Protein kinase domain-containing protein

Overview
NameProtein kinase domain-containing protein
Smed IDSMED30025887
Length (bp)2296
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein kinase domain-containing protein (SMED30025887) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30025887) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein kinase domain-containing protein (SMED30025887) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein kinase domain-containing protein (SMED30025887) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025887

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermal cellSMED30025887SMESG000074945.1 SMESG000074944.1 dd_Smed_v4_3571_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025887SMESG000074945.1 SMESG000074944.1 dd_Smed_v4_3571_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30025887SMESG000074945.1 SMESG000074944.1 dd_Smed_v4_3571_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 101.679 bits (252), Expect = 4.258e-22
Identity = 65/251 (25.90%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+   ++A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    +  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L       F+  CL  +P +RA+ TQL+ H F+
Sbjct:   34 EKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDS-PHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 101.293 bits (251), Expect = 7.476e-22
Identity = 70/255 (27.45%), Postives = 130/255 (50.98%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-----SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +     + IE  +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   31 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIED-EIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK3 (serine/threonine kinase 3 [Source:HGNC Symbol;Acc:HGNC:11406])

HSP 1 Score: 101.679 bits (252), Expect = 7.737e-22
Identity = 70/255 (27.45%), Postives = 130/255 (50.98%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-----SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +     + IE  +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   59 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLIED-EIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 306          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 100.523 bits (249), Expect = 1.600e-21
Identity = 65/251 (25.90%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+   ++A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    +  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L       F+  CL  +P +RA+ TQL+ H F+
Sbjct:   34 EKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDS-PHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFTDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Match: STK17B (serine/threonine kinase 17b [Source:HGNC Symbol;Acc:HGNC:11396])

HSP 1 Score: 92.0485 bits (227), Expect = 3.277e-19
Identity = 76/273 (27.84%), Postives = 132/273 (48.35%), Query Frame = 3
Query: 1383 QIYSGSFYKFHEALEKTKNE----KILIKKYQIGDLKL-ILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQG--------VMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDAN---DDVKLFNLNFSKYTDYRKPSSSIKKCLFV-RYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELES----FISNCLKSNPMERASITQLISHSFLAKNSF 2138
            ++  G F    + + K+  +    K L K+ +  D +  IL E+AV ++ KSC R I +  VY + S I + +EY + G         +AE +S  E   IR+I    +QILEG+ +LHQN+ +  DL P +IL+ +     D+K+ +   S+   +   +  +++ +    YLAPEIL      ++ D+W+ G + + L +    +   DN    ++ L  S +    S   F  +      FI + L  NP +R +    +SHS+L +  F
Sbjct:   38 ELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVS--ENDVIRLI----KQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGH---ACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYMLLTHTSPFVGEDNQ---ETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDF 298          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 104.76 bits (260), Expect = 1.281e-23
Identity = 70/257 (27.24%), Postives = 129/257 (50.19%), Query Frame = 3
Query: 1395 GSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMKI 2156
            GS+   H+A+ +     + IKK  +  DL+ I+KE+++ Q  KS    ++    Y   S +++ +EY   G +++ + +  + +  + I    R  L+GLQ+LH    I RD+   +IL++ +   KL +   + + TD     +++    F  ++APE+++E+ YD+ ADIWS G    ++  G+  Y+D+   +A+  I       FK       E   FI +CL   P ER +  +L  H+F+       IM++
Sbjct:   44 GSYGSVHKAIHRESGHVLAIKKVPVDTDLQEIIKEISIMQQCKS-KYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKNAPGCDIMQL 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 105.145 bits (261), Expect = 1.974e-23
Identity = 70/257 (27.24%), Postives = 129/257 (50.19%), Query Frame = 3
Query: 1395 GSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMKI 2156
            GS+   H+A+ +     + IKK  +  DL+ I+KE+++ Q  KS    ++    Y   S +++ +EY   G +++ + +  + +  + I    R  L+GLQ+LH    I RD+   +IL++ +   KL +   + + TD     +++    F  ++APE+++E+ YD+ ADIWS G    ++  G+  Y+D+   +A+  I       FK       E   FI +CL   P ER +  +L  H+F+       IM++
Sbjct:   44 GSYGSVHKAIHRESGHVLAIKKVPVDTDLQEIIKEISIMQQCKS-KYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKNAPGCDIMQL 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 104.76 bits (260), Expect = 2.370e-23
Identity = 70/257 (27.24%), Postives = 129/257 (50.19%), Query Frame = 3
Query: 1395 GSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMKI 2156
            GS+   H+A+ +     + IKK  +  DL+ I+KE+++ Q  KS    ++    Y   S +++ +EY   G +++ + +  + +  + I    R  L+GLQ+LH    I RD+   +IL++ +   KL +   + + TD     +++    F  ++APE+++E+ YD+ ADIWS G    ++  G+  Y+D+   +A+  I       FK       E   FI +CL   P ER +  +L  H+F+       IM++
Sbjct:   44 GSYGSVHKAIHRESGHVLAIKKVPVDTDLQEIIKEISIMQQCKS-KYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKNAPGCDIMQL 297          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: max-2 (Serine/threonine-protein kinase max-2 [Source:UniProtKB/Swiss-Prot;Acc:G5EGQ3])

HSP 1 Score: 84.3445 bits (207), Expect = 9.734e-18
Identity = 56/218 (25.69%), Postives = 106/218 (48.62%), Query Frame = 3
Query: 1479 KLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRY-LAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAK 2129
            +++L E+ V +  +  +    I +   D   ++V ++Y+  G + + +   E +D   I    ++ L+ L FLH++  + RD+   ++L+  N +VKL ++ F       +P S     +   Y ++PEIL +  Y+   DIWS G +  ++  G+  Y      KA+  I +    + K       E  +F+  CL  +P +RA  T+L++H FL K
Sbjct:   39 EMLLTEIKVMKQYRHPNLVNYIESYLVDADDLWVVMDYLEGGNLTDVVVKTE-LDEGQIAAVLQECLKALHFLHRHSIVHRDIKSDNVLLGMNGEVKLTDMGFCAQI---QPGSKRDTVVGTPYWMSPEILNKKQYNYKVDIWSLGIMALEMIDGEPPYLRETPLKAIYLIAQNGKPEIKQRDRLSSEFNNFLDKCLVVDPDQRADTTELLAHPFLKK 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 84.7297 bits (208), Expect = 1.752e-17
Identity = 49/192 (25.52%), Postives = 96/192 (50.00%), Query Frame = 3
Query: 1554 YSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMI--QKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            + DD  ++V ++Y S+G +   L    G  +  +   ++ RQ+   L + H    I RD+ P ++L+D+  ++KL +  +S   D+ K  +    C  + YLAPE++    +D + DIW+ G L+F++  G   +A+   DK +  I E    +  +  +      S I+  +K  P ER  +  +++H ++
Sbjct:  111 FHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTL---CGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKE---CKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWI 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343587)

HSP 1 Score: 88.9669 bits (219), Expect = 1.710e-18
Identity = 54/224 (24.11%), Postives = 115/224 (51.34%), Query Frame = 3
Query: 1476 LKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSA------DIWSFGALVFKLESGKELYADLDNDKAVKSILE--YSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            L+   +E+++ +        I + +V+  D+ +++  E   +G + +YL+ +  +  +  +   RQI EG++++H    + RDL P +IL+D N +VK+ +  F+K     +  +++  C    YLAPE LK  +++ S       DIW+ G ++F L  G   +        +++I+E  YS    + + ++ ++ +  I  CL  +P +R ++ +++ H F 
Sbjct:   71 LEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNL--CGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADIS-EDPKDLIRKCLVVDPSQRITVKEVLRHPFF 291          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0090002)

HSP 1 Score: 88.9669 bits (219), Expect = 2.545e-18
Identity = 55/229 (24.02%), Postives = 117/229 (51.09%), Query Frame = 3
Query: 1476 LKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSA------DIWSFGALVFKLESGKELYADLDNDKAVKSILE--YSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF 2138
            L+   +E+++ +        I + +V+  D+ +++  E   +G + +YL+ +  +  +  +   RQI EG++++H    + RDL P +IL+D N +VK+ +  F+K     +  +++  C    YLAPE LK  +++ S       DIW+ G ++F L  G   +        +++I+E  YS    + + ++ ++ +  I  CL  +P +R ++ +++ H F  +  F
Sbjct:   71 LEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNL--CGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADIS-EDPKDLIRKCLVVDPSQRITVKEVLRHPFFNQMLF 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: PhKgamma (gene:FBgn0011754 transcript:FBtr0343648)

