Mucolipin-3 like protein

Overview
NameMucolipin-3 like protein
Smed IDSMED30025889
Length (bp)2356
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Mucolipin-3 like protein (SMED30025889) t-SNE clustered cells

Violin plots show distribution of expression levels for Mucolipin-3 like protein (SMED30025889) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Mucolipin-3 like protein (SMED30025889) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Mucolipin-3 like protein (SMED30025889) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025889

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025889SMESG000015162.1 PL08005B2E01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025889SMESG000015162.1 PL06014B2E11ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30025889SMESG000015162.1 dd_Smed_v4_3616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025889SMESG000015162.1 dd_Smed_v4_3616_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30025889SMESG000015162.1 dd_Smed_v4_3616_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30025889SMESG000015162.1 dd_Smed_v6_3616_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30025889SMESG000015162.1 dd_Smed_v4_3616_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Mucolipin-3 like protein vs. Ensembl Human
Match: MCOLN2 (mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357])

HSP 1 Score: 213.001 bits (541), Expect = 1.989e-59
Identity = 152/486 (31.28%), Postives = 269/486 (55.35%), Query Frame = 3
Query:  129 RYSINNLQLNED----QERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--DNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQA-----EMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            R ++ N   + D    +E +R DL+++FM+P EK+RA+  +P K+ L ++K+++VT Q+V F  +N   V+F E +  +FKHLFL  +  + E       +   ++Y  ED Y S+ +A+  Y++L+   +G   YG   DN   L +C  +Y+ G +FP N T +   +  ++C  +     + S+K  D K       F ++F +LL+ +++F ++ I L++    E PDC  F   I+FDN  H+G++K+   +     E    N   ST         KN   +L  D   ++  + SLIL +RS++   +  K+   FF  +    +  +D+W++  G  Y ++ I D++ I G+ILKM+   +  K++  + LC+ FLG    L  + ++RY  YF   ++L+ T++ ++P +LRF  C+ ++YL ++  GWI+LGPYH KF  +++   CLFSL+ GDDM+ T + I   + +V++FS+
Sbjct:   22 RLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDE------DDYSCSVYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLD--LQDLSKKPPDWKN---SSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQ--------KNAQYVLVFDAFVIVICLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFING-WYVLVIISDLMTIIGSILKME---IKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVWLFSR 484          
BLAST of Mucolipin-3 like protein vs. Ensembl Human
Match: MCOLN2 (mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357])

HSP 1 Score: 211.846 bits (538), Expect = 2.838e-59
Identity = 149/470 (31.70%), Postives = 263/470 (55.96%), Query Frame = 3
Query:  165 QERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--DNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQA-----EMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +E +R DL+++FM+P EK+RA+  +P K+ L ++K+++VT Q+V F  +N   V+F E +  +FKHLFL  +  + E       +   ++Y  ED Y S+ +A+  Y++L+   +G   YG   DN   L +C  +Y+ G +FP N T +   +  ++C  +     + S+K  D K       F ++F +LL+ +++F ++ I L++    E PDC  F   I+FDN  H+G++K+   +     E    N   ST         KN   +L  D   ++  + SLIL +RS++   +  K+   FF  +    +  +D+W++  G  Y ++ I D++ I G+ILKM+   +  K++  + LC+ FLG    L  + ++RY  YF   ++L+ T++ ++P +LRF  C+ ++YL ++  GWI+LGPYH KF  +++   CLFSL+ GDDM+ T + I   + +V++FS+
Sbjct:   10 EECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDE------DDYSCSVYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLD--LQDLSKKPPDWKN---SSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQ--------KNAQYVLVFDAFVIVICLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFING-WYVLVIISDLMTIIGSILKME---IKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVWLFSR 456          
BLAST of Mucolipin-3 like protein vs. Ensembl Human
Match: MCOLN3 (mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358])

HSP 1 Score: 211.075 bits (536), Expect = 7.482e-59
Identity = 157/478 (32.85%), Postives = 265/478 (55.44%), Query Frame = 3
Query:  126 QRYSINNLQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIP--ILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            Q+ S +   L EDQ  MRR L++ FMNP EK+ A+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  +    +          +A+Y   D Y  + +A+  Y +L + ++G ++Y         + +C  +Y+ G I+P N T+    E    C  ++P      E          + N T+DF++LL  +L F +++I L++    E PDC  F + I FDN  H+G++K+ L  +++   C     S SI    KNT  ++  D   ++  ++SLIL  RS+I   Q  ++   FF  H +  + +SD+ ++  G  Y +I I DIL I G+ILKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T++ A+P ++RF  C+ ++YL +   GWI+LGPYH KFR+++    CLFSL+ GDDM+ T + +   + +V++FS+
Sbjct:   24 QQTSPSEELLLEDQ--MRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMD--------DTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEP-----DEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQ---KNTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNG-WYIMIIISDILTIIGSILKME---IQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSR 479          
BLAST of Mucolipin-3 like protein vs. Ensembl Human
Match: MCOLN1 (mucolipin 1 [Source:HGNC Symbol;Acc:HGNC:13356])

HSP 1 Score: 206.068 bits (523), Expect = 9.384e-57
Identity = 148/478 (30.96%), Postives = 251/478 (52.51%), Query Frame = 3
Query:  174 MRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY---GLD---NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDI------KPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSI------SISLMIK-NTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHS---NTVVYIFSQ 1541
            +RR L+Y FM+P +K+RAKG  P K++L VVK+++VTVQ++LF  +N   V+F E +  +F+HLFL  +           ++  FA Y  E  Y ++ +A++ Y  L   ++G Y+Y   G D   N   L LC  YY  G + P N T+      + +C  +       P  S+    +  S  Y   KN T+ F+KL+   + F +++I L+S   +E PDC  F + I FDN  H+G++ + L+ +     C    PS+      S  L+     +L+  +  L+ +   L         +   W++  +       ++  + W       Y ++   D+L ISGTI+K+    +  K++  + +C+  LG    L  + ++RY ++F   +IL+ T+RVA+P ++RF  C  ++YL +   GWI+LGPYH+KFR++     CLFSL+ GDDM+VT + +      +++V++FSQ
Sbjct:   41 LRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLAVTFREENTIAFRHLFLLGYSDG--------ADDTFAAYTREQLYQAIFHAVDQYLALPDVSLGRYAYVRGGGDPWTNGSGLALCQRYYHRGHVDPANDTFDIDPMVVTDCIQVDPPERPPPPPSDDLTLLESSSSY---KNLTLKFHKLVNVTIHFRLKTINLQSLINNEIPDCYTFSVLITFDNKAHSGRIPISLETQAHIQEC--KHPSVFQHGDNSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVGFMWRQRGRVISLWERLEFVNGW-------YILLVTSDVLTISGTIMKIG---IEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHNYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGRSSLVWLFSQ 495          
BLAST of Mucolipin-3 like protein vs. Ensembl Human
Match: MCOLN3 (mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358])

HSP 1 Score: 162.155 bits (409), Expect = 4.256e-42
Identity = 115/360 (31.94%), Postives = 198/360 (55.00%), Query Frame = 3
Query:  480 NYYKLEHEAIGPYSYGLDNIP--ILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
             Y +L + ++G ++Y         + +C  +Y+ G I+P N T+    E    C  ++P      E          + N T+DF++LL  +L F +++I L++    E PDC  F + I FDN  H+G++K+ L  +++   C     S SI    KNT  ++  D   ++  ++SLIL  RS+I   Q  ++   FF  H +  + +SD+ ++  G  Y +I I DIL I G+ILKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T++ A+P ++RF  C+ ++YL +   GWI+LGPYH KFR+++    CLFSL+ GDDM+ T + +   + +V++FS+
Sbjct:   76 QYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEP-----DEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQ---KNTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNG-WYIMIIISDILTIIGSILKME---IQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSR 423          
BLAST of Mucolipin-3 like protein vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.815 bits (486), Expect = 5.969e-52
Identity = 149/486 (30.66%), Postives = 254/486 (52.26%), Query Frame = 3
Query:  156 NEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--------------DNIPILTLCIVYYRYGEIFPYNHTYSFSQ---ETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTI---DFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDR--FTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFS 1538
             E  ER+RR L++ FMNP EKW+ +  LP K++L V+K++ VT+Q++LF+E   + V F+E + T  +H FL  W    + L YPP+ G +++Y  +     +++ + +YY + +++   +SY +              ++IP + + I       +    + +   +      +N T+ +      S+     ++ L  +  T    D  K+      F +R+I       D+ P+C +  ++I FDNS H GQ+ V L   ++  N         +       L+   DI  LI  +LSLIL  R+LI  +    KT  +F N +   I ++D+   F  + Y +I + D L+I GT+ K+   ++  +D D   FTL + FLG G  L ++ ++RYF +F + +IL+ T++ + P ++RF  C+ +LY  F + GW+I+GPY +KFRT+  S   LFSL+ GDDM+ T   IN SNTV+ +F 
Sbjct:   43 RETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAV--RDILATRGITFLPEDALKISTVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLD-FLNLWYVMIVVNDALIIIGTVAKI---SIEFQDFDNSLFTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVIKVFG 522          
BLAST of Mucolipin-3 like protein vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.815 bits (486), Expect = 5.969e-52
Identity = 149/486 (30.66%), Postives = 254/486 (52.26%), Query Frame = 3
Query:  156 NEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--------------DNIPILTLCIVYYRYGEIFPYNHTYSFSQ---ETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTI---DFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDR--FTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFS 1538
             E  ER+RR L++ FMNP EKW+ +  LP K++L V+K++ VT+Q++LF+E   + V F+E + T  +H FL  W    + L YPP+ G +++Y  +     +++ + +YY + +++   +SY +              ++IP + + I       +    + +   +      +N T+ +      S+     ++ L  +  T    D  K+      F +R+I       D+ P+C +  ++I FDNS H GQ+ V L   ++  N         +       L+   DI  LI  +LSLIL  R+LI  +    KT  +F N +   I ++D+   F  + Y +I + D L+I GT+ K+   ++  +D D   FTL + FLG G  L ++ ++RYF +F + +IL+ T++ + P ++RF  C+ +LY  F + GW+I+GPY +KFRT+  S   LFSL+ GDDM+ T   IN SNTV+ +F 
Sbjct:   43 RETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAV--RDILATRGITFLPEDALKISTVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLD-FLNLWYVMIVVNDALIIIGTVAKI---SIEFQDFDNSLFTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVIKVFG 522          
BLAST of Mucolipin-3 like protein vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.815 bits (486), Expect = 1.308e-51
Identity = 149/485 (30.72%), Postives = 254/485 (52.37%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--------------DNIPILTLCIVYYRYGEIFPYNHTYSFSQ---ETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTI---DFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDR--FTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFS 1538
            E  ER+RR L++ FMNP EKW+ +  LP K++L V+K++ VT+Q++LF+E   + V F+E + T  +H FL  W    + L YPP+ G +++Y  +     +++ + +YY + +++   +SY +              ++IP + + I       +    + +   +      +N T+ +      S+     ++ L  +  T    D  K+      F +R+I       D+ P+C +  ++I FDNS H GQ+ V L   ++  N         +       L+   DI  LI  +LSLIL  R+LI  +    KT  +F N +   I ++D+   F  + Y +I + D L+I GT+ K+   ++  +D D   FTL + FLG G  L ++ ++RYF +F + +IL+ T++ + P ++RF  C+ +LY  F + GW+I+GPY +KFRT+  S   LFSL+ GDDM+ T   IN SNTV+ +F 
Sbjct:   44 ETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAV--RDILATRGITFLPEDALKISTVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLD-FLNLWYVMIVVNDALIIIGTVAKI---SIEFQDFDNSLFTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVIKVFG 522          
BLAST of Mucolipin-3 like protein vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.815 bits (486), Expect = 1.308e-51
Identity = 149/485 (30.72%), Postives = 254/485 (52.37%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--------------DNIPILTLCIVYYRYGEIFPYNHTYSFSQ---ETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTI---DFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDR--FTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFS 1538
            E  ER+RR L++ FMNP EKW+ +  LP K++L V+K++ VT+Q++LF+E   + V F+E + T  +H FL  W    + L YPP+ G +++Y  +     +++ + +YY + +++   +SY +              ++IP + + I       +    + +   +      +N T+ +      S+     ++ L  +  T    D  K+      F +R+I       D+ P+C +  ++I FDNS H GQ+ V L   ++  N         +       L+   DI  LI  +LSLIL  R+LI  +    KT  +F N +   I ++D+   F  + Y +I + D L+I GT+ K+   ++  +D D   FTL + FLG G  L ++ ++RYF +F + +IL+ T++ + P ++RF  C+ +LY  F + GW+I+GPY +KFRT+  S   LFSL+ GDDM+ T   IN SNTV+ +F 
Sbjct:   44 ETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAV--RDILATRGITFLPEDALKISTVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLD-FLNLWYVMIVVNDALIIIGTVAKI---SIEFQDFDNSLFTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVIKVFG 522          
BLAST of Mucolipin-3 like protein vs. Ensembl Celegans
Match: cup-5 (CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666])

HSP 1 Score: 191.045 bits (484), Expect = 1.323e-51
Identity = 149/486 (30.66%), Postives = 254/486 (52.26%), Query Frame = 3
Query:  156 NEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--------------DNIPILTLCIVYYRYGEIFPYNHTYSFSQ---ETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTI---DFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLS-LDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDR--FTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFS 1538
             E  ER+RR L++ FMNP EKW+ +  LP K++L V+K++ VT+Q++LF+E   + V F+E + T  +H FL  W    + L YPP+ G +++Y  +     +++ + +YY + +++   +SY +              ++IP + + I       +    + +   +      +N T+ +      S+     ++ L  +  T    D  K+      F +R+I       D+ P+C +  ++I FDNS H GQ+ V L   ++  N         +       L+   DI  LI  +LSLIL  R+LI  +    KT  +F N +   I ++D+   F  + Y +I + D L+I GT+ K+   ++  +D D   FTL + FLG G  L ++ ++RYF +F + +IL+ T++ + P ++RF  C+ +LY  F + GW+I+GPY +KFRT+  S   LFSL+ GDDM+ T   IN SNTV+ +F 
Sbjct:   65 RETGERLRRHLQFFFMNPMEKWKVRHQLPYKLVLQVLKIVFVTMQLILFAEMRMSHVDFLEDTTTVMRHRFLKEWNDDRDALQYPPAEGRYSVYDDQGLSEHLSFLINSYYSIRNDSFASFSYDVVSHPSGNLGAQISFESIPPIEVLIDRISNVTVNNNTYNFDIREVKDTKRLNLTETEVFQIGQSDDAV--RDILATRGITFLPEDALKISTVQFKFRLRTIHYSPTAGDQKPECYKISVSIKFDNSRHTGQVHVTLSTVVSYVNVCNGRIIKGVGWSFDTLLIGGTDIFVLILCILSLILCCRALIKAHLLQIKTSDYFENVLKNKITVTDQLD-FLNLWYVMIVVNDALIIIGTVAKI---SIEFQDFDNSLFTLTSIFLGMGALLVYVGVLRYFGFFSQYNILMLTLKRSAPNIMRFMTCAIVLYAGFLIAGWVIIGPYSMKFRTLAESSEALFSLLNGDDMFATFYTINDSNTVIKVFG 544          
BLAST of Mucolipin-3 like protein vs. Ensembl Fly
Match: Trpml (gene:FBgn0262516 transcript:FBtr0074952)

