 323.939 bits (829), Expect = 1.083e-106
Identity = 166/319 (52.04%), Postives = 213/319 (66.77%), Query Frame = 1
Query:   28 KPSNDENRKDTP---TKSIKLSFDR---------NKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETP-----GENIYKEQIDLLYKLI 933
            K S    R  +P   TK + +S  R         NK+FIGAHVSIS GL+K+   A  I  +AF LFL NQR+W  K +      +F+   E +      +VPH SYL+NCGSPK+D L KSRNL ++ ++ C+ LGI  +NFHPGSTCG  SR E I+ IADS+N     S  VI ++ENMS QGHTIGG F E++ II  V +K+R+GVCLDTCHAFAAG+ + K  G+++M++EF+ +IG +YLKAIHLNDSKG  G HLDRHE+IGKG IGL  F+ +VN+P+   IPMILETP      E IY+E+I LLY LI
Sbjct:    4 KKSAKRQRTQSPNSETKELNVSSARDKDWFQTSENKVFIGAHVSISGGLYKSILEATSINGQAFGLFLCNQRRWDVKPLDKSDAEQFRKVCEAHGYPSHLMVPHASYLVNCGSPKEDNLAKSRNLMLDGVKRCEALGIDLYNFHPGSTCGDISRKECIERIADSINFVHKNSNKVITVIENMSKQGHTIGGDFSEIRDIIKHVDDKSRVGVCLDTCHAFAAGYDISKESGFKKMIQEFETEIGFQYLKAIHLNDSKGKVGCHLDRHENIGKGYIGLDGFKLIVNEPKFKGIPMILETPVTADNEEYIYREEIKLLYSLI 322          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-141o9.10 (probable endonuclease 4 [Source:NCBI gene;Acc:103025298])

HSP 1 Score: 296.975 bits (759), Expect = 1.879e-99
Identity = 143/284 (50.35%), Postives = 197/284 (69.37%), Query Frame = 1
Query:   97 KIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTE-TIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGEN--IYKEQIDLLYKLIKE 939
            K +IGAHVSIS G++KA  ++  +G ++FALFL +QR W   ++      KF+    ++     +++PHGSYL+NCGSPK D+  KS+ + ++EL  C  LG+  FNFHPG++  I S TE  I+ IA ++N   +++  VI +LENMS QG T+GG+F EL+ II +V +K R+GVCLDTCHAFAAG+ + K  G + M+++FD ++GL YL+A HLNDSKG  G HLDRHEDIG G IG+  F  +VN+PRL NIP+ILETPG     Y EQI LLY L ++
Sbjct:   52 KKYIGAHVSISGGIWKAVEDSVELGGRSFALFLGSQRTWQRPALDQSAAVKFQKACAQHGFDPTHILPHGSYLMNCGSPKQDVFTKSQAMLVDELSRCSALGLTQFNFHPGAS--IDSSTEKCIERIAQAINHAHNQTSAVITVLENMSGQGSTVGGQFNELKRIIDRVRDKTRVGVCLDTCHAFAAGYDISKAGGVKSMLDQFDQEVGLHYLRAFHLNDSKGILGCHLDRHEDIGCGNIGISAFRDIVNEPRLDNIPLILETPGRPGFEYAEQIKLLYSLCED 333          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: si:ch211-141o9.10 (si:ch211-141o9.10 [Source:ZFIN;Acc:ZDB-GENE-130603-5])

HSP 1 Score: 164.081 bits (414), Expect = 1.270e-50
Identity = 78/138 (56.52%), Postives = 105/138 (76.09%), Query Frame = 1
Query:  523 LLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENI--YKEQIDLLYKL 930
            ++ENM  QGHT+GG+FEEL+ II  V +++RIGVCLDTCHAFAAG+ +   +G +  ++EF   +GLK+LKA+HLNDSKG  G HLDRHE++G+G IGL  F  ++N P+L ++PMILETPG     Y+E+I LLY L
Sbjct:   12 VIENMCGQGHTVGGQFEELRGIIDLVADQSRIGVCLDTCHAFAAGYDVSSQEGVQHTLDEFHRIVGLKFLKAVHLNDSKGKLGCHLDRHENVGRGHIGLEGFRAIMNAPQLDHLPMILETPGSLSFGYEEEIALLYSL 149          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Yeast
Match: APN1 (Major apurinic/apyrimidinic endonuclease; 3'-repair diesterase; involved in repair of DNA damage by oxidation and alkylating agents; also functions as a 3'-5' exonuclease to repair 7,8-dihydro-8-oxodeoxyguanosine; genetically interacts with NTG1 to maintain mitochondrial genome integrity [Source:SGD;Acc:S000001597])