HSP 1 Score: 88.9669 bits (219), Expect = 2.545e-18
Identity = 55/229 (24.02%), Postives = 117/229 (51.09%), Query Frame = 3
Query: 1476 LKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSA------DIWSFGALVFKLESGKELYADLDNDKAVKSILE--YSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF 2138
            L+   +E+++ +        I + +V+  D+ +++  E   +G + +YL+ +  +  +  +   RQI EG++++H    + RDL P +IL+D N +VK+ +  F+K     +  +++  C    YLAPE LK  +++ S       DIW+ G ++F L  G   +        +++I+E  YS    + + ++ ++ +  I  CL  +P +R ++ +++ H F  +  F
Sbjct:   71 LEATRQEISILRQVMGHPYIIDLQDVFESDAFVFLVFELCPKGELFDYLTSVVTLSEKKTRTIMRQIFEGVEYIHAKSIVHRDLKPENILLDENHNVKITDFGFAKQLQEGEKLTNL--CGTPGYLAPETLKCNMFEGSPGYSQEVDIWACGVIMFTLLVGCPPFWHRKQMVMLRNIMEGKYSFTSPEWADIS-EDPKDLIRKCLVVDPSQRITVKEVLRHPFFNQMLF 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0331920)

HSP 1 Score: 88.9669 bits (219), Expect = 7.152e-18
Identity = 65/256 (25.39%), Postives = 121/256 (47.27%), Query Frame = 3
Query: 1395 GSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMK 2153
            GS+   ++A+ K  +  + IK   +  DL  I+KE+++ Q   S    ++    Y     +++ +EY   G +++ +    + +    I       L+GL +LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ YD  ADIWS G    ++  GK  Y ++   +A+  I +     F+       E   F+S CL   P +RA+ T+L+ H F+       I+K
Sbjct:   51 GSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCDS-PYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILK 303          
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Match: hpo (gene:FBgn0261456 transcript:FBtr0086500)

HSP 1 Score: 88.9669 bits (219), Expect = 7.152e-18
Identity = 65/256 (25.39%), Postives = 121/256 (47.27%), Query Frame = 3
Query: 1395 GSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMK 2153
            GS+   ++A+ K  +  + IK   +  DL  I+KE+++ Q   S    ++    Y     +++ +EY   G +++ +    + +    I       L+GL +LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ YD  ADIWS G    ++  GK  Y ++   +A+  I +     F+       E   F+S CL   P +RA+ T+L+ H F+       I+K
Sbjct:   51 GSYGSVYKAVHKESSSIVAIKLVPVESDLHEIIKEISIMQQCDS-PYVVRYYGSYFKQYDLWICMEYCGAGSVSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDCVADIWSLGITALEMAEGKPPYGEIHPMRAIFMIPQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIRNAKHRSILK 303          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk3 (serine/threonine kinase 3 (STE20 homolog, yeast) [Source:NCBI gene;Acc:324125])

HSP 1 Score: 98.9821 bits (245), Expect = 2.751e-21
Identity = 65/251 (25.90%), Postives = 126/251 (50.20%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    +  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+       +   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   30 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk3 (serine/threonine kinase 3 (STE20 homolog, yeast) [Source:NCBI gene;Acc:324125])

HSP 1 Score: 98.9821 bits (245), Expect = 2.751e-21
Identity = 65/251 (25.90%), Postives = 126/251 (50.20%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    +  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+       +   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   30 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATVLKSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPEHWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk24a (serine/threonine kinase 24a (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-070424-52])

HSP 1 Score: 89.7373 bits (221), Expect = 1.644e-18
Identity = 80/280 (28.57%), Postives = 133/280 (47.50%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQIGDLKLILKELAVFQ----ITKSC-SRFI-QISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVR---YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMKIDAKLDITDNFK 2189
            E+I  GSF +  + ++    + + IK   I DL+    E+   Q    +   C S FI +    Y  D+ +++ +EY+  G   + L     +D   I    R+IL+GL +LH    I RD+   ++L+    DVKL +   + + TD     + IK+  FV    ++APE++K+  YDS ADIWS G    +L  G+  ++DL   K V  ++   N        N K L+ F+  CL  +P  R +  +L+ H  + + S     K    +D+ D +K
Sbjct:   21 ERIGKGSFGEVFKGIDNRTQKVVAIK---IIDLEEAEDEVEDIQQEITVLSQCDSLFITKYFGSYLKDTKLWIIMEYLGGGSALDLLGP-GALDETHIATILREILKGLDYLHSEKKIHRDIKAANVLLSEQGDVKLADFGVAGQLTD-----TQIKRNTFVGTPFWMAPEVIKQSEYDSKADIWSLGITAIELAKGEPPHSDLHPMK-VLFLIPKENPPTLEGNYN-KALKEFVDACLNKDPNFRPTAKELLKHKLIVRYS----KKTSYLMDLIDKYK 285          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 88.5817 bits (218), Expect = 3.917e-18
Identity = 58/196 (29.59%), Postives = 97/196 (49.49%), Query Frame = 3
Query: 1554 YSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVR---YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAK 2129
            Y  D+ +++ +EY+  G   + L     +D   I    R+IL+GL++LH    I RD+   ++L+    +VKL +   + + TD     + IK+  FV    ++APE++K+  YDS ADIWS G    +L  G+  ++DL   K +   L   N    L     K L+ F+  CL   P  R +  +L+ H  + +
Sbjct:   89 YLKDTKLWIIMEYLGGGSALDLLEP-GSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD-----TQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVL--FLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVR 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Match: stk24b (serine/threonine kinase 24b (STE20 homolog, yeast) [Source:ZFIN;Acc:ZDB-GENE-040426-2841])

HSP 1 Score: 88.5817 bits (218), Expect = 4.044e-18
Identity = 58/196 (29.59%), Postives = 97/196 (49.49%), Query Frame = 3
Query: 1554 YSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVR---YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAK 2129
            Y  D+ +++ +EY+  G   + L     +D   I    R+IL+GL++LH    I RD+   ++L+    +VKL +   + + TD     + IK+  FV    ++APE++K+  YDS ADIWS G    +L  G+  ++DL   K +   L   N    L     K L+ F+  CL   P  R +  +L+ H  + +
Sbjct:   77 YLKDTKLWIIMEYLGGGSALDLLEP-GSLDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD-----TQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVL--FLIPKNNPPTLEGNYCKPLKEFVEACLNKEPSFRPTAKELLKHKLIVR 264          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 105.145 bits (261), Expect = 4.249e-23
Identity = 68/251 (27.09%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    R  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   28 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-HYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 105.145 bits (261), Expect = 4.655e-23
Identity = 68/251 (27.09%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    R  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   27 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-HYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 274          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 105.145 bits (261), Expect = 4.862e-23
Identity = 68/251 (27.09%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    R  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   35 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-HYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 282          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 104.375 bits (259), Expect = 4.992e-23
Identity = 68/251 (27.09%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    R  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   32 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-HYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Match: elp4 (elongator acetyltransferase complex subunit 4 [Source:Xenbase;Acc:XB-GENE-991975])

HSP 1 Score: 104.76 bits (260), Expect = 5.553e-23
Identity = 68/251 (27.09%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    R  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   30 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-HYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEEEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDEFTDFVKKCLVKNPEQRATATQLLQHPFI 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk4 (serine/threonine kinase 4 [Source:MGI Symbol;Acc:MGI:1929004])

HSP 1 Score: 99.7525 bits (247), Expect = 1.865e-21
Identity = 65/251 (25.90%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+   ++A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    +  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L       F+  CL  +P +RA+ TQL+ H F+
Sbjct:   34 EKLGEGSYGSVYKAIHKETGQIVAIKQVPVESDLQEIIKEISIMQQCDS-PHVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDNFMDFVKQCLVKSPEQRATATQLLQHPFV 281          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 99.3673 bits (246), Expect = 2.649e-21
Identity = 67/254 (26.38%), Postives = 128/254 (50.39%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS----HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  +P +RA+ TQL+ H F+
Sbjct:   29 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFI 276          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Stk3 (serine/threonine kinase 3 [Source:MGI Symbol;Acc:MGI:1928487])