HSP 1 Score: 245.743 bits (626), Expect = 6.837e-71
Identity = 162/467 (34.69%), Postives = 262/467 (56.10%), Query Frame = 3
Query:  162 DQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN--IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMD-ESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS-DKWKYFWGIAYFIIFIGDILVISGTILKMDM---YTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
             +ERMRR L++ FMNP EKW+AK   P K ++ +VK+ +VT+Q+ LF+ +  N +++   ++ +F HLFL  W SS E   YPP+ GPFA+Y   +F+ ++ YA+  Y  +   +IGPY Y   N  +P L LC+  YR G IF +N +Y F       C  + P     +      + YLR+++  ++F  L+ A L F ++++  K+      +PDC +FDI+I F+N +H+GQM + L AE T   C  +T  IS +         L+I  L+   LS  L +R+L   Y     T  FF ++   ++S D    F    Y +I   D+L+I G+ LK  +   Y +    +D++  C+ FLG G  L    ++RY  +F   ++++ T++ A P +LRF + + L+Y  F   GW+ILGPYH+KFR++ ++  CLF+L+ GDDM+ T + ++   T ++ F Q
Sbjct:   91 QEERMRRKLQFFFMNPIEKWQAKRKFPYKFVVQIVKIFLVTMQLCLFAHSRYNHINYTGDNRFAFSHLFLRGWDSSREVESYPPAVGPFALYLKSEFFDTVQYAVNGYANVSR-SIGPYDYPTPNNTMPPLKLCLQNYREGTIFGFNESYIFDPHIDEVCERLPP-----NVTTIGVENYLRQRDVEVNFASLVSAQLTFKIKTVNFKANGGPLSAPDCFRFDISITFNNRDHDGQMLLSLDAEATRLKCHGATDFISDANFDSMLRSVLNIFVLLTCALSFALCTRALWRAYLLRCTTVNFFRSQFGKELSFDGRLEFVNFWYIMIIFNDVLLIIGSALKEQIEGRYLV----VDQWDTCSLFLGIGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKILRFLIAALLIYAGFVFCGWLILGPYHMKFRSLATTSECLFALINGDDMFATFATLSSKATWLWWFCQ 547          
BLAST of Mucolipin-3 like protein vs. Ensembl Fly
Match: CG42638 (gene:FBgn0261361 transcript:FBtr0302283)

HSP 1 Score: 245.743 bits (626), Expect = 6.837e-71
Identity = 162/467 (34.69%), Postives = 262/467 (56.10%), Query Frame = 3
Query:  162 DQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN--IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMD-ESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS-DKWKYFWGIAYFIIFIGDILVISGTILKMDM---YTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
             +ERMRR L++ FMNP EKW+AK   P K ++ +VK+ +VT+Q+ LF+ +  N +++   ++ +F HLFL  W SS E   YPP+ GPFA+Y   +F+ ++ YA+  Y  +   +IGPY Y   N  +P L LC+  YR G IF +N +Y F       C  + P     +      + YLR+++  ++F  L+ A L F ++++  K+      +PDC +FDI+I F+N +H+GQM + L AE T   C  +T  IS +         L+I  L+   LS  L +R+L   Y     T  FF ++   ++S D    F    Y +I   D+L+I G+ LK  +   Y +    +D++  C+ FLG G  L    ++RY  +F   ++++ T++ A P +LRF + + L+Y  F   GW+ILGPYH+KFR++ ++  CLF+L+ GDDM+ T + ++   T ++ F Q
Sbjct:   91 QEERMRRKLQFFFMNPIEKWQAKRKFPYKFVVQIVKIFLVTMQLCLFAHSRYNHINYTGDNRFAFSHLFLRGWDSSREVESYPPAVGPFALYLKSEFFDTVQYAVNGYANVSR-SIGPYDYPTPNNTMPPLKLCLQNYREGTIFGFNESYIFDPHIDEVCERLPP-----NVTTIGVENYLRQRDVEVNFASLVSAQLTFKIKTVNFKANGGPLSAPDCFRFDISITFNNRDHDGQMLLSLDAEATRLKCHGATDFISDANFDSMLRSVLNIFVLLTCALSFALCTRALWRAYLLRCTTVNFFRSQFGKELSFDGRLEFVNFWYIMIIFNDVLLIIGSALKEQIEGRYLV----VDQWDTCSLFLGIGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKILRFLIAALLIYAGFVFCGWLILGPYHMKFRSLATTSECLFALINGDDMFATFATLSSKATWLWWFCQ 547          
BLAST of Mucolipin-3 like protein vs. Ensembl Zebrafish
Match: mcoln1a (mucolipin 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2704])

HSP 1 Score: 231.491 bits (589), Expect = 2.938e-66
Identity = 160/467 (34.26%), Postives = 263/467 (56.32%), Query Frame = 3
Query:  156 NEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY--GLD-NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            + ++E +RR L+Y FM+P EK++AKG  P K+IL ++K++IVT Q+VLF  +N   V F E +  SFKHLFL +         Y  S+   A+Y   D Y  M YA+E Y  L    +G Y+Y  G+  N   L+LC  YY+ G I P N T+      + +C  + P+ + ++      ++Y   +NFT+ F+KL+   + F +++I L++   +E PDC  F I IL DN  H+G++++ L  + +   C    PS+S      N  +  D+   +  V SL+L  RS+I       +  ++F   +   +   D+ ++  G  Y ++ I D+L I+G+I+K+    +  K++  +  C   LG    L  + ++RY ++F K +IL+ T++ A P ++RF  C  ++YL +   GWI+LGPYH+KFR++ S   CLFSL+ GDDM+VT S +  S+ +V++FSQ
Sbjct:   51 DPEEEELRRKLKYFFMSPCEKYQAKGRKPFKLILQILKIVIVTAQLVLFGLSNEMAVMFKEENTASFKHLFLKD---------YADSDDALAVYTQSDVYDHMFYAVEQYLSLADTTVGQYAYVYGVGVNGSALSLCQQYYKKGRIDPANDTFIIDPLVVTDCIGVNPLSTPTAAG--TGRDY---RNFTLKFHKLINVTIQFQLKAINLQTIIHNEIPDCYTFLITILLDNKAHSGKVRISLDNKASIKEC--RDPSVS-GHPDSNARVLFDLAVALVCVFSLLLCGRSIIRGIILQNEFVKYFKTSLKRHVCWGDRMEFING-WYILLIISDLLTITGSIIKIG---IELKNLSSYDECGILLGTSTLLVWVGVIRYLTFFQKYNILIVTLQAAFPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSSVSECLFSLINGDDMFVTFSGMQESSMLVWVFSQ 496          
BLAST of Mucolipin-3 like protein vs. Ensembl Zebrafish
Match: mcoln1b (mucolipin 1b [Source:ZFIN;Acc:ZDB-GENE-130514-1])

HSP 1 Score: 217.624 bits (553), Expect = 2.943e-61
Identity = 152/466 (32.62%), Postives = 259/466 (55.58%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY--GLD-NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEI--NIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +++E +RR L+Y FM+P +K+ AKG  P K+ L ++K+IIVTVQ+V+F  +N   V+F E +  SFKHLFL ++           S  P  ++  +  +  + YA++ Y  L   ++G Y+Y  G+  N   L LC  Y++ G I P N T+      + +C  + P  S+ S  + D        N T++F KL+   + F +++I +++   +E PDC  F I ILFDN  H+G++K+ L  E     C    P++S         ++ D+L  +   LSL+L  RS++       +   +F   +  ++ + D+ ++  G  Y ++ I D+L I  + +K+ + T   K++  + +C+  +G    L  + ++RYFS+F K +IL+ T+R A P ++RF  C+  +Y+ +   GWI+LGPYH KFR++ +   CLFSL+ GDDM+ T S +  S T+V++FSQ
Sbjct:   49 DEEEALRRKLKYFFMSPCDKYHAKGRKPYKLALQLLKIIIVTVQLVMFGLSNQMVVAFKEENTDSFKHLFLRDYVED--------SQEPLCLHTQKQVHEHIRYAIDQYLILSQTSVGRYAYVPGVGPNSSALYLCQRYFKKGTIDPVNDTFDIDPHVITDCFGVNP--SDPSSPVQD-----LYPNITLNFQKLVNVTIEFQLKAINIQTIINNEIPDCYTFSITILFDNKAHSGKVKLSLLNEAFIKEC--RDPNVS-GHGDSYARVAFDVLVAVVCGLSLVLCGRSILKGIMLQHELVCYFRVSLGRSVSLGDRLEFING-WYLLLIISDVLTIIASFIKIAIET---KNLSSYDVCSILMGTSTLLVWVGVIRYFSFFQKYNILIVTLRAAFPNVIRFCCCAAAIYMGYCFCGWIVLGPYHAKFRSLSTVSECLFSLINGDDMFATFSEVEQSGTLVWVFSQ 492          
BLAST of Mucolipin-3 like protein vs. Ensembl Zebrafish
Match: mcoln3a (mucolipin 3a [Source:ZFIN;Acc:ZDB-GENE-121116-4])

HSP 1 Score: 206.453 bits (524), Expect = 1.875e-57
Identity = 146/465 (31.40%), Postives = 260/465 (55.91%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL-DNIPI-LTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNE--INIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            E  E +RR L+Y FM+P +K+  +G +P KM+L ++K++I+TVQ+V F  +N   V+F E +  +FKH FL N         Y  SN  +A+Y   + +  + Y +  Y +L++  IG  +  + D +   L+LC   YR+  + P N T+         C  + P+   +++ + +S       N T+DF +LL  ++   +++I +++    E PDC  F I I+FDN  H+GQ+K+ L + +    C     S S S      ++  D L + F +LSLIL +RS+   +    + ++F  ++   ++  S++ ++  G  Y +I I D L I+G+ILK+    +  K++  + +C+  LG    L  + ++RY S+F K  IL+ T++ A+P ++RFS+C+ ++YL++   GWI+LGP+H  FRT      CLFS++ GD++Y T + +   +T+V++FS+
Sbjct:   18 ECVESLRRKLKYFFMSPCQKYSTRGRIPWKMMLQILKIVIITVQLVSFGLSNEMMVTFKEENLIAFKHFFLKN---------YKDSNKHYALYTKHEVHDHILYTIRRYLQLQNLTIGNQALEMIDGLATPLSLCQQLYRHARVVPSNETFEIDPHVETECVSVYPLSPITTDSLENSL------NLTLDFQRLLAVNIYLKIKAINIQTVRHQELPDCYDFSINIMFDNRAHSGQIKISLSSGVQINVCKDWNISGSNSHF--ALIVVFDCLIICFCLLSLILCTRSVHTGFLLQTEYRRFMSSQHSKSVSWSERLEFING-WYILIIISDALTIAGSILKI---CIQSKELTSYDVCSILLGTATMLVWIGVMRYLSFFQKYYILILTLKAALPNVIRFSICAVMIYLSYCFCGWIVLGPHHENFRTFSRVAGCLFSMINGDEIYSTFTKLREYSTLVWLFSR 461          
BLAST of Mucolipin-3 like protein vs. Ensembl Zebrafish
Match: MCOLN3 (mucolipin 3b [Source:NCBI gene;Acc:100001113])

HSP 1 Score: 202.216 bits (513), Expect = 7.783e-56
Identity = 181/578 (31.31%), Postives = 296/578 (51.21%), Query Frame = 3
Query:  168 ERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIV--YYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQ-STPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSC---PESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISS 1877
            E  RR L+Y FMNP +K++A+   P K+ L +VK+ +VTVQ+V F  +N   V F E +  +F+HLFL N+  S        +   +AIY   D Y  + + ++ +  L    +G + Y  +      LCI   +Y  G I P N T+         C+ I P    +   +          NFT+ F +LL   + F++++I L++ E  E PDC  F+I I FDN  H+G++ V L  E+  + C   S    S   M    L   D + ++    SL+L  RS+       K+  +F        + +S++ ++  G  Y +I + D+L ISG++LK+    +  K +  + LC+  LG G  L  + ++RY  Y  K +IL+ T+RVA+P ++RF+ C+ ++YL +   GWI+LGPYH KFRT+++    LFSL+ GDDM+ T   +   + VV++FS+L++Y F  LFI++VL+L +T+I + Y+  + Q+  G  V     F+  C   P+S  +S+ K + I      K            ++CCC  ++       +D D +    E SS
Sbjct:   30 EAFRRKLKYFFMNPCDKYKARQRKPWKLFLQIVKIAVVTVQLVSFGLSNQMVVQFKEENLLTFRHLFLKNYSES--------NTNTYAIYTQLDVYTHITHIVQQFLMLPSITVGNHEYEQEGDVYTPLCICQQFYHNGSISPANETFDIDSRVDQECSLIYPQDPFTESPL----------NFTLHFERLLSVTVNFTLKAINLETVEYHELPDCYVFNIMIQFDNKAHSGRILVDLDNEVHIYECSDWSMTGASARNMYMMVLF--DAVVILILSTSLLLCIRSVKAGVLLQKEYSEFSLRRYRKCVSLSERLEFING-WYLLIIVSDVLTISGSVLKI---VIQLKAVASYDLCSILLGTGTMLVWIGVLRYMGYLKKYNILIITLRVALPNVIRFTCCAAMIYLGYCFCGWIVLGPYHTKFRTLNTVSESLFSLINGDDMFATFKNMQQKSFVVWLFSRLYLYTFVSLFIYMVLSLFITLITDTYDTIKHQQLDGEPVSDLQAFVLQCKDLPDSGEFSVEKTNSISSTGGGK------------LMCCCSHRS-------SDSDEDTHFSECSS 564          
BLAST of Mucolipin-3 like protein vs. Ensembl Zebrafish
Match: MCOLN3 (mucolipin 3b [Source:NCBI gene;Acc:100001113])