HSP 1 Score: 201.445 bits (511), Expect = 1.227e-62
Identity = 101/268 (37.69%), Postives = 162/268 (60.45%), Query Frame = 1
Query:   94 NKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSE-AEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGEN 894
            +K   GAH+S + G+  +  NA   G  +FA+FL++ R+W     + E + KFK   A  N   L +V+PHG Y +N  +P  +  +KS   F+++L  C++LGI  +N HPGST     + + +K +A  +N  I +++ V ++LENM+  G+ +G    +L+ +I  + +K+RIGVC+DTCH FAAG+ +   + +    +EF+  IG KYL A+HLNDSK   G + D HE +G+G +G+ +F  + +   L  IP++LETP EN
Sbjct:   13 SKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPRKWVSPQYTQEEIDKFKKNCATYNYNPLTDVLPHGQYFINLANPDREKAEKSYESFMDDLNRCEQLGIGLYNLHPGSTLKGDHQLQ-LKQLASYLNKAIKETKFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKSRIGVCIDTCHTFAAGYDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHERLGQGYLGIDVFRMIAHSEYLQGIPIVLETPYEN 279          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO33510 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS16])

HSP 1 Score: 321.242 bits (822), Expect = 4.008e-110
Identity = 151/281 (53.74%), Postives = 202/281 (71.89%), Query Frame = 1
Query:  100 IFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGE--NIYKEQIDLLYKLIK 936
            +FIGAHVSI+ GL+KA +NA  IGAKAFA+FLR+QRQW+ K + D+    F    +    +   ++PHG YL+N GSP D+ L KSR + +EEL+ C+KLG+  +NFHPGSTCG  +  + I+ I +S+N   ++++ V+ ++ENMSCQGHTIGGKFEEL  II  V +K+R+GVC+DTCHAFAAG  +    GYE +M+ FD  +GLKYLKAIHLNDSKG  G HLDRHE+IG+G +G   F +++ DPRL  IPMILETP E  N Y  +I +LY + +
Sbjct:    1 MFIGAHVSIAGGLYKAVHNAVQIGAKAFAMFLRSQRQWNSKPLDDKTAELFIEACKSEGFAPSTILPHGIYLMNLGSPDDETLTKSRAVLVEELQRCEKLGLTLYNFHPGSTCGKITVQDCIERIGESINKAHAQTKKVVTVIENMSCQGHTIGGKFEELSDIIDLVRDKSRVGVCIDTCHAFAAGHDISTDKGYEEVMDNFDKIVGLKYLKAIHLNDSKGKLGCHLDRHENIGQGSLGKATFHRIMVDPRLNGIPMILETPCEADNTYMREIKMLYSMTE 281          
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Medaka
Match: si:ch211-141o9.10 (probable endonuclease 4 [Source:NCBI gene;Acc:101166169])

HSP 1 Score: 297.745 bits (761), Expect = 9.025e-100
Identity = 141/305 (46.23%), Postives = 206/305 (67.54%), Query Frame = 1
Query:   40 DENRKDTPTKSIKLSFD---RNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGEN--IYKEQIDLLYKLIKE 939
            +E+ ++T  K+ +   D   + K +IGAHV I  G++KA  +   +G  +FALFL +QR W   ++      KF+ +   +     ++VPHGSYL+NCGSPK+D+  KS+ L ++EL  C  LG++ +NFHPGS+ G  +  + ++ IA ++N    +  +V+ +LENMS QG T+GGKF EL+ II +V +++R+GVCLDTCHAF+AG+ L    G + M+++FD ++G  YLKA+HLNDSKG  G HLDRHED+GKG IG+  F  +VN+PRL NIP+ILETPG     Y EQI+LL+ L +E
Sbjct:   20 EEDSQNTERKADEEEGDGRRKKKKYIGAHVGIQGGVWKAVESCLQMGGTSFALFLGSQRSWKRPALDPSAAEKFRVQCSSHGFDPAHIVPHGSYLMNCGSPKEDVFAKSQELLVDELGRCHMLGLRLYNFHPGSSLGTITTEQCVEKIAGAINHAHQQIPDVVTVLENMSGQGSTVGGKFSELRGIIDRVRDQSRVGVCLDTCHAFSAGYDLAAEGGVKAMLDQFDQEVGRHYLKAVHLNDSKGQLGCHLDRHEDVGKGNIGISAFRDIVNEPRLDNIPLILETPGRPGFEYAEQIELLHSLCEE 324          
BLAST of AP_endonuc_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000044611.1 (SMESG000044611.1)