HSP 1 Score: 98.9821 bits (245), Expect = 3.542e-21
Identity = 67/254 (26.38%), Postives = 128/254 (50.39%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL----SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  +P +RA+ TQL+ H F+
Sbjct:   31 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKSPEQRATATQLLQHPFI 278          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 87.8113 bits (216), Expect = 1.435e-18
Identity = 51/201 (25.37%), Postives = 101/201 (50.25%), Query Frame = 3
Query: 1536 IQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKK-CLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            +++ N + DD+ IY+ +EY   G + + L   + +D +      +++ + L + H+   I RD+ P ++L+  N +VK+ +  +S +T    PS   K  C  + YL PE++ +  Y+   D+W  G L ++L  GK  +    + +  + I     + FK         +  IS  L+ +P ER S+ Q++ H ++ ++S
Sbjct:   77 LRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHT----PSLRRKTMCGTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRI---RQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHS 270          
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Match: Aurkc (aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119])

HSP 1 Score: 87.8113 bits (216), Expect = 1.435e-18
Identity = 51/201 (25.37%), Postives = 101/201 (50.25%), Query Frame = 3
Query: 1536 IQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKK-CLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            +++ N + DD+ IY+ +EY   G + + L   + +D +      +++ + L + H+   I RD+ P ++L+  N +VK+ +  +S +T    PS   K  C  + YL PE++ +  Y+   D+W  G L ++L  GK  +    + +  + I     + FK         +  IS  L+ +P ER S+ Q++ H ++ ++S
Sbjct:   77 LRLYNYFYDDTRIYLILEYAPGGELYKELQRHQKLDQQRTATIIQELSDALTYCHEKKVIHRDIKPENLLLGLNGEVKISDFGWSVHT----PSLRRKTMCGTLDYLPPEMIAQKPYNEMVDLWCIGVLCYELLVGKPPFESSTSSETYRRI---RQVDFKFPSSVPAGAQDLISKLLRYHPSERLSLAQVLKHPWVREHS 270          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|A8XJW8|CST1_CAEBR (Serine/threonine-protein kinase cst-1 OS=Caenorhabditis briggsae OX=6238 GN=cst-1 PE=3 SV=2)

HSP 1 Score: 106.301 bits (264), Expect = 1.043e-22
Identity = 69/250 (27.60%), Postives = 127/250 (50.80%), Query Frame = 3
Query: 1383 QIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            ++  GS+   H+A+ K     + IKK  +  DL+ I+KE+++ Q  KS    ++    Y  +S +++ +EY   G +++ + +  + +  + I    R  L+GLQ+LH    I RD+   +IL++ +   KL +   + + TD     +++    F  ++APE+++E+ YD+ ADIWS G    ++  G+  Y+D+   +A+  I       FK       E   FI  CL   P ER +  +L  H+F+
Sbjct:   40 KLGEGSYGSVHKAIHKESGHVLAIKKVPVDTDLQEIIKEISIMQQCKS-KYVVKYYGSYFKNSDLWIVMEYCGAGSISDIMRARRKPLSEKEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRCCLIKKPEERKTALRLCEHTFI 286          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9S7U9|M2K2_ARATH (Mitogen-activated protein kinase kinase 2 OS=Arabidopsis thaliana OX=3702 GN=MKK2 PE=1 SV=2)

HSP 1 Score: 103.605 bits (257), Expect = 1.795e-22
Identity = 69/227 (30.40%), Postives = 116/227 (51.10%), Query Frame = 3
Query: 1479 KLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIV-RDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFV---RYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILE-----YSNIQFKLSRLNF-KELESFISNCLKSNPMERASITQLISHSFLAK 2129
            K I +EL + Q +  C   +     + D+ +I + +EYM  G +A++L  ++ I    +    RQ+L+GL +LH +  I+ RDL P+++LI+   +VK+ +   S        +++     FV    Y++PE +    Y + +DIWS G +V +  +GK  YA  + ++   S+ E            L   NF  EL SFIS CL+ +P  R+S  +L+ H FL K
Sbjct:  111 KAIAQELKINQ-SSQCPNLVTSYQSFYDNGAISLILEYMDGGSLADFLKSVKAIPDSYLSAIFRQVLQGLIYLHHDRHIIHRDLKPSNLLINHRGEVKITDFGVSTVMT----NTAGLANTFVGTYNYMSPERIVGNKYGNKSDIWSLGLVVLECATGKFPYAPPNQEETWTSVFELMEAIVDQPPPALPSGNFSPELSSFISTCLQKDPNSRSSAKELMEHPFLNK 332          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9NB31|CST1_CAEEL (Serine/threonine-protein kinase cst-1 OS=Caenorhabditis elegans OX=6239 GN=cst-1 PE=1 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 2.511e-22
Identity = 70/257 (27.24%), Postives = 129/257 (50.19%), Query Frame = 3
Query: 1395 GSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL-SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*KIMKI 2156
            GS+   H+A+ +     + IKK  +  DL+ I+KE+++ Q  KS    ++    Y   S +++ +EY   G +++ + +  + +  + I    R  L+GLQ+LH    I RD+   +IL++ +   KL +   + + TD     +++    F  ++APE+++E+ YD+ ADIWS G    ++  G+  Y+D+   +A+  I       FK       E   FI +CL   P ER +  +L  H+F+       IM++
Sbjct:   44 GSYGSVHKAIHRESGHVLAIKKVPVDTDLQEIIKEISIMQQCKS-KYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIEEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIPTKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFIKNAPGCDIMQL 297          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6IP06|STK3_XENLA (Serine/threonine-protein kinase 3 OS=Xenopus laevis OX=8355 GN=stk3 PE=2 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 3.751e-22
Identity = 68/251 (27.09%), Postives = 127/251 (50.60%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +    + +    I    R  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   30 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-HYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILRSTLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWTDEFTDFVKKCLVKNPEQRATATQLLQHPFI 277          
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q802A6|STK4_SQUAC (Serine/threonine-protein kinase 3/4 OS=Squalus acanthias OX=7797 GN=STK4 PE=2 SV=1)