HSP 1 Score: 202.986 bits (515), Expect = 9.269e-56
Identity = 177/560 (31.61%), Postives = 290/560 (51.79%), Query Frame = 3
Query:  168 ERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIV--YYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQ-STPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSC---PESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHN 1823
            E  RR L+Y FMNP +K++A+   P K+ L +VK+ +VTVQ+V F  +N   V F E +  +F+HLFL N+  S        +   +AIY   D Y  + + ++ +  L    +G + Y  +      LCI   +Y  G I P N T+         C+ I P    +   +          NFT+ F +LL   + F++++I L++ E  E PDC  F+I I FDN  H+G++ V L  E+  + C   S    S   M    L   D + ++    SL+L  RS+       K+  +F        + +S++ ++  G  Y +I + D+L ISG++LK+    +  K +  + LC+  LG G  L  + ++RY  Y  K +IL+ T+RVA+P ++RF+ C+ ++YL +   GWI+LGPYH KFRT+++    LFSL+ GDDM+ T   +   + VV++FS+L++Y F  LFI++VL+L +T+I + Y+  + Q+  G  V     F+  C   P+S  +S+ K + I      K            ++CCC  + +H 
Sbjct:   30 EAFRRKLKYFFMNPCDKYKARQRKPWKLFLQIVKIAVVTVQLVSFGLSNQMVVQFKEENLLTFRHLFLKNYSES--------NTNTYAIYTQLDVYTHITHIVQQFLMLPSITVGNHEYEQEGDVYTPLCICQQFYHNGSISPANETFDIDSRVDQECSLIYPQDPFTESPL----------NFTLHFERLLSVTVNFTLKAINLETVEYHELPDCYVFNIMIQFDNKAHSGRILVDLDNEVHIYECSDWSMTGASARNMYMMVLF--DAVVILILSTSLLLCIRSVKAGVLLQKEYSEFSLRRYRKCVSLSERLEFING-WYLLIIVSDVLTISGSVLKI---VIQLKAVASYDLCSILLGTGTMLVWIGVLRYMGYLKKYNILIITLRVALPNVIRFTCCAAMIYLGYCFCGWIVLGPYHTKFRTLNTVSESLFSLINGDDMFATFKNMQQKSFVVWLFSRLYLYTFVSLFIYMVLSLFITLITDTYDTIKHQQLDGEPVSDLQAFVLQCKDLPDSGEFSVEKTNSISSTGGGK------------LMCCCSHRYSHT 553          
BLAST of Mucolipin-3 like protein vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:NCBI gene;Acc:496811])

HSP 1 Score: 243.047 bits (619), Expect = 2.322e-70
Identity = 166/463 (35.85%), Postives = 270/463 (58.32%), Query Frame = 3
Query:  162 DQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLD-NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFH--NEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            ++ ++RR L+Y FM+P +K+RAKG  P K+ L ++K++ VTVQ++LF  +N   V F E +  +FKHLFL ++    E          +A+Y  ED Y  + YA+E Y+ L ++    Y+Y    N   L++C  YYR G I P N T++   + + NC     +F + +E    S+ Y   KNFTI F+KL+   + F +++I +++   +E PDC  F I ILFDN  H+G++K+ L  E     C    PS+       ++ L+ D+L ++  +LS IL +RS++       +  QF H  + + I +SD+ ++  G  Y ++ I D+L +SGT++K+    +  K    + +C+  LG    L  + ++RY S+F K +IL+ T+RVA+P ++RF  C  ++YL +   GWI+LGPYH+KFRT+     CLFSL+ GDDM+VT S + +S+ +V+ FSQ
Sbjct:   41 EEVQLRRRLKYFFMSPCDKFRAKGRKPYKLGLQLLKIMFVTVQLILFGLSNQMVVQFKEENTEAFKHLFLKDYTDDAEK--------TYAVYTQEDVYEHLYYAVEQYFSLSNQTTARYAYTRPFNQSALSVCQQYYRKGHIDPANDTFNIDPQVITNC-----LFLDPAEP---SQSY---KNFTIKFHKLINLTVQFQLKAINIQTIINNEIPDCYTFTITILFDNKAHSGKVKIQLDNEAKIKEC--KDPSV-YGRGDNHSRLAFDVLVILSCILSFILCARSIVRGLLLQHEFAQFVHYRHGLTISLSDRLEFVNG-WYLLLIISDVLTVSGTVMKIG---IESKTFASYDVCSILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRVALPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRTLSMVSECLFSLINGDDMFVTFSEMQNSSYLVWAFSQ 477          
BLAST of Mucolipin-3 like protein vs. Ensembl Xenopus
Match: mcoln1 (mucolipin 1 [Source:NCBI gene;Acc:496811])

HSP 1 Score: 242.276 bits (617), Expect = 2.543e-70
Identity = 166/463 (35.85%), Postives = 270/463 (58.32%), Query Frame = 3
Query:  162 DQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLD-NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFH--NEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            ++ ++RR L+Y FM+P +K+RAKG  P K+ L ++K++ VTVQ++LF  +N   V F E +  +FKHLFL ++    E          +A+Y  ED Y  + YA+E Y+ L ++    Y+Y    N   L++C  YYR G I P N T++   + + NC     +F + +E    S+ Y   KNFTI F+KL+   + F +++I +++   +E PDC  F I ILFDN  H+G++K+ L  E     C    PS+       ++ L+ D+L ++  +LS IL +RS++       +  QF H  + + I +SD+ ++  G  Y ++ I D+L +SGT++K+    +  K    + +C+  LG    L  + ++RY S+F K +IL+ T+RVA+P ++RF  C  ++YL +   GWI+LGPYH+KFRT+     CLFSL+ GDDM+VT S + +S+ +V+ FSQ
Sbjct:   35 EEVQLRRRLKYFFMSPCDKFRAKGRKPYKLGLQLLKIMFVTVQLILFGLSNQMVVQFKEENTEAFKHLFLKDYTDDAEK--------TYAVYTQEDVYEHLYYAVEQYFSLSNQTTARYAYTRPFNQSALSVCQQYYRKGHIDPANDTFNIDPQVITNC-----LFLDPAEP---SQSY---KNFTIKFHKLINLTVQFQLKAINIQTIINNEIPDCYTFTITILFDNKAHSGKVKIQLDNEAKIKEC--KDPSV-YGRGDNHSRLAFDVLVILSCILSFILCARSIVRGLLLQHEFAQFVHYRHGLTISLSDRLEFVNG-WYLLLIISDVLTVSGTVMKIG---IESKTFASYDVCSILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRVALPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRTLSMVSECLFSLINGDDMFVTFSEMQNSSYLVWAFSQ 471          
BLAST of Mucolipin-3 like protein vs. Ensembl Xenopus
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:Xenbase;Acc:XB-GENE-964629])

HSP 1 Score: 234.187 bits (596), Expect = 2.762e-67
Identity = 157/469 (33.48%), Postives = 265/469 (56.50%), Query Frame = 3
Query:  153 LNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN--IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            L EDQ  +RR L++ FMNP EK+RA+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  ++           +  +AIY  ED +  +N+ ++ Y +L++ ++G ++Y  +      ++LC  YY+ G IFP N T+    +    C  I P    S+    D+       N T+DF +L+  ++ F +++I L++    E PDC  F + I FDN  H+G++K+ L  ++    C     S SI    KNT  ++  D   ++  + S+ L  RS++      K+   FF +     +S  D+ ++  G  Y +I I D+L I G+ILKM++ +LT  D+     C+  LG    L  L ++RY  +F K ++L+ T+R A+P ++RF  C+ ++YL +   GWI+LGPYH+KFR+++    CLFSL+ GDDM+ T S++   + +V++FS+
Sbjct:   32 LMEDQ--LRRKLKFFFMNPCEKFRARGRKPWKLCIQILKIAMVTIQLVLFGLSNEMVVTFKEENTVAFKHLFLKGYKDG--------HDDTYAIYSQEDVHAHINFTIKRYLELQNISVGNHAYESNGKGQTGMSLCQHYYKQGSIFPGNETFEIDPQIDTECFHIDPSTLCSN----DTPAEYYWSNMTLDFYRLVSVEIMFKLKAINLQTIRHHELPDCYDFMVIITFDNKAHSGRIKISLDNDVGIQECKDWHVSGSIQ---KNTHYMMIFDAAVILVCLSSITLCIRSVVKGIHLQKEYVNFFQHRFARTVSSADRMEFVNG-WYIMIIISDVLSIIGSILKMEIQSLTSYDV-----CSILLGTSTLLVWLGVIRYLGFFKKYNLLILTLRAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHVKFRSLNMVSECLFSLINGDDMFTTFSIMQEKSYLVWLFSR 477          
BLAST of Mucolipin-3 like protein vs. Ensembl Xenopus
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:Xenbase;Acc:XB-GENE-964629])

HSP 1 Score: 231.106 bits (588), Expect = 1.167e-66
Identity = 155/469 (33.05%), Postives = 264/469 (56.29%), Query Frame = 3
Query:  153 LNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN--IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            L EDQ  +RR L++ FMNP EK+RA+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  ++           +  +AIY  ED +  +N+ ++ Y +L++ ++G ++Y  +      ++LC  YY+ G IFP N T+    +    C  I P    S+    D+       N T+DF +L+  ++ F +++I L++    E PDC  F + I FDN  H+G++K+ L  ++    C     S SI    KNT  ++  D   ++  + S+ L  RS++      K+   FF +     +S  D+ ++  G  Y +I I D+L I G+ILKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T+R A+P ++RF  C+ ++YL +   GWI+LGPYH+KFR+++    CLFSL+ GDDM+ T S++   + +V++FS+
Sbjct:   19 LMEDQ--LRRKLKFFFMNPCEKFRARGRKPWKLCIQILKIAMVTIQLVLFGLSNEMVVTFKEENTVAFKHLFLKGYKDG--------HDDTYAIYSQEDVHAHINFTIKRYLELQNISVGNHAYESNGKGQTGMSLCQHYYKQGSIFPGNETFEIDPQIDTECFHIDPSTLCSN----DTPAEYYWSNMTLDFYRLVSVEIMFKLKAINLQTIRHHELPDCYDFMVIITFDNKAHSGRIKISLDNDVGIQECKDWHVSGSIQ---KNTHYMMIFDAAVILVCLSSITLCIRSVVKGIHLQKEYVNFFQHRFARTVSSADRMEFVNG-WYIMIIISDVLSIIGSILKME---IQAKSLTSYDVCSILLGTSTLLVWLGVIRYLGFFKKYNLLILTLRAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHVKFRSLNMVSECLFSLINGDDMFTTFSIMQEKSYLVWLFSR 466          
BLAST of Mucolipin-3 like protein vs. Ensembl Xenopus
Match: wdsub1 (WD repeat, sterile alpha motif and U-box domain containing 1 [Source:Xenbase;Acc:XB-GENE-964629])

HSP 1 Score: 231.491 bits (589), Expect = 1.594e-66
Identity = 155/469 (33.05%), Postives = 264/469 (56.29%), Query Frame = 3
Query:  153 LNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN--IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            L EDQ  +RR L++ FMNP EK+RA+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  ++           +  +AIY  ED +  +N+ ++ Y +L++ ++G ++Y  +      ++LC  YY+ G IFP N T+    +    C  I P    S+    D+       N T+DF +L+  ++ F +++I L++    E PDC  F + I FDN  H+G++K+ L  ++    C     S SI    KNT  ++  D   ++  + S+ L  RS++      K+   FF +     +S  D+ ++  G  Y +I I D+L I G+ILKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T+R A+P ++RF  C+ ++YL +   GWI+LGPYH+KFR+++    CLFSL+ GDDM+ T S++   + +V++FS+
Sbjct:   32 LMEDQ--LRRKLKFFFMNPCEKFRARGRKPWKLCIQILKIAMVTIQLVLFGLSNEMVVTFKEENTVAFKHLFLKGYKDG--------HDDTYAIYSQEDVHAHINFTIKRYLELQNISVGNHAYESNGKGQTGMSLCQHYYKQGSIFPGNETFEIDPQIDTECFHIDPSTLCSN----DTPAEYYWSNMTLDFYRLVSVEIMFKLKAINLQTIRHHELPDCYDFMVIITFDNKAHSGRIKISLDNDVGIQECKDWHVSGSIQ---KNTHYMMIFDAAVILVCLSSITLCIRSVVKGIHLQKEYVNFFQHRFARTVSSADRMEFVNG-WYIMIIISDVLSIIGSILKME---IQAKSLTSYDVCSILLGTSTLLVWLGVIRYLGFFKKYNLLILTLRAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHVKFRSLNMVSECLFSLINGDDMFTTFSIMQEKSYLVWLFSR 479          
BLAST of Mucolipin-3 like protein vs. Ensembl Mouse
Match: Mcoln3 (mucolipin 3 [Source:MGI Symbol;Acc:MGI:1890500])

HSP 1 Score: 221.09 bits (562), Expect = 1.077e-62
Identity = 152/469 (32.41%), Postives = 263/469 (56.08%), Query Frame = 3
Query:  153 LNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIP--ILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            L EDQ  MRR L++ FMNP EK+ A+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  +            +  +A+Y   + Y  + +A+  Y +L++ ++G ++Y         + +C  +YR G I P N T+    E    C  ++P   + +  +    E   + N ++DF++LL  +L F +++I L++    E PDC  F + I FDN  H+G++K+ L  +++   C     S SI    KNT  ++  D   ++  + SL+L +RS+I   Q  ++   FF  H +  +  SD+ ++  G  Y +I I DIL I G++LKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T++ A+P ++RF  C+ ++YL +   GWI+LGPYH KFR+++    CLFSL+ GDDM+ T + +   + +V++FS+
Sbjct:   33 LLEDQ--MRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRM--------DDTYAVYTQSEVYDQIIFAVTQYLQLQNISVGNHAYENKGTKQSAMAICQHFYRQGTICPGNDTFDIDPEVETECFLVEP---DEASHLGTPGE--NKLNLSLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIKECKDWHVSGSIQ---KNTHYMMIFDAFVILTCLASLVLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFING-WYIMIIISDILTIVGSVLKME---IQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVMRFCCCAAMIYLGYCFCGWIVLGPYHEKFRSLNRVSECLFSLINGDDMFSTFAKMQQKSYLVWLFSR 479          
BLAST of Mucolipin-3 like protein vs. Ensembl Mouse
Match: Mcoln1 (mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498])