HSP 1 Score: 633.254 bits (1632), Expect = 0.000e+0
Identity = 307/310 (99.03%), Postives = 308/310 (99.35%), Query Frame = 1
Query:   13 MVKRLKPSNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIKEI 942
            MVKRLKPSNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFK+EAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGG FEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFD KIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIKEI
Sbjct:    1 MVKRLKPSNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNANVIGAKAFALFLRNQRQWSFKSISDEMVAKFKAEAEKNKISLDNVVPHGSYLLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTETIKLIADSVNLGISKSENVIVLLENMSCQGHTIGGNFEELQMIISQVTNKARIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDSKIGLKYLKAIHLNDSKGDCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQIDLLYKLIKEI 310          
The following BLAST results are available for this feature:
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
apn-11.232e-9646.18DNA-(apurinic or apyrimidinic site) lyase [Source... [more]
apn-11.232e-9646.18DNA-(apurinic or apyrimidinic site) lyase [Source... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-141o9.102.074e-10249.32si:ch211-141o9.10 [Source:ZFIN;Acc:ZDB-GENE-130603... [more]
si:ch211-141o9.102.074e-10249.32si:ch211-141o9.10 [Source:ZFIN;Acc:ZDB-GENE-130603... [more]
BX323878.43.605e-10250.53si:ch211-141o9.10 [Source:NCBI gene;Acc:558198][more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nubp22.761e-9650.00nucleotide binding protein 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q10002|APN1_CAEEL1.568e-9546.18DNA-(apurinic or apyrimidinic site) lyase OS=Caeno... [more]
sp|Q7M8B4|END4_WOLSU1.389e-8945.91Probable endonuclease 4 OS=Wolinella succinogenes ... [more]
sp|Q30PH2|END4_SULDN2.232e-8745.85Probable endonuclease 4 OS=Sulfurimonas denitrific... [more]
sp|A4SDE2|END4_CHLPM1.046e-8646.18Probable endonuclease 4 OS=Chlorobium phaeovibrioi... [more]
sp|A6LB99|END4_PARD82.029e-8644.24Probable endonuclease 4 OS=Parabacteroides distaso... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3HJ889.441e-10957.14uncharacterized protein LOC106155683 OS=Lingula un... [more]
A0A2B4SLS64.118e-10854.48Putative endonuclease 4 OS=Stylophora pistillata O... [more]
A0A293L6524.813e-10751.42AP_endonuc_2 domain-containing protein (Fragment) ... [more]
A0A2R5LNS36.227e-10750.94Putative ap endonuclease (Fragment) OS=Ornithodoro... [more]
A0A443SBE21.083e-10652.04Putative endonuclease 4-like protein OS=Leptotromb... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-141o9.101.879e-9950.35probable endonuclease 4 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-141o9.101.270e-5056.52si:ch211-141o9.10 [Source:ZFIN;Acc:ZDB-GENE-130603... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
APN11.227e-6237.69Major apurinic/apyrimidinic endonuclease; 3'-repai... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO335104.008e-11053.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-141o9.109.025e-10046.23probable endonuclease 4 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of AP_endonuc_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000044611.10.000e+099.03SMESG000044611.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025895 ID=SMED30025895|Name=AP_endonuc_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=984bp
GAATGATTTACTATGGTTAAGAGATTAAAACCATCAAATGATGAAAACCG
AAAAGATACTCCGACTAAATCTATTAAATTGTCCTTTGATCGTAATAAAA
TATTTATCGGAGCCCATGTTTCAATATCAAATGGGTTATTTAAAGCATTT
TATAATGCAAATGTAATAGGCGCTAAAGCATTTGCTTTGTTTCTCAGAAA
TCAAAGGCAATGGTCATTTAAGTCTATTTCTGATGAAATGGTTGCTAAGT
TCAAGTCAGAAGCTGAAAAAAATAAGATTTCATTAGATAACGTTGTACCA
CATGGAAGTTATTTATTAAATTGCGGATCTCCAAAAGATGATATTCTGCA
AAAAAGTCGTAATTTATTTATCGAAGAACTTCGAACATGTGATAAATTGG
GAATTAAATACTTCAATTTTCATCCCGGCTCAACCTGCGGAATAGCATCA
AGGACAGAAACAATTAAACTGATTGCTGACAGTGTTAATTTAGGAATATC
CAAATCTGAAAATGTTATAGTTCTCCTAGAAAATATGTCATGCCAGGGCC
ACACGATCGGGGGAAAATTCGAAGAGTTACAAATGATTATTTCCCAAGTG
ACAAACAAGGCTCGGATTGGAGTTTGCCTTGATACGTGTCACGCATTTGC
TGCTGGGTTCCCGCTACACAAGCCCGATGGATATGAGAGAATGATGGAGG
AATTCGACTTGAAAATTGGATTGAAATATCTCAAAGCGATCCATTTGAAT
GATTCGAAAGGCGACTGCGGTAACCATCTCGATCGGCACGAGGATATTGG
CAAAGGAAAAATCGGATTGGGTTTATTTGAACAAATGGTCAACGATCCTC
GACTAATGAACATTCCGATGATTCTAGAAACTCCGGGAGAAAATATATAC
AAAGAACAAATTGATTTATTATATAAATTAATTAAAGAAATATAATTGCA
AAATTGTATTCTCTATAAAATAAATTATAGTTTG
back to top