HSP 1 Score: 101.679 bits (252), Expect = 3.110e-21
Identity = 70/257 (27.24%), Postives = 127/257 (49.42%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIR-------MIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++       I IR        I    +  L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   E   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   36 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PHVVKYYGSYFKNTDLWIVMEYCGAGSVSDL------IRIRNKTLTEDEIATILQSTLKGLEYLHFMRKIHRDIKAGNILLNNEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGISAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWTDEFTDFVKQCLVKNPEQRAAATQLLQHPFI 283          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1R2CIP8 (Protein kinase domain-containing protein OS=Stentor coeruleus OX=5963 GN=SteCoe_9129 PE=3 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.344e-23
Identity = 79/274 (28.83%), Postives = 140/274 (51.09%), Query Frame = 3
Query: 1356 RFCDIELQEQIYSGSFYKFHEALEKTKNEKILIKKYQIG--------DLKLILKELAVFQITKSCS--RFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRK--PSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLN--FKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            R    +  + I  G + K ++A+     E + +K Y++         +L  I +E+ + +  K  +  R+ Q+ +  +  ++I + +EY+  G M   LS  +G     ++ +++Q+LEGL +LH ND I RDL   +ILI  +  +KL +   S+  D      + S K   +  ++APE++    +   ADIWS G LV ++ +G+  ++++ N    K +L    I+  +  +     ELE+FIS CLK NP +R S  QL+ HSF+   S
Sbjct:   52 RIISWQRGDLIGEGVYGKVYQAMNMNTGELVAVKSYKLSQDISKVENELMSIRREIMILRQLKHPNIIRYFQV-DYDNRQNTINILMEYIPSGSMNVLLSKYKGFSENAVRNYTKQLLEGLDYLHSNDIIHRDLKSANILITEDSTLKLTDFGCSRRFDENSNFQTRSFKGSPY--WMAPEVVLRSGHSFPADIWSLGCLVIEMITGRPPWSNITN--LSKEVLRLIAIEHNIPDIPKVSPELENFISLCLKRNPKKRPSALQLLEHSFIKTAS 320          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A194YJT7 (Uncharacterized protein OS=Sorghum bicolor OX=4558 GN=SORBI_3010G171600 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 2.822e-22
Identity = 80/260 (30.77%), Postives = 135/260 (51.92%), Query Frame = 3
Query: 1392 SGSFYKFHEALEKTKNEKILIKKYQIGDLKLILKELAVFQITKSC---SRF-----IQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEIL-KEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSI--LEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF 2138
            SGSF   +EA+    +E +     ++   + I  +L +FQ+ +     S+F     +Q      +DS +YV +E M+QG +A  LS    +    +  ++RQIL GL +LH+ + + RD+   +IL+ AN  VKL +   +K       + S K  ++  ++APE++  +  Y  +ADIWS G  V ++ + +  Y D++  +A+  I   E  +I   LS    K+   FIS C+KSNP +R S ++L+ H FL   S 
Sbjct:  400 SGSFGMVYEAI---TDEGVFFAVKEVSLFEGIHAKLCIFQLEQEIELLSQFEHENIVQYYGTDKEDSKLYVFLELMTQGSLAS-LSQKYHLQDNHVSTYTRQILNGLTYLHERNIVHRDIKCANILVHANGSVKLADFGLAKELSKFSAAKSCKGTVY--WMAPEVVNPKKTYGPAADIWSLGCTVLEMLTRQVPYPDMEWTQALFRIGKGEAPSIPSALS----KDARDFISQCVKSNPEDRPSASELLKHPFLINRSM 649          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A1R2AP63 (Protein kinase domain-containing protein OS=Stentor coeruleus OX=5963 GN=SteCoe_36861 PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 3.018e-22
Identity = 81/249 (32.53%), Postives = 132/249 (53.01%), Query Frame = 3
Query: 1404 YKFHEALEKTKNEKILIKKYQIGDLKLILKELAVFQITKSCSRFIQISNVYSD-DSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRK--PSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLN--FKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            YK  + + K +NE I I+K +I    +IL++L    I     R+ Q    Y D  ++I + +EY+  G M   LS  +G     ++ +++Q+L+GL +LH ND I RDL   +ILI  +  +KL +   S+  D      + S K   +  ++APE++    +   ADIWS G LV ++ +G+  ++++ N    K +L    I+  +  +     ELE+FIS CLK NP +R S  QL+ HSF+   S
Sbjct:   87 YKLSQDISKAENELISIRK-EI----MILRQLNHPNII----RYFQAD--YDDRQNTINILMEYIPSGSMNVLLSRYKGFSENAVRNYTKQLLDGLDYLHSNDIIHRDLKSANILITEDSTLKLTDFGCSRRFDENSNFQTRSFKGSPY--WMAPEMVLRSGHSFPADIWSLGCLVIEMITGRPPWSNISN--LSKEVLRLIAIEHNIPDIPKVSPELENFISLCLKRNPKKRPSAAQLLEHSFIKTAS 320          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A0A0N4V5X8 (Uncharacterized protein OS=Enterobius vermicularis OX=51028 GN=EVEC_LOCUS5258 PE=4 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 4.552e-22
Identity = 71/250 (28.40%), Postives = 131/250 (52.40%), Query Frame = 3
Query: 1383 QIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            ++  GS+   H+A+ K     + +KK  +  DL+ I+KE+++ Q   S    ++    Y  +S +++ +EY   G +++ +    + +  + I   +R +L+GL++LH    I RD+   +IL++   + KL +   + + TD     +++    F  ++APE+++E  YD+ ADIWS G    ++  G+  +AD+   +A+  I       FK       E  SF+S CL  NP ER S T+L+ HSF+
Sbjct:   65 KLGEGSYGSVHKAIHKESGHILAVKKVPVDTDLQEIIKEISIMQQCDS-KYVVKYYGSYFKNSDLWIVMEYCGAGSVSDIMRMRKKTLSEKEISAVTRDVLKGLKYLHDLKKIHRDIKAGNILLNNEGNAKLADFGVAGQLTDTMAKRNTLIGTPF--WMAPEVIQETGYDTKADIWSLGITAMEMAEGRPPHADIHPMRAIFMIPTKPPPTFKNPADWSSEFISFVSQCLIKNPEERKSATELLEHSFI 311          
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Match: A7S0A9 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g241948 PE=4 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 4.668e-22
Identity = 69/254 (27.17%), Postives = 135/254 (53.15%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS----HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I+ + K++   L+GL++LH    I RD+   +IL+++    KL +   + + TD     +++    F  ++APE+++E+ YD  ADIWS G    ++  GK  YAD+   +A+  I       F+      ++ + F+S CL  NP ERA+ T+L+ HSF+
Sbjct:   28 EKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEIIKEISMMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYT---LKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFI 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk3 (serine/threonine kinase 3 [Source:NCBI gene;Acc:103027492])

HSP 1 Score: 101.293 bits (251), Expect = 4.762e-22
Identity = 68/254 (26.77%), Postives = 128/254 (50.39%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL----SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  NP +RA+ TQL+ H F+
Sbjct:   30 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFI 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: STK4 (serine/threonine kinase 4 [Source:HGNC Symbol;Acc:HGNC:11408])

HSP 1 Score: 94.3597 bits (233), Expect = 5.712e-20
Identity = 66/246 (26.83%), Postives = 123/246 (50.00%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHI-EGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLI 2108
            E++  GS+    +A  K   E + IK+  +  DL+ I+KE+++ Q   S    ++    Y  +S +++ +EY   G +++ +    + +    I    +  L+GL++LH    I RD+   +IL+++    KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+      +    F+S CL  NP  RA+ TQL+
Sbjct:   37 EKLGEGSYGSVFKAHYKETGEIVAIKQVPVESDLQEIIKEISIMQQCNS-PHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRQRNKTLAEDEIAAILQSTLKGLEYLHFMRKIHRDIKAGNILLNSEGQAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDQWSEPFRDFVSQCLVKNPENRATATQLL 279          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk25b (serine/threonine-protein kinase 25-like [Source:NCBI gene;Acc:103039280])

HSP 1 Score: 90.1225 bits (222), Expect = 1.187e-18
Identity = 78/282 (27.66%), Postives = 132/282 (46.81%), Query Frame = 3
Query: 1314 KDIQNQPVLVCVMKRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIKKYQIGDLKLILKELAVFQ----ITKSC-SRFI-QISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVR---YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAK 2129
            +DIQNQ   +   + F     QE+I  GSF + ++ +     E + IK   I DL+    E+   Q    +   C S F+ +    Y   + +++ +EY+  G   + L     ++   I    R+IL+GL++LH    I RD+   ++L+    DVKL +   + + TD     + IK+  FV    ++APE++K+  YD  ADIWS G    +L  G+   +DL   + +   L   N    L     K  + F+  CL  +P  R +  +L+ H F+ +
Sbjct:    5 RDIQNQNARLDPEEYFTK---QERIGKGSFGEVYKGINNRTKEVVAIK---IIDLEEAEDEIEDIQQEITVLSQCDSPFVTKYYGSYLKGTKLWIIMEYLGGGSALDLL-RPGPLEETYIATILREILKGLEYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTD-----TQIKRNTFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVL--FLIPKNPPPTLEGSYSKPFKEFVEACLNKDPRFRPTAKELLKHKFITR 272          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk17a (serine/threonine kinase 17a [Source:NCBI gene;Acc:103045004])

HSP 1 Score: 89.3521 bits (220), Expect = 1.763e-18
Identity = 69/265 (26.04%), Postives = 129/265 (48.68%), Query Frame = 3
Query: 1383 QIYSGSFYKFHEALEKTKNE----KILIKKYQIGDLKL-ILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQG-----VMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDAND---DVKLFNLNFSKYTDYRKPSSSIKKCLFV-RYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELE----SFISNCLKSNPMERASITQLISHSFL 2123
            ++  G F    + +EK+       K + K+ +  D +  I+ E+AV ++  SC R + +  VY   S + + +E+ + G      +AE     +  D++   +  RQILEG+ FLH+ D +  DL P +IL+ +ND   D+K+ +   S+     +    I++ +    Y+APE+L      ++ D+WS G L + + +G   +  L +DK  ++ L  S I    +    ++L+     FI + L   P  RA+  + + H +L
Sbjct:   45 ELGRGKFAVVRKCVEKSTGREYAAKFMRKRRKGQDCRTEIIHEIAVLELAASCQRVVNLHEVYELPSEMVLVLEFAAGGEIFNQCVAERDEAFKEEDVK---RLLRQILEGVSFLHKRDVVHLDLKPQNILLTSNDPLGDIKIVDFGLSRMVSNNQ---EIREIMGTPEYVAPEVLNYEPISTATDMWSIGVLAYVMLTGISPF--LGDDKQ-ETFLNISQINISYTEEELEQLDKAAIQFIKSLLIKEPEGRATAEECLKHQWL 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Match: stk24b (serine/threonine-protein kinase 24-like [Source:NCBI gene;Acc:103028447])