HSP 1 Score: 211.075 bits (536), Expect = 7.858e-59
Identity = 157/478 (32.85%), Postives = 262/478 (54.81%), Query Frame = 3
Query:  162 DQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY------GLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIF------SNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTL-LSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHS---NTVVYIFSQ 1541
            ++E +RR L+Y FM+P +K+RAKG  P K++L VVK+++VTVQ++LF  +N   V+F E +  +F+HLFL  +           S+  FA Y  E  Y ++ YA++ Y  L   ++G Y+Y         N   L LC  YY  G + P N T+      + +C  + P        S   + +  S  Y   KN T+ F+KL+   + F +++I L+S   +E PDC  F I I FDN  H+G++ + L+ +      IQ     S+S    N+  L  D++ ++   LS +L +RSL+  +    +   F       +IS  ++ ++  G  Y ++   D+L ISGT++K+    +  K++  + +C+  LG    L  + ++RY ++F K +IL+ T+RVA+P ++RF  C  ++YL +   GWI+LGPYH+KFR++     CLFSL+ GDDM+VT + +      +++V++FSQ
Sbjct:   37 EEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDG--------SDDTFAAYTQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFDIDPRVVTDCIQVDPPDRPPDIPSEDLDFLDGSASY---KNLTLKFHKLINVTIHFQLKTINLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTH----IQECKHPSVSRHGDNSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNG-WYILLVTSDVLTISGTVMKIG---IEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGHSSLVWLFSQ 495          
BLAST of Mucolipin-3 like protein vs. Ensembl Mouse
Match: Mcoln2 (mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529])

HSP 1 Score: 207.994 bits (528), Expect = 7.868e-58
Identity = 144/480 (30.00%), Postives = 268/480 (55.83%), Query Frame = 3
Query:  126 QRYSINNLQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--DNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIK-PIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT---LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
             R ++ +L     +E +R DL+++FM+P EK+RA+  +P K+ L ++K+++VT Q+V F  +N   V+F E +  +FKHLFL  +    E       +   +IY  E+ Y S+ +A++ Y  L++ ++    YG   DN   L +C  +Y+ G +F  N T +   +   +C  +   + +   E      ++ +   F +DF +L++ D++F+++ I L++    E PDC  F   I FDN+ H+G++K+ L +E      I+   +++IS   + +   LL  D+  ++  + SLIL +RS++   +  K+   FF  +    +  +D+W++  G  Y ++ I D++ I G+ILKM+   +  K +  + +C+  LG       + ++RY  YF   ++L+ T++ ++P +LRF  C+ ++YL ++  GWI+LGPYH KF  ++    CLFSL+ GDDM+ T + I   + +V++FS+
Sbjct:   25 HRSAMASLDSEVREECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGFSGVDE------DDYSCSIYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETLNIDSDIETDCIHLDLQVLTTEPE------DWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREIPDCYLFQNTITFDNTAHSGKIKIYLNSEAN----IEECKNMNISGSTQRSTHYLLVFDVFVIMICLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNG-WYVLVTISDLMTIIGSILKME---IKAKKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFATFAQIQQKSILVWLFSR 484          
BLAST of Mucolipin-3 like protein vs. Ensembl Mouse
Match: Mcoln2 (mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529])

HSP 1 Score: 207.223 bits (526), Expect = 8.930e-58
Identity = 144/467 (30.84%), Postives = 264/467 (56.53%), Query Frame = 3
Query:  165 QERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--DNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIK-PIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT---LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +E +R DL+++FM+P EK+RA+  +P K+ L ++K+++VT Q+V F  +N   V+F E +  +FKHLFL  + S  +   Y  S     IY  E+ Y S+ +A++ Y  L++ ++    YG   DN   L +C  +Y+ G +F  N T +   +   +C  +   + +   E      ++ +   F +DF +L++ D++F+++ I L++    E PDC  F   I FDN+ H+G++K+ L +E      I+   +++IS   + +   LL  D+  ++  + SLIL +RS++   +  K+   FF  +    +  +D+W++  G  Y ++ I D++ I G+ILKM+   +  K +  + +C+  LG       + ++RY  YF   ++L+ T++ ++P +LRF  C+ ++YL ++  GWI+LGPYH KF  ++    CLFSL+ GDDM+ T + I   + +V++FS+
Sbjct:   10 EECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGF-SGVDEDDYSCS-----IYTQENTYESIFFAIKQYRHLKNISLATLGYGESEDNRTGLKVCKQHYKTGAMFSSNETLNIDSDIETDCIHLDLQVLTTEPE------DWAQTSFFRLDFYRLVQVDISFALKGIDLQAVHSREIPDCYLFQNTITFDNTAHSGKIKIYLNSEAN----IEECKNMNISGSTQRSTHYLLVFDVFVIMICLASLILCTRSIVLALRLRKRFLNFFLEKYKQRVCGADQWEFVNG-WYVLVTISDLMTIIGSILKME---IKAKKLTNYDVCSILLGTSTLFVWVGVIRYLGYFQTYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHEKFENLNIVAECLFSLVNGDDMFATFAQIQQKSILVWLFSR 456          
BLAST of Mucolipin-3 like protein vs. Ensembl Mouse
Match: Mcoln1 (mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498])

HSP 1 Score: 52.7582 bits (125), Expect = 9.288e-8
Identity = 25/50 (50.00%), Postives = 36/50 (72.00%), Query Frame = 3
Query: 1404 LGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVIN----HSNTVVYIFSQ 1541
            LGPYH+KFR++     CLFSL+ GDDM+VT + +     HS ++V++FSQ
Sbjct:    1 LGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGHS-SLVWLFSQ 49          
BLAST of Mucolipin-3 like protein vs. UniProt/SwissProt
Match: sp|Q8R4F0|MCLN3_MOUSE (Mucolipin-3 OS=Mus musculus OX=10090 GN=Mcoln3 PE=1 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 7.531e-62
Identity = 152/469 (32.41%), Postives = 263/469 (56.08%), Query Frame = 3
Query:  153 LNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIP--ILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            L EDQ  MRR L++ FMNP EK+ A+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  +            +  +A+Y   + Y  + +A+  Y +L++ ++G ++Y         + +C  +YR G I P N T+    E    C  ++P   + +  +    E   + N ++DF++LL  +L F +++I L++    E PDC  F + I FDN  H+G++K+ L  +++   C     S SI    KNT  ++  D   ++  + SL+L +RS+I   Q  ++   FF  H +  +  SD+ ++  G  Y +I I DIL I G++LKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T++ A+P ++RF  C+ ++YL +   GWI+LGPYH KFR+++    CLFSL+ GDDM+ T + +   + +V++FS+
Sbjct:   33 LLEDQ--MRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRM--------DDTYAVYTQSEVYDQIIFAVTQYLQLQNISVGNHAYENKGTKQSAMAICQHFYRQGTICPGNDTFDIDPEVETECFLVEP---DEASHLGTPGE--NKLNLSLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIKECKDWHVSGSIQ---KNTHYMMIFDAFVILTCLASLVLCARSVIRGLQLQQEFVNFFLLHYKKEVSASDQMEFING-WYIMIIISDILTIVGSVLKME---IQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVMRFCCCAAMIYLGYCFCGWIVLGPYHEKFRSLNRVSECLFSLINGDDMFSTFAKMQQKSYLVWLFSR 479          
BLAST of Mucolipin-3 like protein vs. UniProt/SwissProt
Match: sp|F6RG56|MCLN3_CALJA (Mucolipin-3 OS=Callithrix jacchus OX=9483 GN=MCOLN3 PE=1 SV=1)

HSP 1 Score: 212.616 bits (540), Expect = 8.963e-59
Identity = 153/466 (32.83%), Postives = 265/466 (56.87%), Query Frame = 3
Query:  165 QERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY---GLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +++MRR L++ FMNP EK+ A+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  +    +          +A+Y   D Y  + +A+  Y +L + ++G ++Y   G D    + +C  +Y+ G I+P N T+    E   +C  ++P      E          + N T+DF++LL  +L F +++I L++    E PDC  F + I FDN  H+G++K+ L  +++   C     S SI    KNT  ++  D   ++  ++SLIL  RS+I+  Q  ++   FF  H + ++ +SD+ ++  G  Y +I I DIL I G+ILKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T++ A+P ++RF  C+ ++YL +   GWI+LGPYH KFR+++    CLFSL+ GDDM+ T + +   + +V++FS+
Sbjct:   35 EDQMRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTVAFKHLFLKGYIDRMD--------DTYAVYTQSDVYDQIIFAVNQYLQLYNVSVGNHAYENKGTDQ-SAMAICQHFYKRGNIYPGNDTFDIDPEIETDCFFVEP-----DEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQ---KNTHNMMIFDAFVILTCLVSLILCIRSVISGLQLQQEFVNFFLLHYKKDVSVSDQMEFVNG-WYIMIIISDILTIIGSILKME---IQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHNKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSR 479          
BLAST of Mucolipin-3 like protein vs. UniProt/SwissProt
Match: sp|Q8IZK6|MCLN2_HUMAN (Mucolipin-2 OS=Homo sapiens OX=9606 GN=MCOLN2 PE=1 SV=2)

HSP 1 Score: 213.001 bits (541), Expect = 9.551e-59
Identity = 152/486 (31.28%), Postives = 269/486 (55.35%), Query Frame = 3
Query:  129 RYSINNLQLNED----QERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGL--DNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQA-----EMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            R ++ N   + D    +E +R DL+++FM+P EK+RA+  +P K+ L ++K+++VT Q+V F  +N   V+F E +  +FKHLFL  +  + E       +   ++Y  ED Y S+ +A+  Y++L+   +G   YG   DN   L +C  +Y+ G +FP N T +   +  ++C  +     + S+K  D K       F ++F +LL+ +++F ++ I L++    E PDC  F   I+FDN  H+G++K+   +     E    N   ST         KN   +L  D   ++  + SLIL +RS++   +  K+   FF  +    +  +D+W++  G  Y ++ I D++ I G+ILKM+   +  K++  + LC+ FLG    L  + ++RY  YF   ++L+ T++ ++P +LRF  C+ ++YL ++  GWI+LGPYH KF  +++   CLFSL+ GDDM+ T + I   + +V++FS+
Sbjct:   22 RLTVRNAMAHRDSEMKEECLREDLKFYFMSPCEKYRARRQIPWKLGLQILKIVMVTTQLVRFGLSNQLVVAFKEDNTVAFKHLFLKGYSGTDE------DDYSCSVYTQEDAYESIFFAINQYHQLKDITLGTLGYGENEDNRIGLKVCKQHYKKGTMFPSNETLNIDNDVELDCVQLD--LQDLSKKPPDWKN---SSFFRLEFYRLLQVEISFHLKGIDLQTIHSRELPDCYVFQNTIIFDNKAHSGKIKIYFDSDAKIEECKDLNIFGSTQ--------KNAQYVLVFDAFVIVICLASLILCTRSIVLALRLRKRFLNFFLEKYKRPVCDTDQWEFING-WYVLVIISDLMTIIGSILKME---IKAKNLTNYDLCSIFLGTSTLLVWVGVIRYLGYFQAYNVLILTMQASLPKVLRFCACAGMIYLGYTFCGWIVLGPYHDKFENLNTVAECLFSLVNGDDMFATFAQIQQKSILVWLFSR 484          
BLAST of Mucolipin-3 like protein vs. UniProt/SwissProt
Match: sp|Q8TDD5|MCLN3_HUMAN (Mucolipin-3 OS=Homo sapiens OX=9606 GN=MCOLN3 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 3.593e-58
Identity = 157/478 (32.85%), Postives = 265/478 (55.44%), Query Frame = 3
Query:  126 QRYSINNLQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIP--ILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            Q+ S +   L EDQ  MRR L++ FMNP EK+ A+G  P K+ + ++K+ +VT+Q+VLF  +N   V+F E +  +FKHLFL  +    +          +A+Y   D Y  + +A+  Y +L + ++G ++Y         + +C  +Y+ G I+P N T+    E    C  ++P      E          + N T+DF++LL  +L F +++I L++    E PDC  F + I FDN  H+G++K+ L  +++   C     S SI    KNT  ++  D   ++  ++SLIL  RS+I   Q  ++   FF  H +  + +SD+ ++  G  Y +I I DIL I G+ILKM+   +  K +  + +C+  LG    L  L ++RY  +F K ++L+ T++ A+P ++RF  C+ ++YL +   GWI+LGPYH KFR+++    CLFSL+ GDDM+ T + +   + +V++FS+
Sbjct:   24 QQTSPSEELLLEDQ--MRRKLKFFFMNPCEKFWARGRKPWKLAIQILKIAMVTIQLVLFGLSNQMVVAFKEENTIAFKHLFLKGYMDRMD--------DTYAVYTQSDVYDQLIFAVNQYLQLYNVSVGNHAYENKGTKQSAMAICQHFYKRGNIYPGNDTFDIDPEIETECFFVEP-----DEPFHIGTPAENKLNLTLDFHRLLTVELQFKLKAINLQTVRHQELPDCYDFTLTITFDNKAHSGRIKISLDNDISIRECKDWHVSGSIQ---KNTHYMMIFDAFVILTCLVSLILCIRSVIRGLQLQQEFVNFFLLHYKKEVSVSDQMEFVNG-WYIMIIISDILTIIGSILKME---IQAKSLTSYDVCSILLGTSTMLVWLGVIRYLGFFAKYNLLILTLQAALPNVIRFCCCAAMIYLGYCFCGWIVLGPYHDKFRSLNMVSECLFSLINGDDMFATFAKMQQKSYLVWLFSR 479          
BLAST of Mucolipin-3 like protein vs. UniProt/SwissProt
Match: sp|Q99J21|MCLN1_MOUSE (Mucolipin-1 OS=Mus musculus OX=10090 GN=Mcoln1 PE=1 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 5.497e-58
Identity = 157/478 (32.85%), Postives = 262/478 (54.81%), Query Frame = 3
Query:  162 DQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY------GLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIF------SNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTL-LSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHS---NTVVYIFSQ 1541
            ++E +RR L+Y FM+P +K+RAKG  P K++L VVK+++VTVQ++LF  +N   V+F E +  +F+HLFL  +           S+  FA Y  E  Y ++ YA++ Y  L   ++G Y+Y         N   L LC  YY  G + P N T+      + +C  + P        S   + +  S  Y   KN T+ F+KL+   + F +++I L+S   +E PDC  F I I FDN  H+G++ + L+ +      IQ     S+S    N+  L  D++ ++   LS +L +RSL+  +    +   F       +IS  ++ ++  G  Y ++   D+L ISGT++K+    +  K++  + +C+  LG    L  + ++RY ++F K +IL+ T+RVA+P ++RF  C  ++YL +   GWI+LGPYH+KFR++     CLFSL+ GDDM+VT + +      +++V++FSQ
Sbjct:   37 EEEDLRRRLKYFFMSPCDKFRAKGRKPCKLMLQVVKILVVTVQLILFGLSNQLVVTFREENTIAFRHLFLLGYSDG--------SDDTFAAYTQEQLYQAIFYAVDQYLILPEISLGRYAYVRGGGGPWANGSALALCQRYYHRGHVDPANDTFDIDPRVVTDCIQVDPPDRPPDIPSEDLDFLDGSASY---KNLTLKFHKLINVTIHFQLKTINLQSLINNEIPDCYTFSILITFDNKAHSGRIPIRLETKTH----IQECKHPSVSRHGDNSFRLLFDVVVILTCSLSFLLCARSLLRGFLLQNEFVVFMWRRRGREISLWERLEFVNG-WYILLVTSDVLTISGTVMKIG---IEAKNLASYDVCSILLGTSTLLVWVGVIRYLTFFHKYNILIATLRVALPSVMRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFAAMQAQQGHSSLVWLFSQ 495          
BLAST of Mucolipin-3 like protein vs. TrEMBL
Match: A0A077LDL1 (Transient receptor potential ion channel ML a (Fragment) OS=Dugesia japonica OX=6161 GN=DjTRPMLa PE=2 SV=1)