protein sequence of SMED30025895-orf-1

>SMED30025895-orf-1 ID=SMED30025895-orf-1|Name=SMED30025895-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=311bp
MVKRLKPSNDENRKDTPTKSIKLSFDRNKIFIGAHVSISNGLFKAFYNAN
VIGAKAFALFLRNQRQWSFKSISDEMVAKFKSEAEKNKISLDNVVPHGSY
LLNCGSPKDDILQKSRNLFIEELRTCDKLGIKYFNFHPGSTCGIASRTET
IKLIADSVNLGISKSENVIVLLENMSCQGHTIGGKFEELQMIISQVTNKA
RIGVCLDTCHAFAAGFPLHKPDGYERMMEEFDLKIGLKYLKAIHLNDSKG
DCGNHLDRHEDIGKGKIGLGLFEQMVNDPRLMNIPMILETPGENIYKEQI
DLLYKLIKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036237Xyl_isomerase-like_sf
IPR013022Xyl_isomerase-like_TIM-brl
IPR018246AP_endonuc_F2_Zn_BS
IPR001719AP_endonuc_2
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0008270zinc ion binding
GO:0003906DNA-(apurinic or apyrimidinic site) lyase activity
GO:0008081phosphoric diester hydrolase activity
GO:0008311double-stranded DNA 3'-5' exodeoxyribonuclease activity
GO:0016829lyase activity
GO:00170053'-tyrosyl-DNA phosphodiesterase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006281DNA repair
GO:0006284base-excision repair
GO:0006974cellular response to DNA damage stimulus
GO:0090305nucleic acid phosphodiester bond hydrolysis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005739mitochondrion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001719AP endonuclease 2SMARTSM00518ap2real3coord: 33..309
e-value: 2.8E-109
score: 379.0
IPR001719AP endonuclease 2TIGRFAMTIGR00587TIGR00587coord: 34..306
e-value: 1.7E-99
score: 330.5
IPR001719AP endonuclease 2PANTHERPTHR21445ENDONUCLEASE IV ENDODEOXYRIBONUCLEASE IVcoord: 8..310
IPR001719AP endonuclease 2PROSITEPS51432AP_NUCLEASE_F2_4coord: 31..310
score: 106.604
IPR001719AP endonuclease 2CDDcd00019AP2Eccoord: 34..308
e-value: 1.72449E-92
score: 274.197
NoneNo IPR availableGENE3DG3DSA:3.20.20.150coord: 32..311
e-value: 7.4E-104
score: 348.7
NoneNo IPR availablePANTHERPTHR21445:SF0SI:CH211-141O9.10coord: 8..310
IPR013022Xylose isomerase-like, TIM barrel domainPFAMPF01261AP_endonuc_2coord: 52..269
e-value: 3.7E-33
score: 114.7
IPR018246AP endonuclease 2, zinc binding sitePROSITEPS00731AP_NUCLEASE_F2_3coord: 245..261
IPR018246AP endonuclease 2, zinc binding sitePROSITEPS00730AP_NUCLEASE_F2_2coord: 205..212
IPR018246AP endonuclease 2, zinc binding sitePROSITEPS00729AP_NUCLEASE_F2_1coord: 99..107
IPR036237Xylose isomerase-like superfamilySUPERFAMILYSSF51658Xylose isomerase-likecoord: 33..310