HSP 1 Score: 88.1965 bits (217), Expect = 3.853e-18
Identity = 57/198 (28.79%), Postives = 98/198 (49.49%), Query Frame = 3
Query: 1554 YSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVR---YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            Y   + +++ +EY+  G   + L     +D   I    R+IL+GL++LH    I RD+   ++L+    +VKL +   + + TD     + IK+  FV    ++APE++K+  YDS ADIWS G    +L  G+  ++DL   K +   L   N    L     K L+ F+  CL   P  R +  +L+ H  + +++
Sbjct:   62 YLKGTKLWIIMEYLGGGSALDLLEP-GALDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD-----TQIKRNTFVGTPFWMAPEVIKQSAYDSKADIWSLGITAIELAKGEPPHSDLHPMKVL--FLIPKNNPPTLEGNYSKPLKEFVEACLNKEPSFRPTAKELLKHKLIVRHA 251          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008193.1 (pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-1 gene:ENSPMAG00000007385.1 transcript:ENSPMAT00000008193.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 8.828e-19
Identity = 49/179 (27.37%), Postives = 92/179 (51.40%), Query Frame = 3
Query: 1578 VAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISH 2114
            + +EY +QG + E L     I   ++  W+R I  G+ +LH +  I RDL   ++LI  +D+VK+ +   SK  + R+ S+ +     V ++APE+++        DIWSFG ++++L +G+  Y D+D+   +  +   S +   +     +  +  ++ C  S P  R S  Q++ H
Sbjct:   77 IIMEYCAQGQLYEVLRAGRRISPELLVGWTRGIARGMSYLHLHKIIHRDLKSPNVLITHDDEVKISDFGTSK--EMREKSTRMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYRDVDSSAIIWGVGSNS-LHLPIPASCPEGFKILLTQCWNSKPRNRPSFRQILLH 252          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: RPS6KA3 (ribosomal protein S6 kinase A3 [Source:HGNC Symbol;Acc:HGNC:10432])

HSP 1 Score: 83.1889 bits (204), Expect = 7.124e-18
Identity = 60/260 (23.08%), Postives = 119/260 (45.77%), Query Frame = 3
Query: 1371 ELQEQIYSGSFYKFHEALEKTKNEKILIKKYQIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSIL-IDAN---DDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNF----KELESFISNCLKSNPMERASITQLISHSFLA 2126
            EL+E I  GS+      + KT N +  +K       +   +E+ +          I + +VY D  S+Y+  E M  G + + +   +    R      + I   +++LH    + RDL P++IL +D +   + +++ +  F+K          +  C    ++APE+LK   YD++ DIWS G L++ + +G   +A+  +D     +    + +F LS  N+    +  +  +   L  +P +R +  Q++ H ++A
Sbjct:   13 ELREDIGVGSYSVCKRCIHKTTNMEYAVKVIIDKSKRDPSEEIEILLRYGQHPNVITLKDVYDDGKSVYLVTELMKGGELLDKILRQKFFSEREASAVLQTIARTVEYLHSQGVVHRDLKPSNILYVDESGNPESLRICDFGFAKQLRAEN-GLLMTPCYTANFVAPEVLKRQGYDAACDIWSLGVLLYTMLAGHTPFANGPDDTPGVILTRIGSGRFLLSGGNWDTVSEAAKDLVKKMLHVDPHQRFTAAQVLRHPWIA 271          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001965.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001965.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.016e-17
Identity = 53/199 (26.63%), Postives = 99/199 (49.75%), Query Frame = 3
Query: 1569 SIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDT--IVRDLNPTSILIDA-NDDVKLFNLNFSKYTDYRKPSSSIKKCLFVR-------YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            SI +  E M+ G +  YL   + +  +++Q W RQIL+GL FLH      I RDL   +I I      VK+ +L            +++K+  F +       ++APE+ +E  YD + D+++FG  + ++ + +  Y++  N   +   +         +++   EL+  I  C+++N  ER SI  L++H F A+++
Sbjct:   45 SIVLVTELMTSGTLKTYLKRFKVMKTKVLQSWCRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGL----------ATLKRASFAKSVIGTPEFMAPEMYEEH-YDEAVDVYAFGMCMLEMATSEYPYSECQNPAQIYRKVTTGVKPASFNKVAMPELKEIIEGCIRTNKDERYSIKDLLNHGFFAEDT 232          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001973.1 (pep scaffold:Pmarinus_7.0:GL477178:11064:57290:1 gene:ENSPMAG00000001777.1 transcript:ENSPMAT00000001973.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.040e-17
Identity = 53/199 (26.63%), Postives = 99/199 (49.75%), Query Frame = 3
Query: 1569 SIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDT--IVRDLNPTSILIDA-NDDVKLFNLNFSKYTDYRKPSSSIKKCLFVR-------YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            SI +  E M+ G +  YL   + +  +++Q W RQIL+GL FLH      I RDL   +I I      VK+ +L            +++K+  F +       ++APE+ +E  YD + D+++FG  + ++ + +  Y++  N   +   +         +++   EL+  I  C+++N  ER SI  L++H F A+++
Sbjct:   45 SIVLVTELMTSGTLKTYLKRFKVMKTKVLQSWCRQILKGLHFLHTRTPPIIHRDLKCDNIFITGPTGSVKIGDLGL----------ATLKRASFAKSVIGTPEFMAPEMYEEH-YDEAVDVYAFGMCMLEMATSEYPYSECQNPAQIYRKVTTGVKPASFNKVAMPELKEIIEGCIRTNKDERYSIKDLLNHGFFAEDT 232          
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 83.9593 bits (206), Expect = 1.476e-17
Identity = 61/245 (24.90%), Postives = 114/245 (46.53%), Query Frame = 3
Query: 1443 KILIKKYQIGDLKL-ILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQG-----VMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDAN---DDVKLFNLNFSKYTDYRKPSSSIKKCLFV-RYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELE----SFISNCLKSNPMERASITQLISHSFLAKNS 2135
            K L K+ +  D +  +  E+A+ +  +SC   I + + +   + I + +EY   G      +AE       +D+R +    RQILEG+ FLH+ND +  DL P +IL+ +     D+K+ +   S+  +    +  +++ +    Y+APE+L       + D+WS G L + + +G+  +  L  DK  ++ L  S +        F+ +     +FI   L   P  RA+    + H +L+   
Sbjct:   24 KFLRKRRKGQDCRADVTHEMAILEAARSCPHIIDLHDAFETPTEIILVLEYAVGGEIFNQCVAEGEDAFTEVDVRRLM---RQILEGVAFLHRNDVVHLDLKPQNILLTSASPLGDIKIVDFGLSRRVNS---AEELREIMGTPEYVAPEVLNYEPISKATDMWSVGVLAYVMLTGESPF--LGEDKQ-ETFLNVSQLNVSYEPEVFEGVSVQAVAFIQQLLVKAPHRRATAEHCLRHPWLSARG 259          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 91.2781 bits (225), Expect = 2.157e-19
Identity = 68/272 (25.00%), Postives = 133/272 (48.90%), Query Frame = 3
Query: 1374 LQEQIYSGSFYKFHEALEKTKNE----KILIKKYQIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDD--VKLFNLNFSKYTDYRKPSSSIKK--CLFVRYLAPEILK-------------EMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNF-KELESFISNCLKSNPMERASITQLISHSFL 2123
            + E +  G+F    +A+E+T  +    KI+ K+  IG++  + +EL V Q   +  R +++   Y D  S Y+ +E++S G + ++++    +     ++ SRQIL  ++++H      RDL P +ILI+ +D   VK+ +   +K     + + S  K  C  + Y+APE+++                Y S  D+WS G LV+ + +G   ++    D+  K I   S  +  L      +E   FI + L+ +P  R++  + ++H ++
Sbjct:  200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQ-KLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKV----QGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPFSGSTQDQLYKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 82.8037 bits (203), Expect = 2.799e-17
Identity = 54/217 (24.88%), Postives = 105/217 (48.39%), Query Frame = 3
Query: 1362 CDIELQEQIYSGSFYKFHEALEKTKNEKI----LIKKYQIGDLKLILK---ELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSIL 1991
             D ++   + +GSF + H  +    N +      +KK+ I  LK +     E  +  I  S    I++   + D   +++ ++Y+  G +   L   +     + + ++ ++   L++LH  D I RDL P +IL+D N  +K+ +  F+KY     P  +   C    Y+APE++    Y+ S D WSFG L++++ +G   + + +  K  ++IL
Sbjct:   86 SDFQILRTLGTGSFGRVH-LIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIV-SHPFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFAKYV----PDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENIL 296          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 84.3445 bits (207), Expect = 3.656e-17
Identity = 69/271 (25.46%), Postives = 133/271 (49.08%), Query Frame = 3
Query: 1353 KRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIKKY-----QIGDLKLILKELAVFQI---TKSCSRF--IQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSS-ADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKN 2132
            K  C I++  +      +K H +L   KNE  ++++      +I   K  ++E ++ QI      C  F    +SN +      Y+  EY+S G + +Y+     +     +K++R I   LQ+LH N+ + RDL   +I+I ++ ++K+ +   S   DYRK   +   C  + + APE+LK   Y     DIWSFG +++ L  GK  + D +N   +   ++   + +  S L+  E+ S ++  +  +P+ RA++  ++ H ++ + 
Sbjct:  122 KEICVIKIVNRASKAYLHKQH-SLPSPKNESEILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHF------YMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNIFDYRKQLHTF--CGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDD-ENSSILHEKIKKGKVDYP-SHLSI-EVISLLTRMIVVDPLRRATLKNVVEHPWMNRG 380          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SCH9 (AGC family protein kinase; functional ortholog of mammalian S6 kinase; phosphorylated by Tor1p and required for TORC1-mediated regulation of ribosome biogenesis, translation initiation, and entry into G0 phase; involved in transactivation of osmostress-responsive genes; regulates G1 progression, cAPK activity and nitrogen activation of the FGM pathway; integrates nutrient signals and stress signals from sphingolipids to regulate lifespan [Source:SGD;Acc:S000001248])