HSP 1 Score: 575.859 bits (1483), Expect = 0.000e+0
Identity = 346/575 (60.17%), Postives = 445/575 (77.39%), Query Frame = 3
Query:  141 NNLQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPI-FSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLT-KKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEII-TDDDREN 1856
            +N +  E+QERMRR+LRYHFMNP+EKW+AKGTLPIKMILI+ KLII+T+QI+LFSENNSNEVSFVEGSKTSFKHLFL NWQSS+ETLPYPPS+GPFAIYK+ +FY + ++ALENYYKL  EAIGPY YG  N PI+TLC+ YY+  EIFPYN +Y F+ E + NC D+ PI F N S   ++ K+ L+  NFTI+FN L KA++ F++RSIQLKSYE+D+ PDC +FD+ I FDN+NHNGQ+ V L+  MT   C +   + +    +  TL  +D LALIFS  SL+L  RS   L++FWKK K F+ +E+ +DI +K KYF+ I+Y ++F GDILVISGTI K+ M  L  KK I  F++ NYFLG G+FLG+LTL+RYF+++ KSS+L+NTI+ A  PLLRFSLCS +LYLAFSLLGWIILGPYH+KFRT  SS+ACLFSLM GDDMYVTLS+I+  N+V+++FSQLFIYLFC+LFIFVVLNLILTII EAY + + Q+     +D FW FIN+C ES+   LY+ D+I+D+++ K +    ++K VD  CCC+GK +H  EI   +D+R+N
Sbjct:    6 DNHEYTENQERMRRNLRYHFMNPREKWQAKGTLPIKMILIIFKLIILTIQIILFSENNSNEVSFVEGSKTSFKHLFLENWQSSYETLPYPPSSGPFAIYKIAEFYSAASFALENYYKLNEEAIGPYGYGKYNKPIMTLCVTYYKISEIFPYNSSYIFTNELIRNCIDLMPISFQNKSGYSYNVKDILQNNNFTINFNGLTKAEILFTLRSIQLKSYEIDKIPDCFEFDLNIYFDNNNHNGQVVVDLKVNMTELECNKEIKNPNQKDYVTITLKVIDYLALIFSTFSLVLCCRSHYRLFKFWKKVKSFYLDEMGVDIINKRKYFFSISYMLMFFGDILVISGTIAKLKMDVLEGKKAITNFSVTNYFLGIGVFLGYLTLLRYFTFYRKSSVLINTIKAATSPLLRFSLCSIILYLAFSLLGWIILGPYHLKFRTFVSSVACLFSLMNGDDMYVTLSIISSENSVIFVFSQLFIYLFCLLFIFVVLNLILTIIIEAYNDVQHQDLSSTQLDNFWGFINACQESSKSPLYRSDMIYDKSLRKLKSANFSRKFVDTFCCCIGKGSHTQEIKENNDERDN 580          
BLAST of Mucolipin-3 like protein vs. TrEMBL
Match: A0A517BE80 (Transient receptor potential cation channel, mucolipin OS=Manduca sexta OX=7130 PE=4 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 2.893e-81
Identity = 168/470 (35.74%), Postives = 279/470 (59.36%), Query Frame = 3
Query:  153 LNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYG--LDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSIS---ISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKK-TKQFFHNEINIDIS-DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            L++ +E+MRR L++ FMNP EKW+AK   P K ++ V+K+++VT Q+ LF+ N  N V++   ++ SF HLFL  W S+ E   YPP  GP A+YK+++FY ++++A   Y  L + AIGPYSY    +N+P    C   Y+ G+IF +N +Y F+ E +  C +    F+    ++FDS+ +++     I+F+ L++A L FS+++I  ++      PDC +FD+ I+FDN +H+GQM + L+AE     C   T  I+   I  ++++TL  L    +I       +     I   Q  K+ T QFF    N D+S D    F  + Y +I + D+L+I G+ +K +     +   D++ +C+ FLG G  L    ++RY  +F   ++++ T++ A P + RFS+C+ LLY  F   GW+ILGPYH+KFR++ ++  CLFSL+ GDDM+ T S+++  + +++ FS+
Sbjct:   45 LHQMEEKMRRKLQFFFMNPIEKWQAKRKFPYKFVVQVIKIVLVTFQLCLFAHNRYNHVNYTWDNRISFSHLFLQGWDSTREINAYPPGAGPLAVYKIDEFYSTLDFAYAGYSNLSN-AIGPYSYNDESNNMPDPVFCQYNYKQGDIFGFNESYQFNSEIVETCIN----FTRKGNEVFDSELFIKEAGLDINFSALIRAKLMFSIKTINFRAAGPITPPDCYRFDVEIIFDNEDHDGQMSLILEAEPYKLECKGDTAYITDNKIDQILRSTLNIL----VILICAVSFVLCSRAIYRAQLLKELTVQFFQRTYNKDLSLDGRLEFLNVWYIMIIVNDLLIIMGSAIK-EQIERNQFTNDQWNVCSLFLGTGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKIFRFSICALLLYAGFMFCGWLILGPYHMKFRSLATTSECLFSLINGDDMFATFSIMSKKSPMLWWFSR 504          
BLAST of Mucolipin-3 like protein vs. TrEMBL
Match: R7UMX7 (PKD_channel domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_136028 PE=4 SV=1)

HSP 1 Score: 280.796 bits (717), Expect = 3.965e-81
Identity = 166/472 (35.17%), Postives = 272/472 (57.63%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNI--PILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIF-----SNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKY--FWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            ++ + +RR L++ FMNP EKWRAK   P KM+L +VK+  VT Q+ LF  +    V F+E S  +FKHLFL  WQ SFET+PYPP+ G FA+Y + +F+ S+NYAL  Y   E  AIG Y +   N   P + +C  +Y+ G+I  +N ++ F    + +C  + P+      + S+  I+D +++L  +N +I+F+ ++  +L FSV+++ L+      +PDC +F+I+I +DNS HNGQM V L        C     S      +   +   D + ++ S +SL L  RSL    Q  K+T  FF   +N  + +   +++  FW   Y +I I D++ I G+ LK+    +  K+   +  C   LG    L    ++RY  +F K +IL+ T++ + P +LRF +C+ + Y  F++ GW++LGPYH+KFRT+  +  CLF+L+ GD++YVT + I ++ + V+ +S+
Sbjct:   17 QEGDLLRRKLKFFFMNPCEKWRAKRRFPWKMVLQLVKIFFVTAQLALFGFDRGGHVDFLEKSNIAFKHLFLEGWQPSFETMPYPPATGAFAVYTIPEFFSSVNYALRQYNLTEKVAIGTYHFSNPNATKPPVVMCNTFYKIGKISAHNQSFLFDDTKIEDCFQLLPVIEYDESTQSAVAIYDVEKFLLLRNKSINFDSIISVELKFSVKTVHLRKLSKVHTPDCFRFNISIFYDNSLHNGQMTVALSCSQEMLKCNGKVTSDVDEGPLLTLVTIFDAIVILVSSVSLFLCCRSLHRGNQLRKETSVFFEERLNHPLQVHSHFEFVNFW---YIMIVINDLMTIVGSGLKIR---IENKESAAYEACGVLLGTANLLVWFGVLRYLGFFEKYNILILTMKKSAPNILRFLVCAGVFYFGFTVCGWVVLGPYHLKFRTLSVASECLFALVNGDELYVTFATIPNTGSYVWWYSR 482          
BLAST of Mucolipin-3 like protein vs. TrEMBL
Match: A0A2H1WSC3 (SFRICE_032943 OS=Spodoptera frugiperda OX=7108 GN=SFRICE_032943 PE=4 SV=1)

HSP 1 Score: 279.256 bits (713), Expect = 2.782e-80
Identity = 171/468 (36.54%), Postives = 276/468 (58.97%), Query Frame = 3
Query:  150 QLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLD-NI-PILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKK-TKQFFHNEINIDISDKWKY-FWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +LN+ +E+MRR L++ FMNP EKW+AK   P K ++ V+K+++VT Q+ LF+ N  N V++   ++ +F HLFL  W S+ E   YPP  GP A+YK+E+FY +++YA + Y  L + AIGPYSY  + NI P    C   Y+ G I  +N +Y F+ E + NC +    F+    ++F S+ ++ +    I F  L++A L FS+++I  ++      PDC +FDI I+FDN +H+GQM + L+AE     C   T  I+ +  I   L S+  + +I       +     I   Q  K+ T QFF    N D+S + +  F  I Y +I + DIL+I G+ +K +     +   D++ +C+ FLG G  L    ++RY  +F   ++++ T++ A P + RFS+C+ LLY  F   GW+ILGPYH+KFR++ ++  CLFSL+ GDDM+ T S+++  + +++ FS+
Sbjct:   46 ELNQMEEKMRRKLQFFFMNPIEKWKAKRKFPYKFVVQVIKIVLVTFQLCLFAHNRYNHVNYTWDNRITFSHLFLLGWDSTREINAYPPGAGPLAVYKIEEFYNTLDYAYDGYSNLTN-AIGPYSYNDESNIKPPPVFCQYNYKQGIINGFNESYEFNSEIVENCVN----FTKKDNEVFRSQSFIEKAGLNISFASLVRAKLMFSLKTINFRAAGPITPPDCYRFDIEIIFDNEDHDGQMSLILEAEPYKLTCKGDTAYITDN-KIDQVLRSILNILVILICAISFILCSRAIYRAQLLKELTVQFFRRAYNRDLSMEGRLEFLNIWYIMIIVNDILIIMGSAIK-EQIERNQFTNDQWNVCSLFLGTGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKIFRFSVCALLLYAGFMFCGWLILGPYHMKFRSLATTSECLFSLINGDDMFATFSIMSKKSPMLWWFSR 506          
BLAST of Mucolipin-3 like protein vs. TrEMBL
Match: A0A517BDY7 (Transient receptor potential cation channel, mucolipin OS=Heliconius melpomene OX=34740 PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 3.717e-79
Identity = 172/473 (36.36%), Postives = 277/473 (58.56%), Query Frame = 3
Query:  141 NNLQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN----IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKK-TKQFFHNEINIDIS-DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            N   L + +E+MRR L++ FMNP EKWRAK   P K ++ V+K+++VT+Q+ LF+ N  N V++   ++ SF HLFL  W S+ E   YPP  GP A+YKV++FY +++YA   Y  L + AIGPYSY  ++     PI   C  YY+ G I  +N +Y F+ E + +C +    F+N   ++F SKE+++     ++F  L++A+L FS+++I  ++      PDC +FDI I+FDN +H+GQM + L AE     C +   +   +  I   L S+  + +IF     ++     I   Q  K+ T  FFH   N ++S D    F  I Y +I I D L+I G+ +K +     +   D++ +C+ FLG G  L    ++RY  +F   ++++ T++ A P + RFS C+ LLY  F   GW++LGPYH+KFR++ ++  CLFSL+ GDDM+ T S+++  + +++ FS+
Sbjct:   40 NTSTLIQVEEKMRRKLQFFFMNPIEKWRAKRKFPYKFVVQVIKIVLVTLQLCLFAHNRYNHVNYTWDNRISFSHLFLLGWDSTREINAYPPGAGPLAVYKVDEFYNALDYAYTGYSNLSN-AIGPYSYNNEDNNKTDPIF--CTYYYKKGIIHGFNESYEFNSEIVYSCVN----FTNGENQLFKSKEFIKNVGIEVNFAALVRAELLFSLKTINFRAAGPITPPDCYRFDIKIIFDNEDHDGQMSLILDAEPFKLAC-KGDKAYVTNNQIDQILRSVLNILVIFICSISLILCSRAIYRAQLLKELTVHFFHRAYNKELSLDGRLEFLNIWYIMIIINDFLIIMGSAIK-EQIERNQFTNDQWNVCSMFLGIGNLLVWFGVLRYLGFFKTYNVVILTLKKAAPKIFRFSCCALLLYAGFMFCGWLVLGPYHMKFRSLATTSECLFSLINGDDMFATFSIMSRKSPMLWWFSR 503          
BLAST of Mucolipin-3 like protein vs. Ensembl Cavefish
Match: mcoln1a (mucolipin-1-like [Source:NCBI gene;Acc:103039116])

HSP 1 Score: 243.047 bits (619), Expect = 1.501e-70
Identity = 170/470 (36.17%), Postives = 266/470 (56.60%), Query Frame = 3
Query:  147 LQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY--GLD-NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            + + +++E +RR L+Y FM+P +K+ AKG  P K+ L +VK+IIVTVQ+VLF  +N   V+F E +  SFKHLFL  +    + L         A+Y   D Y S+ YA+E Y  L    +G Y+Y  G+  N   L+LC  YYR G I P N T+S       +C  + P+ + S    F   +Y   KNFT+ F+KL+   + F +++I L++   +E PDC  F I I+ DN  H+G++K+ L  E+    C    PS+S         ++ D+   +  +LSL+L  RS+        +  QFF + +N  +S  D+ ++  G  Y ++ I D+L I+G+ +K+    +  K+I  + +C   LG    L  + ++RY S+F K +IL+ T+R A P ++RF  C   +YL +   GWI+LGPYH+KFR++     CLFSL+ GDDM+VT S +  S+T+V++FSQ
Sbjct:   48 VTVEQEEEALRRKLKYFFMSPCDKFHAKGRKPFKLFLQLVKIIIVTVQLVLFGLSNQMVVTFKEENTASFKHLFLKGYDGESDAL---------AVYTQSDVYDSIYYAVEQYLALPETTVGRYAYVYGVGVNGSALSLCQQYYRRGWIDPANDTFSIDPHINTDCVGVTPLDTPSG---FIGSDY---KNFTLKFHKLINVTIQFQLKAINLQTIINNEIPDCYTFTITIVLDNKAHSGKVKISLDNEVAIKEC--KDPSVS-GHAENYARVTFDVAVAVVCLLSLLLCGRSIFRGVLLQHEFVQFFKDTLNRKVSWGDRMEFING-WYILLIISDLLTITGSFIKIG---IESKNIASYDVCGILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRAAFPNVIRFCCCVAAIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFSDMQESSTLVWVFSQ 495          
BLAST of Mucolipin-3 like protein vs. Ensembl Cavefish
Match: mcoln1a (mucolipin-1-like [Source:NCBI gene;Acc:103039116])

HSP 1 Score: 243.432 bits (620), Expect = 1.599e-70
Identity = 170/471 (36.09%), Postives = 268/471 (56.90%), Query Frame = 3
Query:  147 LQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY--GLD-NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKN-TLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            + + +++E +RR L+Y FM+P +K+ AKG  P K+ L +VK+IIVTVQ+VLF  +N   V+F E +  SFKHLFL  +    + L         A+Y   D Y S+ YA+E Y  L    +G Y+Y  G+  N   L+LC  YYR G I P N T+S       +C  + P+ + S    F   +Y   KNFT+ F+KL+   + F +++I L++   +E PDC  F I I+ DN  H+G++K+ L  E+     I+     S+S   +N   ++ D+   +  +LSL+L  RS+        +  QFF + +N  +S  D+ ++  G  Y ++ I D+L I+G+ +K+    +  K+I  + +C   LG    L  + ++RY S+F K +IL+ T+R A P ++RF  C   +YL +   GWI+LGPYH+KFR++     CLFSL+ GDDM+VT S +  S+T+V++FSQ
Sbjct:   48 VTVEQEEEALRRKLKYFFMSPCDKFHAKGRKPFKLFLQLVKIIIVTVQLVLFGLSNQMVVTFKEENTASFKHLFLKGYDGESDAL---------AVYTQSDVYDSIYYAVEQYLALPETTVGRYAYVYGVGVNGSALSLCQQYYRRGWIDPANDTFSIDPHINTDCVGVTPLDTPSG---FIGSDY---KNFTLKFHKLINVTIQFQLKAINLQTIINNEIPDCYTFTITIVLDNKAHSGKVKISLDNEVA----IKECKDPSVSGHAENYARVTFDVAVAVVCLLSLLLCGRSIFRGVLLQHEFVQFFKDTLNRKVSWGDRMEFING-WYILLIISDLLTITGSFIKIG---IESKNIASYDVCGILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRAAFPNVIRFCCCVAAIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFSDMQESSTLVWVFSQ 495          
BLAST of Mucolipin-3 like protein vs. Ensembl Cavefish
Match: mcoln1b (mucolipin 1b [Source:ZFIN;Acc:ZDB-GENE-130514-1])

HSP 1 Score: 228.024 bits (580), Expect = 2.451e-65
Identity = 155/462 (33.55%), Postives = 262/462 (56.71%), Query Frame = 3
Query:  174 MRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLD---NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTL-LSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +RR L+Y FM+P +K+ AKG  P K++L ++K++IVTVQ+VLF  +N   V F + +  +F+HLFL ++Q   + L         A++   D Y  M+YA++ Y  L   ++  Y+Y +    N   L+LC  YY+ G I P N T++     + +C  + P  ++ S  I D       KNFT+ F+KL+   + F +++I ++S   +E PDC  F + ILFDN  H+G++K+ L+ +     C    P++S     +N L ++ D+L  +   LSL L  RS++       + ++FF   +   +  +D+ ++  G  Y ++ I D+L I  + +K+ + T   K++  + +C   +G    L  + ++RY S+F K +IL+ T+R A P ++RF  C+  +YL +   GWI+LGPYH KFR++ +   CLFSL+ GDDM+ T S +  S T+V++FSQ
Sbjct:   31 LRRKLKYFFMSPCDKYHAKGRKPYKLVLQMLKIVIVTVQLVLFGLSNQMVVMFKDENTDTFRHLFLQDYQDDSDGL---------AVHTQSDVYQHMHYAIDQYLTLSQNSVSMYAYVMGSGVNASALSLCQRYYKKGRIDPVNDTFNIDPRIITDCIGVNPP-ADPSAPIPDDY-----KNFTLKFHKLINVTIKFKLKAINIQSIINNEIPDCYTFSVTILFDNRAHSGKVKISLRNQAVITEC--RDPNVSGHK--ENYLRVAFDVLVAVVCGLSLALCGRSILRGIALQHEFERFFRQSLGRQVCWADRMEFING-WYLLLIISDVLTIIASFIKIGIET---KNLSSYDVCGILMGTSTLLVWVGVIRYLSFFQKYNILIVTLRAAFPSVIRFCCCAAAIYLGYVFCGWIVLGPYHAKFRSLSTVSECLFSLINGDDMFATFSEVERSGTLVWLFSQ 469          
BLAST of Mucolipin-3 like protein vs. Ensembl Cavefish
Match: MCOLN3 (mucolipin 3 [Source:NCBI gene;Acc:103027252])

HSP 1 Score: 216.468 bits (550), Expect = 5.068e-61
Identity = 153/469 (32.62%), Postives = 263/469 (56.08%), Query Frame = 3
Query:  150 QLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN---IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            Q   + E  RR L+Y FMNP EK+RA+G  P K++L ++K+ ++T+Q+V F  +N   V+F E +  +FKHLFL ++           S   +A+Y   + Y  +++ +  + +L +  +G +++  D     P+L +C  +Y  G I P N T+    +    C +I P+  +S   + D+       NFT+ F +LL+ ++ F++++I L++ +  E PDC  F+I I F+N  H+G++KV L  ++    C     + +    I  T+L  D++ ++  + SL+L +RSL    Q   +   FF  H    +  SD+ ++  G  Y +I I DIL I+G++LK+    +  K +  + +C+  LG G  L  + ++RY  YF K +IL+ T+R A P ++RF  C+ L+YL +   GWI+LGPYH KFRT+++   CLFSL+ GDDM+ T   +   + +V++FS+
Sbjct:   29 QAQREVESFRRKLKYFFMNPCEKYRARGRKPWKLMLQIIKIAVITIQLVSFGLSNQMVVTFKEENLMAFKHLFLKDYSDH--------SPNTYAVYTQAEVYTHLSHIVGQFLRLRNITVGNHAHDKDGRFFTPLL-ICQQFYHNGSISPSNETFEIDAQVEEECLEIYPVQPSS---LPDAD----LSNFTLQFKRLLEVNVYFTLKAINLQTVQHHELPDCYDFNITIRFNNRAHSGRIKVDLDNDVDINECKDWKVTGASPKKIYYTVL-FDVVIILTCLASLVLCTRSLSTGVQLQFEYADFFVKHYGKRVSWSDRMEFING-WYILIVISDILTITGSVLKI---AIQLKALTSYDVCSILLGTGTMLVWIGVLRYMGYFKKYNILIITLRAAFPNVIRFCCCAGLIYLGYCFCGWIVLGPYHEKFRTLNTVSECLFSLINGDDMFATFKNMQQKSYLVWLFSR 476          
BLAST of Mucolipin-3 like protein vs. Ensembl Cavefish
Match: MCOLN3 (mucolipin 3 [Source:NCBI gene;Acc:103027252])

HSP 1 Score: 216.468 bits (550), Expect = 5.068e-61
Identity = 153/469 (32.62%), Postives = 263/469 (56.08%), Query Frame = 3
Query:  150 QLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDN---IPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFF--HNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            Q   + E  RR L+Y FMNP EK+RA+G  P K++L ++K+ ++T+Q+V F  +N   V+F E +  +FKHLFL ++           S   +A+Y   + Y  +++ +  + +L +  +G +++  D     P+L +C  +Y  G I P N T+    +    C +I P+  +S   + D+       NFT+ F +LL+ ++ F++++I L++ +  E PDC  F+I I F+N  H+G++KV L  ++    C     + +    I  T+L  D++ ++  + SL+L +RSL    Q   +   FF  H    +  SD+ ++  G  Y +I I DIL I+G++LK+    +  K +  + +C+  LG G  L  + ++RY  YF K +IL+ T+R A P ++RF  C+ L+YL +   GWI+LGPYH KFRT+++   CLFSL+ GDDM+ T   +   + +V++FS+
Sbjct:   29 QAQREVESFRRKLKYFFMNPCEKYRARGRKPWKLMLQIIKIAVITIQLVSFGLSNQMVVTFKEENLMAFKHLFLKDYSDH--------SPNTYAVYTQAEVYTHLSHIVGQFLRLRNITVGNHAHDKDGRFFTPLL-ICQQFYHNGSISPSNETFEIDAQVEEECLEIYPVQPSS---LPDAD----LSNFTLQFKRLLEVNVYFTLKAINLQTVQHHELPDCYDFNITIRFNNRAHSGRIKVDLDNDVDINECKDWKVTGASPKKIYYTVL-FDVVIILTCLASLVLCTRSLSTGVQLQFEYADFFVKHYGKRVSWSDRMEFING-WYILIVISDILTITGSVLKI---AIQLKALTSYDVCSILLGTGTMLVWIGVLRYMGYFKKYNILIITLRAAFPNVIRFCCCAGLIYLGYCFCGWIVLGPYHEKFRTLNTVSECLFSLINGDDMFATFKNMQQKSYLVWLFSR 476          
BLAST of Mucolipin-3 like protein vs. Ensembl Nematostella
Match: EDO42542 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S161])

HSP 1 Score: 179.489 bits (454), Expect = 4.554e-49
Identity = 145/467 (31.05%), Postives = 246/467 (52.68%), Query Frame = 3
Query:  171 RMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYS--YGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFW------GIAYFIIFIGDILVISGTILKM--DMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            ++R+ L+ HFM P +K++ +G  P K+++ ++K+IIVT Q+ LF     + V ++E +  +F HLF+ N   +         NG  AIY    FY  + + L  YY +  +A+G YS    +     L LC   Y+ G + P N TY+F++ T  +C D+ P      ++  +  E+  R N    F + +   L   ++S+ ++ +     P C  F++ I+FDNS H+G++ V L A+    +C       +  L     L  LDI  ++   +S  L +RSL   ++  K T++FF ++++  +S     +W       + + +I I D   + G++LK+  D   L+  D      C+ FLG G+ L    ++RY  Y  + +IL+ T+R + P +LRF +C+ LLY  F   GWI+LGPYH KFRT+     C+FSL+ GDDM++T   +   +T V++FS+
Sbjct:    1 QIRKRLKSHFMTPYQKFKHRGRKPWKLLIQLIKIIIVTAQVCLFGNELFSIVDYLENNLDTFNHLFILNSTRA---------NGG-AIYTRTQFYTQVRHTLNQYYAISQDAVGVYSPPTVMGQQTPLKLCTYSYKQGFVDPGNATYTFNRCTNYSCFDLLP----PRKEDRNITEFRLRNNLPYTFERYIFISLIAEIKSLHIQKH-----PQCFTFNVTIVFDNSKHDGKIPVTLDADGIMDDCGGGLEESNQYL-----LTVLDIFVMVICAISYFLCARSLYKHFRLVKTTRRFFADQLDDHLS-----YWDCLDLISLWFILILISDTCTVIGSLLKILIDWEVLSNYDT-----CSIFLGTGVLLTWTGVLRYLGYMKQYNILLVTLRASAPSVLRFCVCAALLYFGFMFCGWIVLGPYHPKFRTLSMVSECMFSLINGDDMFMTYKEMQDHSTAVWVFSK 433          
BLAST of Mucolipin-3 like protein vs. Ensembl Nematostella
Match: EDO42580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S163])

HSP 1 Score: 166.777 bits (421), Expect = 1.695e-44
Identity = 148/467 (31.69%), Postives = 249/467 (53.32%), Query Frame = 3
Query:  174 MRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNI----PILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISI---SLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEIN--IDISDKWKYF--WGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +R  + YHFMNP EK++A+   P K+++ + K+IIVTVQ+ LF  +  + V+F++ ++ + ++LFL ++           +N    +Y     Y+ + YA E YY +  EA G Y+Y   +I    P + LC  YY+  E+   +++Y+F   T+IN  D  P       K  D +  +   +F  +F +LL   L F + +I LK  +  + P C Q ++ +LFDN   +GQM + L  E     C   +   SI   S +I+  L+  D L ++  + SL LS RSLI   +  K    F  NE    + +SD    F  W +   I  I  IL   G+I KM    + +KD + + +C+  LG  + L    L+R+  YF + ++L+ T++ + P +LRF +C+ +L+L F+  GWI++GPY+ KFR    +   L+SL+ GDDMY T +++N  +  ++++S+
Sbjct:    2 LRAQIEYHFMNPWEKYKARNRKPWKLLIQIFKIIIVTVQVYLFGADRFSVVNFMDDNQEALRYLFLKDYGGD--------ANAVRTVYTKNQVYMYLKYAHEQYYNIA-EAAGSYAYTDLDIFGDPPAVRLCYDYYKQVELNASSNSYTFD-PTVINECDFLP-------KPHDHQHIITNTSF--NFGRLLSLKLDFLLNAINLKGVKAWDKPTCYQLNVTLLFDNKKRDGQMPINLNLENNWLQCKADSQIHSIDSYSTIIRILLIVFDSLVVVVCLASLTLSVRSLIKCLKLIKARAFFIANEDQDPLSLSDAMDLFNWWFVIIIISDILTIL---GSIYKM---AIDQKDSNFYDVCSLLLGIAVLLVWTGLLRFLGYFKQYNVLLLTLKASGPSILRFCVCAGVLFLGFTFCGWIVIGPYNTKFRDTTVTAEALYSLVNGDDMYNTYAMVNPESKAIWVYSK 443          
BLAST of Mucolipin-3 like protein vs. Ensembl Medaka
Match: mcoln1a (mucolipin-1 [Source:NCBI gene;Acc:101164208])