HSP 1 Score: 83.5741 bits (205), Expect = 5.044e-17
Identity = 64/238 (26.89%), Postives = 114/238 (47.90%), Query Frame = 3
Query: 1428 KTKNEKILIKKYQIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPE-ILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASI----TQLISHSFLA 2126
            K  ++K+++KK +I    +  + + V   +KS    + +   +   + +Y+  +YMS G +  +L           + +  +++  L+ LH ND + RDL P +IL+DAN ++ L +   SK  D +  +++   C    YLAPE +L E  Y    D WS G L+F++  G   +   +N K  + I  +  ++F    L+ +E  SF+   L  NP  R        +L +H F A
Sbjct:  441 KVLSKKVIVKKNEIAHT-IGERNILVTTASKSSPFIVGLKFSFQTPTDLYLVTDYMSGGELFWHLQKEGRFSEDRAKFYIAELVLALEHLHDNDIVYRDLKPENILLDANGNIALCDFGLSK-ADLKDRTNTF--CGTTEYLAPELLLDETGYTKMVDFWSLGVLIFEMCCGWSPFFAENNQKMYQKIA-FGKVKFPRDVLS-QEGRSFVKGLLNRNPKHRLGAIDDGRELRAHPFFA 672          
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 83.1889 bits (204), Expect = 5.621e-17
Identity = 62/255 (24.31%), Postives = 124/255 (48.63%), Query Frame = 3
Query: 1401 FYKFHEALEKTKNEKILIKKYQIGDL---KLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYL---------SHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLA 2126
            F K H    +   E++ IK+ ++ +    +LI+ EL V   ++  +    +     DD  ++V +EYM  G + + L          H   ++   +    ++  +GL+FLH    I RD+   +IL+++   VK+ +  F  + T+ R   +++    +  ++APEI+ +  YD   D+WS G ++ ++  G+  Y + D  KA+  I    + + +      K+ + F+  CL+ N   RAS+ +L++  FL+
Sbjct:  390 FLKSH--CHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPY--WMAPEIVNQKGYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANNGSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLS 640          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 108.997 bits (271), Expect = 6.455e-26
Identity = 69/254 (27.17%), Postives = 135/254 (53.15%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS----HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I+ + K++   L+GL++LH    I RD+   +IL+++    KL +   + + TD     +++    F  ++APE+++E+ YD  ADIWS G    ++  GK  YAD+   +A+  I       F+      ++ + F+S CL  NP ERA+ T+L+ HSF+
Sbjct:   28 EKLGEGSYGSVFKAMHKESGQVVAIKQVPVDTDLQEIIKEISMMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYT---LKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIPTKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFI 275          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO41410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4G7])

HSP 1 Score: 95.9005 bits (237), Expect = 6.486e-22
Identity = 59/204 (28.92%), Postives = 102/204 (50.00%), Query Frame = 3
Query: 1530 RFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRY-LAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF 2138
            R +Q   + +DD  IY+ +EY+  G + E++     ++  + +K+SRQILEG+ +LH N  + RD+   +IL D   +VKL +   SK     +  +  +      Y +APE++    Y   AD+WS G  V ++ + K  +AD +   A+  I          S L+   +E F+ + L+ N   R S  +L+  SF+  +S 
Sbjct:   65 RIVQYYGIETDDLHIYIFMEYLPGGSIHEHIKQHGALNESLTRKYSRQILEGILYLHTNRIVHRDIKGANILRDLYGNVKLADFGASKRLQTIRSKTGFRSVHGTPYWMAPEVINGEGYGRKADVWSVGCTVVEMLTTKPPWADFEPMAALFKIATQPTEPELPSDLSVDAVE-FVRSTLRMNSKSRPSADELLRFSFVTNSSM 267          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO44439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVS7])

HSP 1 Score: 92.0485 bits (227), Expect = 3.906e-20
Identity = 69/278 (24.82%), Postives = 130/278 (46.76%), Query Frame = 3
Query: 1332 PVLVCVMKRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIK---KYQIG-DLKLILKELAVFQITKSCSRFI-QISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKK-----CLFVRYLAPEILKEMIY-DSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKN 2132
            P     + ++ D+  +E I SG F K   A+ +T  EK+ IK   K  +G DL  + +EL   +    C + I Q+ +V   D +IY+ +EY   G + +Y+   + +     + + RQI+  + ++H+     RDL P ++L+D   ++KL +          KP   + +     C    Y APE++  + Y  +  D+WS G L++ L  G   +   D+D   K        ++++     +   + +   L+ +P +RA I  L++H ++ K 
Sbjct:    4 PAFPVELSKYYDV--RETIGSGGFAKVKLAVHRTSGEKVAIKMMNKEALGHDLPRVQRELEAMK--DLCHQHICQLYHVIETDENIYMVLEYAQGGELFDYIVAKDRLKEDEARGFFRQIISAVAYIHEKGYAHRDLKPENLLLDEEQNIKLIDFGLVA-----KPEGGMTEQLETCCGSPAYAAPELISGLPYFGNEVDLWSMGVLLYALVCG---FLPFDDDNTYKLYRLIQKGEYEIPSWLSQGTVAILGQLLQVSPRKRAKIQDLVNHDWVMKG 269          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO46647 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPA2])

HSP 1 Score: 87.0409 bits (214), Expect = 1.537e-18
Identity = 73/280 (26.07%), Postives = 128/280 (45.71%), Query Frame = 3
Query: 1353 KRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIK----KYQIGDL---KLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPS--SSIK-----KCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELY-ADLDN-----DKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKN 2132
            KR  +  L + I  GSF K  +       EK+ +K    K  + D    K + +E  + Q+ +     I +  V   ++  Y+  E    G + +Y+ + + +    ++K+ RQI+  +Q+LHQ   I RDL   ++L+D   ++++ +   S      KP   S IK     +C    Y APEIL   +Y +  D+WS G  ++ + +GK  Y A+  N     +K V+   E + +  +LS          +   L  +P ER S+ + I+H +L K 
Sbjct:   20 KRVGNYLLGKTIGEGSFAKVKQGFHVLTGEKVAVKIIDKKQALEDRYVSKNMRREARILQMVRH-PHIISLLEVVETENRYYLVFELAGGGDLMDYICYRKRLGETEVRKFIRQIISAVQYLHQGGIIHRDLKVENLLLDEEYNIRIIDFGLSNTVSVAKPGDLSPIKDYCKTQCGSPAYAAPEILGHQLYGTKVDVWSIGVNMYAMLTGKLPYTAEPFNIVTLYNKMVRG--EMNAVPDRLS----PSCRDLLMRFLTFDPDERISLDEAINHVWLKKG 292          
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Match: EDO37575 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFG8])