HSP 1 Score: 223.787 bits (569), Expect = 2.499e-63
Identity = 156/468 (33.33%), Postives = 272/468 (58.12%), Query Frame = 3
Query:  156 NEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLD---NIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKN-TLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +E++E +RR L+Y FM+P +K+ AKG  P K+IL ++K+IIVT Q+VLF  +N   V+F E +  +FKHLFL ++  +        +   FA+Y  +D Y  + + +E Y  L    +G Y+Y  D   N   L+LC  YY+ G I P N T+S   +   +C  + P+ +  S+++  S      +NFT+ F+KL+   + F +++I +++   +E PDC  F I ++ DN  H+G++K+ L+ + T    I+     S+S   +N T ++ D+   +  +LSL+L  RS++      ++  ++F   ++  +S  D+ ++  G  + ++ I DI  ++G+I+K+    +  K++  + LC   LG    L  + ++RY ++F K +IL+ T+R A P ++RF  C  ++YL +   GWI+LGPYH+KFR++     CLFSL+ GDDM+VT S +  S+ +V++FSQ
Sbjct:   60 DEEEEALRRKLKYFFMSPCDKYHAKGRKPFKLILQLLKIIIVTAQLVLFGLSNQVVVTFKEENTMTFKHLFLKDYDDA--------TGDSFAVYTQQDVYDHIFHVVEKYLTLPETTVGRYAYVYDVGVNGSALSLCQQYYKRGRIDPANDTFSIDPQIKTDCIGVNPL-AVPSQRLGSS-----YRNFTLKFHKLINVTIEFQLKAINIQTIINNEIPDCYTFYITVVLDNKAHSGKVKIWLENKAT----IKECKDPSVSGHAENYTRVAFDVAVAVVCLLSLLLCGRSILRGIMLQQEYVRYFKENLDRPVSWTDRLEFING-WFILLIISDIFTVTGSIIKIG---IESKNMSSYDLCGILLGTSTLLVWVGVIRYLTFFQKYNILIITLRAAFPNVIRFCCCVAVIYLGYCFCGWIVLGPYHVKFRSLSMVSECLFSLINGDDMFVTFSEMQESSNLVWLFSQ 505          
BLAST of Mucolipin-3 like protein vs. Ensembl Medaka
Match: mcoln1b (mucolipin-1 [Source:NCBI gene;Acc:101160414])

HSP 1 Score: 220.32 bits (560), Expect = 3.092e-62
Identity = 156/463 (33.69%), Postives = 258/463 (55.72%), Query Frame = 3
Query:  174 MRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPI----LTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSL-DXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDIS--DKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +RR L+Y FM+P +K+ AKG  P K+ L ++K++IVTVQ+V+F  +N   V+F E +  +FKHLFL ++Q           N P A++   + +  +NY LE Y  L   A+G Y+Y +  + +    L+LC  Y+R G I P N T+      L +C  + P   +S+ +  D        NFT+ F+KL+   + F +++I +++   +E PDC  F I IL DN  H+G++ + L    T    IQ     ++S   ++    L D L ++  VLSL+L  RS++       +  QFF +++   +S  D+ ++  G  Y ++ I D+  I G+ +K+    +  K +  + +C   LG    L  + ++RY S+F K +IL+ T+R A P ++RF  C   +YL +   GWI+LGPYH KFR++ +   CLFSL+ GDDM+VT + +  S+++V++FSQ
Sbjct:   65 LRRKLKYFFMSPCDKYHAKGRKPFKLGLQLLKILIVTVQLVMFGLSNQMVVTFKEENTATFKHLFLKDYQD----------NVPQAVHTQAELHDHINYTLERYLALPEIALGRYAY-VTGVGVRGSALSLCQRYFRRGSIEPVNDTFDIDPHVLTDCLGVNPTTEDSTPENGD------LHNFTLHFSKLINVTMDFQLKAINVQTILNNEIPDCYTFAITILMDNKAHSGRVGISLHNRAT----IQECKDPNVSGHAESYARELFDCLVVVVCVLSLLLCGRSVLRGILLQHEYVQFFKHKLARGVSWGDRMEFING-WYILLIISDMFTIIGSFIKIG---IESKTLSSYDVCGILLGTSTLLVWVGVIRYLSFFQKYNILIVTLRAAFPNVIRFCCCVAAIYLGYCFCGWIVLGPYHTKFRSLSTVSECLFSLINGDDMFVTFAEMEQSSSLVWVFSQ 502          
BLAST of Mucolipin-3 like protein vs. Ensembl Medaka
Match: mcoln2 (mucolipin 2 [Source:NCBI gene;Acc:101158932])

HSP 1 Score: 218.779 bits (556), Expect = 7.468e-62
Identity = 150/468 (32.05%), Postives = 252/468 (53.85%), Query Frame = 3
Query:  165 QERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPIL---TLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKN---FTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNT--LLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI-SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            +ER+R DL+Y+FM+P EK+RA+  +P KM + ++K++++T Q+V F  NN   VS+ E +  + K+LF+  +    E       +   A+Y   D Y S+ Y L+ Y +L   ++G  SY  D   +L   T+C  YY+ G + P +  Y    +    C +  P  +N            R++N   F +DF +L+   + F+++ I L++    E PDC  F + I FDN +H+G++K+ L  +  S  C     S +     KNT  LL  D   ++  ++S  L +RS+I   +  ++  QFF    +  +  D  K F    Y ++ + D+L I G+ILKM+   +  K +  + +C+ FLG    L  + ++RY  YF K ++L+ T++ A P +LRF  C+ ++YL ++  GWI+LGPYH KF  +     CLFSL+ GDDM+ T + +   N +V++FS+
Sbjct:   25 EERLRDDLKYYFMSPCEKYRARRHIPWKMGVQILKIVMITTQLVFFGLNNQLVVSYKEENTMALKNLFIKGYSGVDE------DDFSIAVYTQRDVYDSLFYVLDQYSQLGELSVGAISYAEDEDGLLLPLTVCKEYYKRGSLKPSDEAYDIDAQLETLCMEHDPRTANQ----------WRKQNSSFFDLDFYRLVNIKVTFNLKGINLQTVRSRELPDCYSFYVMITFDNESHSGKVKLYLDIDAESSACQDWKISGTAQ---KNTHYLLVFDGFVILVCIISTTLCTRSIILAVRLLQRFSQFFQEHFDRKVCEDDQKEFLNGWYVLVIVSDVLTIIGSILKME---IQAKSLTSYDVCSIFLGTSTLLVWVGVIRYLGYFQKYNVLILTMKAAFPKVLRFCCCAGMIYLGYTFCGWIVLGPYHEKFEGLSRVAECLFSLLNGDDMFTTFAQLKDKNILVWLFSR 470          
BLAST of Mucolipin-3 like protein vs. Ensembl Medaka
Match: MCOLN3 (mucolipin-3-like [Source:NCBI gene;Acc:101169350])

HSP 1 Score: 214.542 bits (545), Expect = 2.734e-60
Identity = 148/466 (31.76%), Postives = 256/466 (54.94%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY---GLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            E+ E +RR ++Y+FMNP EK+ A+G  P K++L ++K+ I+T+Q+V F  +N   V F E +  +F+HLFL ++               +AIY+  D Y  + Y +  +  L +  +G + +   G    P L LC  ++R G I+P N T+         C D+ P+F+ S+++I         ++F + F +LL   + F +++I L++    E PDC  F + I  DN  H+G++ V L+ ++    C     S +    I  T++  D L +   ++S  L +RS++   +   +  +F       D+  SDK ++  G  Y +I + D L I+G+ILK+++ T   K +  + +C+ FLG G     + ++RY  YF K +IL+ T+R A P ++RF  C+ ++YL++   GW++LGPYH KFR++++   CLFSL+ GDDM+ T   +   N +V+IFS+
Sbjct:   31 EEVEALRRKIKYYFMNPCEKYHARGRKPWKLLLQIIKIGIITIQLVSFGLSNQMVVEFKEENLMTFRHLFLKDYVDG--------DKETYAIYRQADVYDQIEYIITQFRLLHNNTVGNHEFEKNGTAYSP-LRLCQEFFRNGSIYPGNETFEIDANVDSECLDVYPMFTPSAKEIL--------QHFKVHFKRLLSVKIVFVLKAINLQTVRHRELPDCYDFTVFITLDNQAHSGRIAVQLENDVEINECRDWKVSGAAGKSIYLTVV-FDCLIITTCIISFALCTRSVVTGIKLMLEYSRFCDRRCGKDVPWSDKLEFVSG-WYILIIVSDTLTITGSILKIEIQT---KILTTYDVCSIFLGIGTMFVWIGVIRYMGYFRKYNILLLTLRAAFPNVIRFICCAGIIYLSYCFCGWVVLGPYHEKFRSLNTVSECLFSLINGDDMFPTFKDMQQKNNLVWIFSR 474          
BLAST of Mucolipin-3 like protein vs. Ensembl Medaka
Match: MCOLN3 (mucolipin-3-like [Source:NCBI gene;Acc:101169350])

HSP 1 Score: 214.542 bits (545), Expect = 2.734e-60
Identity = 148/466 (31.76%), Postives = 256/466 (54.94%), Query Frame = 3
Query:  159 EDQERMRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSY---GLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDI--SDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQ 1541
            E+ E +RR ++Y+FMNP EK+ A+G  P K++L ++K+ I+T+Q+V F  +N   V F E +  +F+HLFL ++               +AIY+  D Y  + Y +  +  L +  +G + +   G    P L LC  ++R G I+P N T+         C D+ P+F+ S+++I         ++F + F +LL   + F +++I L++    E PDC  F + I  DN  H+G++ V L+ ++    C     S +    I  T++  D L +   ++S  L +RS++   +   +  +F       D+  SDK ++  G  Y +I + D L I+G+ILK+++ T   K +  + +C+ FLG G     + ++RY  YF K +IL+ T+R A P ++RF  C+ ++YL++   GW++LGPYH KFR++++   CLFSL+ GDDM+ T   +   N +V+IFS+
Sbjct:   31 EEVEALRRKIKYYFMNPCEKYHARGRKPWKLLLQIIKIGIITIQLVSFGLSNQMVVEFKEENLMTFRHLFLKDYVDG--------DKETYAIYRQADVYDQIEYIITQFRLLHNNTVGNHEFEKNGTAYSP-LRLCQEFFRNGSIYPGNETFEIDANVDSECLDVYPMFTPSAKEIL--------QHFKVHFKRLLSVKIVFVLKAINLQTVRHRELPDCYDFTVFITLDNQAHSGRIAVQLENDVEINECRDWKVSGAAGKSIYLTVV-FDCLIITTCIISFALCTRSVVTGIKLMLEYSRFCDRRCGKDVPWSDKLEFVSG-WYILIIVSDTLTITGSILKIEIQT---KILTTYDVCSIFLGIGTMFVWIGVIRYMGYFRKYNILLLTLRAAFPNVIRFICCAGIIYLSYCFCGWVVLGPYHEKFRSLNTVSECLFSLINGDDMFPTFKDMQQKNNLVWIFSR 474          
BLAST of Mucolipin-3 like protein vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 1092.8 bits (2825), Expect = 0.000e+0
Identity = 649/651 (99.69%), Postives = 651/651 (100.00%), Query Frame = 3
Query:  174 MRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNIXXXXXXXXXXNYGSLXXXXXXXXXXXXXFAGMVVDLNRQNRKRKRTSQVAPVIPSRDRCLSI 2126
            MRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPN+RRKDSRRRRDNYGSLINNIVRSNSIRNIFAGMVVDLNRQNRKRKRTSQVAPV+PSRDRCLSI
Sbjct:    1 MRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNMRRKDSRRRRDNYGSLINNIVRSNSIRNIFAGMVVDLNRQNRKRKRTSQVAPVVPSRDRCLSI 651          
BLAST of Mucolipin-3 like protein vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 1071.23 bits (2769), Expect = 0.000e+0
Identity = 640/642 (99.69%), Postives = 642/642 (100.00%), Query Frame = 3
Query:  201 MNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNIXXXXXXXXXXNYGSLXXXXXXXXXXXXXFAGMVVDLNRQNRKRKRTSQVAPVIPSRDRCLSI 2126
            MNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPN+RRKDSRRRRDNYGSLINNIVRSNSIRNIFAGMVVDLNRQNRKRKRTSQVAPV+PSRDRCLSI
Sbjct:    1 MNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNMRRKDSRRRRDNYGSLINNIVRSNSIRNIFAGMVVDLNRQNRKRKRTSQVAPVVPSRDRCLSI 642          
BLAST of Mucolipin-3 like protein vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 1054.28 bits (2725), Expect = 0.000e+0
Identity = 624/651 (95.85%), Postives = 626/651 (96.16%), Query Frame = 3
Query:  174 MRRDLRYHFMNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNIXXXXXXXXXXNYGSLXXXXXXXXXXXXXFAGMVVDLNRQNRKRKRTSQVAPVIPSRDRCLSI 2126
            MRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPN+RRKDSRRRRDNYGSLI                       N  RKRTSQVAPV+PSRDRCLSI
Sbjct:    1 MRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNMRRKDSRRRRDNYGSLI----------------------NNIVRKRTSQVAPVVPSRDRCLSI 629          
BLAST of Mucolipin-3 like protein vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 1034.25 bits (2673), Expect = 0.000e+0
Identity = 615/642 (95.79%), Postives = 617/642 (96.11%), Query Frame = 3
Query:  201 MNPKEKWRAKGTLPIKMXXXXXXXXXXXXXXXXFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNIXXXXXXXXXXNYGSLXXXXXXXXXXXXXFAGMVVDLNRQNRKRKRTSQVAPVIPSRDRCLSI 2126
            MNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPN+RRKDSRRRRDNYGSLI                       N  RKRTSQVAPV+PSRDRCLSI
Sbjct:    1 MNPKEKWRAKGTLPIKMILIVVKLIIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNMRRKDSRRRRDNYGSLI----------------------NNIVRKRTSQVAPVVPSRDRCLSI 620          
BLAST of Mucolipin-3 like protein vs. Planmine SMEST
Match: SMESG000015162.1 (SMESG000015162.1)