HSP 1 Score: 87.4261 bits (215), Expect = 1.885e-18
Identity = 53/200 (26.50%), Postives = 100/200 (50.00%), Query Frame = 3
Query: 1530 RFIQISNVYSDDSSIY-VAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLA 2126
            RF  + N     + +Y V +EY   G + E L     I   ++  W+ QI +G+ +LH N  I RDL   +IL+ +ND +K+   +F    ++ + S+ +     V ++APE+++        D+WSFG L+++L +G+  Y  +D+   +  +   +N+Q  +     + ++  +  C  S P  R S  Q++ H  +A
Sbjct:   85 RFKGVCN----QAPVYCVVMEYCPYGQLFEVLRDGREITPELLVGWTTQIADGMHYLHGNKIIHRDLKSPNILVSSNDILKIS--DFGTCKEFNEKSAKMTFAGTVAWMAPEVIRNEPCSEKVDVWSFGVLLWELLTGELPYKGVDSSAIIWGV-GSNNLQLPVPSTCPEGIQLLMKLCWNSKPKNRPSFRQVLMHIEIA 277          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000044704.1 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 106.686 bits (265), Expect = 6.431e-24
Identity = 76/267 (28.46%), Postives = 132/267 (49.44%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL---AKNSF*KIMKIDA 2162
            E++  GS+    +A  K   E + IK+  +  DL+ I+KE+++ Q   S    ++    Y  +S +++ +EY   G +++ +    + +    I       L+GL++LH    I RD+   +IL++A    KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L  +    F+S CL  NP  RA+ TQL+ H F+     NS  K M  DA
Sbjct:   37 EKLGEGSYGCVFKANYKETGEIVAIKQVPVESDLQEIIKEISIMQQCNS-PHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFIKSAKPNSVLKSMITDA 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000024938.2 (serine/threonine-protein kinase 4 [Source:NCBI gene;Acc:101175466])

HSP 1 Score: 105.531 bits (262), Expect = 1.746e-23
Identity = 76/267 (28.46%), Postives = 132/267 (49.44%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS-HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL---AKNSF*KIMKIDA 2162
            E++  GS+    +A  K   E + IK+  +  DL+ I+KE+++ Q   S    ++    Y  +S +++ +EY   G +++ +    + +    I       L+GL++LH    I RD+   +IL++A    KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L  +    F+S CL  NP  RA+ TQL+ H F+     NS  K M  DA
Sbjct:   37 EKLGEGSYGCVFKANYKETGEIVAIKQVPVESDLQEIIKEISIMQQCNS-PHVVRYYGSYFKNSDLWIVMEYCGAGSVSDIIRIRNKTLSEEEIATVVHSTLKGLEYLHFMRKIHRDIKAGNILLNAEGQAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITAIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRNPDLWSENFRDFVSQCLVKNPENRATATQLLQHPFIKSAKPNSVLKSMITDA 300          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 102.064 bits (253), Expect = 2.589e-22
Identity = 68/256 (26.56%), Postives = 130/256 (50.78%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS----HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAK 2129
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  NP +RA+ TQL+ H F+++
Sbjct:   31 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFISQ 280          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: stk3 (serine/threonine-protein kinase 3 [Source:NCBI gene;Acc:101155570])

HSP 1 Score: 101.679 bits (252), Expect = 3.190e-22
Identity = 68/256 (26.56%), Postives = 130/256 (50.78%), Query Frame = 3
Query: 1380 EQIYSGSFYKFHEALEKTKNEKILIKKYQI-GDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLS----HIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAK 2129
            E++  GS+    +A+ K   + + IK+  +  DL+ I+KE+++ Q   S    ++    Y  ++ +++ +EY   G +++ +      +   +I  I K     L+GL++LH    I RD+   +IL++     KL +   + + TD     +++    F  ++APE+++E+ Y+  ADIWS G    ++  GK  YAD+   +A+  I       F+   L   +   F+  CL  NP +RA+ TQL+ H F+++
Sbjct:   34 EKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDS-PYVVKYYGSYFKNTDLWIVMEYCGAGSVSDIIRLRNKTLTEDEIATILK---STLKGLEYLHFMRKIHRDIKAGNILLNTEGHAKLADFGVAGQLTDTMAKRNTVIGTPF--WMAPEVIQEIGYNCVADIWSLGITSIEMAEGKPPYADIHPMRAIFMIPTNPPPTFRKPELWSDDFTDFVKKCLVKNPEQRATATQLLQHPFISQ 283          
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000022068.2 (serine/threonine-protein kinase 24 [Source:NCBI gene;Acc:105356828])

HSP 1 Score: 88.9669 bits (219), Expect = 2.455e-18
Identity = 59/198 (29.80%), Postives = 100/198 (50.51%), Query Frame = 3
Query: 1554 YSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFS-KYTDYRKPSSSIKKCLFVR---YLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNS 2135
            Y   + +++ +EY+  G   + L     +D   I    R+IL+GL++LH    I RD+   ++L+    +VKL +   + + TD     + IK+  FV    ++APE++K+  YDS ADIWS G    +L  G+  ++DL   K +   L   N    L     K L+ FI  CL  +P  R +  +L+ H ++ K++
Sbjct:   87 YLKSTKLWIIMEYLGGGSALDLLEPGP-LDETQIATILREILKGLEYLHSEKKIHRDIKAANVLLSEQGEVKLADFGVAGQLTD-----TQIKRNTFVGTPFWMAPEVIKQSSYDSKADIWSLGITAIELAKGEPPHSDLHPMKVL--FLIPKNNPPTLEGNYSKALKEFIEACLNKDPSFRPTAKELLKHRYIVKHA 276          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074945.1 (SMESG000074945.1)

HSP 1 Score: 606.29 bits (1562), Expect = 0.000e+0
Identity = 323/332 (97.29%), Postives = 327/332 (98.49%), Query Frame = 3
Query:   72 MSNLIFIFLLSGVICAGGEKPRFICQNPKSFRTNDNSCADYNDVCIKTGDPDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESNAGRTNKMIGLLIATXXXXXXXXXXXXXXXRFSIITRCLKIRKKKSFSSQRPLLDSTDNQNNLNQAKYQNYFENIKDLFDTKFTEVIGIVKNLSEIYSMQFQVAGSENLIKVKVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDLEDNKCLLSQISFQPDVIIKCEFDETRKSNGILDLRIRDFNGKVKLYQFYKNQTVKDVKETLLPDGVGEAIVLKNTKKLENTD 1067
            MSNLIFIFLLSGVICAGGEKPRFICQNPKSFRTNDNSCADYNDVCIKTGDPDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESNAGRTNKMIGLLIATLVVNLIFVLLLIVEVRFSIITRCLKIRKKKS SSQ+PLLDSTDNQNNLNQAKYQN FENIKDLFDTKFTE+IGIVKNLSEIYSMQFQVAGSENLIK+KVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDLEDNKCLLSQI FQ DVIIKCEFDETRKSNGILDLRIRDFNGKVKLYQFYKNQTVKDVKETLLPD VGEAIVLKNTKKLENT+
Sbjct:    1 MSNLIFIFLLSGVICAGGEKPRFICQNPKSFRTNDNSCADYNDVCIKTGDPDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESNAGRTNKMIGLLIATLVVNLIFVLLLIVEVRFSIITRCLKIRKKKSSSSQKPLLDSTDNQNNLNQAKYQNNFENIKDLFDTKFTEMIGIVKNLSEIYSMQFQVAGSENLIKLKVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDLEDNKCLLSQIFFQADVIIKCEFDETRKSNGILDLRIRDFNGKVKLYQFYKNQTVKDVKETLLPDEVGEAIVLKNTKKLENTE 332          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074944.1 (SMESG000074944.1)