HSP 1 Score: 1001.89 bits (2589), Expect = 0.000e+0
Identity = 582/609 (95.57%), Postives = 584/609 (95.89%), Query Frame = 3
Query:  300 FSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDXXXXXXXXXXXXXXXXXXXXXYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYXXXXXXXXXHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNIXXXXXXXXXXNYGSLXXXXXXXXXXXXXFAGMVVDLNRQNRKRKRTSQVAPVIPSRDRCLSI 2126
            FSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPN+RRKDSRRRRDNYGSLI                       N  RKRTSQVAPV+PSRDRCLSI
Sbjct:   18 FSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNGPFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYRYGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTIDFNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVGLQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLINLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILKMDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIRVAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLMLGDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYEEAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYITKKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYLGTIPNMRRKDSRRRRDNYGSLI----------------------NNIVRKRTSQVAPVVPSRDRCLSI 604          
The following BLAST results are available for this feature:
BLAST of Mucolipin-3 like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCOLN21.989e-5931.28mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357][more]
MCOLN22.838e-5931.70mucolipin 2 [Source:HGNC Symbol;Acc:HGNC:13357][more]
MCOLN37.482e-5932.85mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358][more]
MCOLN19.384e-5730.96mucolipin 1 [Source:HGNC Symbol;Acc:HGNC:13356][more]
MCOLN34.256e-4231.94mucolipin 3 [Source:HGNC Symbol;Acc:HGNC:13358][more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cup-55.969e-5230.66CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-55.969e-5230.66CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-51.308e-5130.72CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-51.308e-5130.72CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
cup-51.323e-5130.66CUP-5L [Source:UniProtKB/TrEMBL;Acc:Q8T666][more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Trpml6.837e-7134.69gene:FBgn0262516 transcript:FBtr0074952[more]
CG426386.837e-7134.69gene:FBgn0261361 transcript:FBtr0302283[more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln1a2.938e-6634.26mucolipin 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2704... [more]
mcoln1b2.943e-6132.62mucolipin 1b [Source:ZFIN;Acc:ZDB-GENE-130514-1][more]
mcoln3a1.875e-5731.40mucolipin 3a [Source:ZFIN;Acc:ZDB-GENE-121116-4][more]
MCOLN37.783e-5631.31mucolipin 3b [Source:NCBI gene;Acc:100001113][more]
MCOLN39.269e-5631.61mucolipin 3b [Source:NCBI gene;Acc:100001113][more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln12.322e-7035.85mucolipin 1 [Source:NCBI gene;Acc:496811][more]
mcoln12.543e-7035.85mucolipin 1 [Source:NCBI gene;Acc:496811][more]
wdsub12.762e-6733.48WD repeat, sterile alpha motif and U-box domain co... [more]
wdsub11.167e-6633.05WD repeat, sterile alpha motif and U-box domain co... [more]
wdsub11.594e-6633.05WD repeat, sterile alpha motif and U-box domain co... [more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcoln31.077e-6232.41mucolipin 3 [Source:MGI Symbol;Acc:MGI:1890500][more]
Mcoln17.858e-5932.85mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498][more]
Mcoln27.868e-5830.00mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529][more]
Mcoln28.930e-5830.84mucolipin 2 [Source:MGI Symbol;Acc:MGI:1915529][more]
Mcoln19.288e-850.00mucolipin 1 [Source:MGI Symbol;Acc:MGI:1890498][more]
back to top
BLAST of Mucolipin-3 like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R4F0|MCLN3_MOUSE7.531e-6232.41Mucolipin-3 OS=Mus musculus OX=10090 GN=Mcoln3 PE=... [more]
sp|F6RG56|MCLN3_CALJA8.963e-5932.83Mucolipin-3 OS=Callithrix jacchus OX=9483 GN=MCOLN... [more]
sp|Q8IZK6|MCLN2_HUMAN9.551e-5931.28Mucolipin-2 OS=Homo sapiens OX=9606 GN=MCOLN2 PE=1... [more]
sp|Q8TDD5|MCLN3_HUMAN3.593e-5832.85Mucolipin-3 OS=Homo sapiens OX=9606 GN=MCOLN3 PE=1... [more]
sp|Q99J21|MCLN1_MOUSE5.497e-5832.85Mucolipin-1 OS=Mus musculus OX=10090 GN=Mcoln1 PE=... [more]
back to top
BLAST of Mucolipin-3 like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A077LDL10.000e+060.17Transient receptor potential ion channel ML a (Fra... [more]
A0A517BE802.893e-8135.74Transient receptor potential cation channel, mucol... [more]
R7UMX73.965e-8135.17PKD_channel domain-containing protein OS=Capitella... [more]
A0A2H1WSC32.782e-8036.54SFRICE_032943 OS=Spodoptera frugiperda OX=7108 GN=... [more]
A0A517BDY73.717e-7936.36Transient receptor potential cation channel, mucol... [more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln1a1.501e-7036.17mucolipin-1-like [Source:NCBI gene;Acc:103039116][more]
mcoln1a1.599e-7036.09mucolipin-1-like [Source:NCBI gene;Acc:103039116][more]
mcoln1b2.451e-6533.55mucolipin 1b [Source:ZFIN;Acc:ZDB-GENE-130514-1][more]
MCOLN35.068e-6132.62mucolipin 3 [Source:NCBI gene;Acc:103027252][more]
MCOLN35.068e-6132.62mucolipin 3 [Source:NCBI gene;Acc:103027252][more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO425424.554e-4931.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO425801.695e-4431.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Mucolipin-3 like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcoln1a2.499e-6333.33mucolipin-1 [Source:NCBI gene;Acc:101164208][more]
mcoln1b3.092e-6233.69mucolipin-1 [Source:NCBI gene;Acc:101160414][more]
mcoln27.468e-6232.05mucolipin 2 [Source:NCBI gene;Acc:101158932][more]
MCOLN32.734e-6031.76mucolipin-3-like [Source:NCBI gene;Acc:101169350][more]
MCOLN32.734e-6031.76mucolipin-3-like [Source:NCBI gene;Acc:101169350][more]
back to top
BLAST of Mucolipin-3 like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015162.10.000e+099.69SMESG000015162.1[more]
SMESG000015162.10.000e+099.69SMESG000015162.1[more]
SMESG000015162.10.000e+095.85SMESG000015162.1[more]
SMESG000015162.10.000e+095.79SMESG000015162.1[more]
SMESG000015162.10.000e+095.57SMESG000015162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025889 ID=SMED30025889|Name=Mucolipin-3 like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2356bp
AATGAATATTGACACTTTCTAATTGAAATATTTCAAACATTGATTTTACA
CTTCTAAATTATATGAAATAAATTTTCATCTTTTATTTTGATGTAAGCCT
AAAACAGATTACAAAATAAAAAATGCAGAGATACAGCATCAATAATCTCC
AGCTGAATGAAGACCAAGAACGAATGCGGCGTGACTTGCGTTACCATTTT
ATGAACCCAAAAGAAAAGTGGCGCGCAAAGGGAACTTTGCCCATTAAAAT
GATTCTGATTGTGGTCAAATTGATTATTGTCACAGTGCAAATTGTTTTAT
TCAGTGAAAATAATTCTAATGAAGTCTCATTTGTTGAAGGATCCAAAACA
TCTTTTAAGCATTTATTTCTCTATAATTGGCAATCTTCCTTTGAAACATT
ACCTTACCCACCAAGCAATGGTCCATTTGCCATTTATAAAGTTGAGGATT
TCTATTTATCAATGAATTATGCATTGGAAAACTATTATAAACTGGAACAC
GAAGCAATTGGACCGTATAGTTATGGGCTTGACAACATTCCAATTTTGAC
TTTGTGCATTGTTTACTATCGATATGGGGAGATTTTTCCTTACAATCACA
CCTACAGCTTTTCTCAGGAAACTCTAATAAACTGTACTGACATCAAACCG
ATTTTCAGCAACAGTTCGGAGAAAATTTTCGATTCTAAAGAATATCTTAG
GAGAAAAAATTTCACAATAGATTTTAACAAACTGTTGAAGGCAGATCTTG
CATTTTCCGTCCGTAGCATTCAATTGAAATCTTATGAAATGGATGAAAGT
CCTGATTGTTTACAATTTGACATTGCTATATTATTTGATAATAGCAATCA
TAATGGGCAAATGAAAGTGGGCCTCCAGGCGGAGATGACTTCATTCAATT
GTATTCAAAGCACTCCATCTATATCAATATCATTAATGATAAAAAATACT
CTTTTATCATTGGATATTCTGGCGTTGATATTTAGCGTTCTATCGCTCAT
TCTCAGTAGCCGATCATTAATCAACCTGTACCAGTTTTGGAAAAAAACAA
AACAATTTTTCCATAACGAAATCAACATAGATATATCAGATAAATGGAAA
TATTTCTGGGGAATCGCCTATTTTATTATATTCATAGGAGACATCCTTGT
CATATCTGGTACAATACTCAAAATGGACATGTATACATTGACGAAAAAAG
ACATTGATAGATTCACATTGTGTAACTATTTTCTTGGATTTGGACTTTTC
TTGGGGCATTTGACACTCGTTCGATATTTCAGTTACTTTCCAAAAAGCAG
TATTCTTGTCAATACAATTCGAGTTGCCATGCCTCCACTTTTGAGATTTT
CATTGTGCTCAACTCTTCTATATTTGGCATTTTCACTTCTTGGTTGGATT
ATCCTCGGTCCTTATCACATTAAATTTCGAACCATTGACAGTTCAATAGC
TTGTCTTTTCTCATTAATGCTAGGAGATGACATGTATGTCACCTTGTCAG
TGATCAACCATTCGAATACTGTTGTTTATATTTTCTCTCAACTATTTATT
TATTTATTTTGCGTTTTATTTATTTTTGTTGTTCTCAATTTAATCCTGAC
GATCATCTATGAGGCCTATGAAGAAGCAGAGAAACAAGAGGCTTATGGAG
GTTCAGTCGATGCATTCTGGGACTTCATAAATTCTTGTCCTGAATCCAAT
AGTTATTCATTATATAAAGATGATGTTATCCACGATCAAAATATAAGTAA
GAAAAGAAAGCAATACATCACAAAGAAATGCGTGGACATTCTCTGCTGTT
GTGTTGGAAAAGCGAATCATAATATAGAAATAATAACTGATGATGATAGG
GAAAATGAGGAAATTGAAATTTCCAGCAATTTTGCGCGAAGTCGTGGTGT
ATCCGTTGATTTAAATTACCTCGGCACTATTCCGAATATACGACGAAAGG
ATAGCCGGCGTCGAAGAGACAATTACGGATCTTTGATCAACAACATAGTT
AGATCTAATTCGATTCGAAATATTTTTGCTGGCATGGTTGTTGACCTCAA
TAGGCAAAATAGAAAAAGAAAAAGAACAAGCCAGGTCGCTCCAGTGATTC
CTTCGAGAGACCGATGTCTATCAATTTAAACGCACATATTTTAGAATAAC
TTTTGCTCCAGATTTATCGGAATTTACAATATCTAGCACATTGAAGCACT
GAATGATATTGATTAATAAATGACCAATCTTATATTCAATAAATATGTGC
TACACATTGATATTATTGAACGTAATAATTCTGATCGGTCTTTATGAATA
GCTTTGTCAGATAAATATTTTACGTTATTATTATATTAATAAACCATATT
AGAGAC
back to top

protein sequence of SMED30025889-orf-1

>SMED30025889-orf-1 ID=SMED30025889-orf-1|Name=SMED30025889-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=669bp
MQRYSINNLQLNEDQERMRRDLRYHFMNPKEKWRAKGTLPIKMILIVVKL
IIVTVQIVLFSENNSNEVSFVEGSKTSFKHLFLYNWQSSFETLPYPPSNG
PFAIYKVEDFYLSMNYALENYYKLEHEAIGPYSYGLDNIPILTLCIVYYR
YGEIFPYNHTYSFSQETLINCTDIKPIFSNSSEKIFDSKEYLRRKNFTID
FNKLLKADLAFSVRSIQLKSYEMDESPDCLQFDIAILFDNSNHNGQMKVG
LQAEMTSFNCIQSTPSISISLMIKNTLLSLDILALIFSVLSLILSSRSLI
NLYQFWKKTKQFFHNEINIDISDKWKYFWGIAYFIIFIGDILVISGTILK
MDMYTLTKKDIDRFTLCNYFLGFGLFLGHLTLVRYFSYFPKSSILVNTIR
VAMPPLLRFSLCSTLLYLAFSLLGWIILGPYHIKFRTIDSSIACLFSLML
GDDMYVTLSVINHSNTVVYIFSQLFIYLFCVLFIFVVLNLILTIIYEAYE
EAEKQEAYGGSVDAFWDFINSCPESNSYSLYKDDVIHDQNISKKRKQYIT
KKCVDILCCCVGKANHNIEIITDDDRENEEIEISSNFARSRGVSVDLNYL
GTIPNIRRKDSRRRRDNYGSLINNIVRSNSIRNIFAGMVVDLNRQNRKRK
RTSQVAPVIPSRDRCLSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005261cation channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0098655cation transmembrane transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0000240body wall musculature
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039031Mucolipin
IPR013122PKD1_2_channel
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013122Polycystin cation channel, PKD1/PKD2PFAMPF08016PKD_channelcoord: 349..484
e-value: 2.4E-10
score: 39.7
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 373..487
e-value: 6.1E-6
score: 28.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 630..651
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 389..411
NoneNo IPR availableTMHMMTMhelixcoord: 347..369
NoneNo IPR availableTMHMMTMhelixcoord: 261..283
NoneNo IPR availableTMHMMTMhelixcoord: 310..332
NoneNo IPR availableTMHMMTMhelixcoord: 457..479
IPR039031MucolipinPANTHERPTHR12127MUCOLIPINcoord: 1..548