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 255/263 (96.96%), Postives = 259/263 (98.48%), Query Frame = 3
Query: 1350 MKRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIKKYQIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF 2138
            MKRFCDIELQ+QIYSGSFYKFHEALEKTKNEKILIKK+QIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIE IDIRMIQKWSRQILEGLQFLHQNDTIVRDLNP SILIDANDDVKLFNLNFSKYTDY KPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDN+KAVKSILEYSNIQFKLSR NFK+LESFISNCLKSNPMERASITQLISHSFLAKNSF
Sbjct:    1 MKRFCDIELQKQIYSGSFYKFHEALEKTKNEKILIKKFQIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIESIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPASILIDANDDVKLFNLNFSKYTDYSKPSSSIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNEKAVKSILEYSNIQFKLSRPNFKKLESFISNCLKSNPMERASITQLISHSFLAKNSF 263          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074941.1 (SMESG000074941.1)

HSP 1 Score: 317.39 bits (812), Expect = 1.078e-97
Identity = 216/653 (33.08%), Postives = 368/653 (56.36%), Query Frame = 3
Query:  126 EKPRFICQNPKSFRTNDNSCADYNDVCIKTGDPDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESNAGRTN-----------KMIGLLIATXXXXXXXXXXXXXXXRFSIITRCLKIRKKKSFSSQRPLLDSTDNQ--NNLNQAKYQNYFENIK----DLFDTKFTEVIGIVKNLSEIYSMQFQVAGSENLIKVKVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDLEDNKCLLSQISFQPDVIIKCEFDE--TRKSNGILDLRIRDFNGKVKLYQFYKNQTVKDVKETLLP--DGVGEAIVLKNTKKLENTDKLAKCDLDDDSLLTLIKSEHTKLSMNYMFYEDQKLSVTYCTTDPIKNILVNIANQMNTNIKNLVLFIDRLYLDVGKYLYEYGKDIQNQ-PVLVCVMKRFCDIELQEQIYSGSFYKFHEALEK-TKNEKILIKKYQIGDLKL-----ILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKK----CLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSI 1988
            E PR  C     F+T DN C D+ +VC+K  D +C NFQT C QCPPSNYS++M++D++ +KN++I +K Q++ L  + E    +T+           K+  LL   + +  I ++L++VEVRF + T+    RK +   S+  +L S  ++   +L  A      E I+    +  D K  E++  +++L +  ++  +      +++V V+  DT VK+KR I  ++  ++  ++K M MK +   ++DN+ LL ++  + + II CEFDE    K   +L++ +  F GK    +  K++ + D+++ +    +   + I+LK+  KLE           DD+ L +I+S   +L+++ +F E   + VTY  TD +  +  ++A+  + +    VLF+    LD  K++Y+Y   I+N+  +  C ++R   +EL   +Y G  Y+  +A +K TK E +L++   I + K      I+KEL +FQITKS  RF+++ N+Y  D ++YV++E MS+G +  YL     IDI+++  WS +IL GL++LHQN  ++RDLNP++IL+D N D+KL+  N SKYT+Y  PS+  K      L VRY APE+     Y+   D+WSFG ++ K+ + K+ + DL  D+ VK I
Sbjct:   19 EIPRSHCPIGSPFKTKDNLCKDFYEVCVKQNDLECLNFQTICKQCPPSNYSVLMFMDLLTVKNELIKTKDQLEALKTQSELCQNKTSGTLMKQNQQIKKIFTLLWILIFIIAIILVLIVVEVRFKLFTKI--CRKHQKSKSRYEILKSRKHEYLKDLILANESKSIERIRSSLEETIDRKLNELMAKMESLLDQNNLPIKFKVDSQVLEVAVTENDTAVKIKRDICQRLPGRNSDSFKRMIMKYHRCLIDDNEYLLKRLETR-NKIITCEFDEKINPKDFVVLNIEMEHFPGK--FIKIRKSENILDLQKIIKAHFNNPSDLIILKDGLKLEGPQTFE--GWLDDTCLRVIESNEKELTISNIFDEKTTVRVTYLPTDSVGIVKKHMADTFSADADRFVLFLRNHSLDENKFMYQYK--IENEYSINYCCLQRLNGVELGTSLYKGIIYELLKAKDKATKKEMLLLRCNIIAENKFRENEHIVKELRIFQITKSNERFVKLLNIYQKDQNVYVSMENMSEGTLKMYLDKYWPIDIKIVFDWSMKILCGLEYLHQNKIVLRDLNPSTILVDENRDIKLYGFNLSKYTEYYSPSTFSKSDNFTGLSVRYFAPELFLNEDYNEKCDLWSFGVVLVKITTKKKPFPDLSRDQIVKCI 662          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074938.1 (SMESG000074938.1)

HSP 1 Score: 304.679 bits (779), Expect = 3.963e-92
Identity = 221/736 (30.03%), Postives = 389/736 (52.85%), Query Frame = 3
Query:   84 IFIFLLSGVICAGGEKPRFICQNPKSFRTNDNSCADYNDVCIKTGDPDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESNAGRT------NKMIGLLIATXXXXXXXXXXXXXXXRFSIITRCLKIR-----------KKKSFSSQ-----------RPLLDSTDNQNNLNQA-------------KYQNYFENIKDLFDTKFTEVIGIVKNLSEIYSMQ-----FQVAGSENLIKVKVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDLEDNKCLLSQISFQPDVIIKCEFDETRKSNGILDLRIRDFNGKVKLYQFYKNQTVKDVKETLLPD-GVGEAIVLKNTKKLENTDKLAKCDLDDDSLLTLIKSEHTKLSMNYMFYEDQKLSVTYCTTDPIKNILVNIANQMNTNIKNLVLFIDRLYLDVGKYLYEYGKDIQNQPVLVCVMKRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIKKYQIGDLK------LILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKY-TDY-RKPSS-SIKKCLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKELESFISNCLKSNPMERASITQLISHSFL 2123
            I +FL+S       E+P  IC   + F+T DN+C ++N++C+K  DP+C NF++ C QCPP NY+ +M+  +  +       + + K + + VE  + +       N ++  +I   V+  I +L LI + + SI  R  K++           K    S Q           +PL+ S     N  Q              K    F+  K   D K  E    ++    I++ Q     FQ+  + + I++ +  ++ +V++KRKI  +      G YKIMK+  N K L+DN+   S +S + DVII CE +++   N I+ L +        L Q  K Q V ++KE +         ++ + +K+L +++ + +  L D   + +I   H ++ +  +F E + L V + ++D +  +  N+AN +N++  N  LF    YLD  K L++YG +  ++   VC+ +   D+E+ E+I  G +    +A  K+K++ I++KKY   DL       ++LKEL++FQ  KS  RF+++  +Y +++  Y+A+E M  G +  ++   + +D + I  WS+QILEGL++LH  + + RDL  ++ILID  +DVKL +++ SKY  DY RKP     +  L +RY+APEIL++  Y   AD+WSFGA++ ++ +G + Y++L+   A++ I++   I++  + ++   L+ FI  CL  NP ER+S  +L++HSFL
Sbjct:   11 ILLFLIS---VTHQEQPLSICHIDRPFKTMDNTCMNFNELCVKKEDPECNNFKSVCTQCPPVNYTFIMFQKLNRLIEDQKRVEIKTKEINEAVEKLSLKKEIKSVLNSILAFVIILPVLLFIGLLYLIRKNKLSIKVRSRKVKISENEEQGDMLKPLIISQQVSENEEQGDMLKPLIISQQVSENEEQGDMLKPLIINQQDLKIDERFKEFKLFLDLKLEENFQKLQAFQGIFANQNKDTKFQLKAAAHPIELNIHIDENIVQIKRKIVSKCPTLRKGCYKIMKLHYNGKVLDDNQYFFSCVSCR-DVIISCEVNQSLDPNEIIVLNVHSKERMPDLLQIKKTQAVSELKEIISKIIQRKNFVIFQESKELIDSELINESKLVDFDWIKVIIKNHEEIFLRSIFDERENLVVEFESSDMVSTLKSNLANNVNSSPDNYALFYYNEYLDDTKLLFDYGINQHSEVKFVCI-RNLHDVEVIEEIDRGYYSVLLKAKIKSKDKDIVLKKYTEIDLPDLNKNNVLLKELSIFQTLKSHHRFLKLFGIYKEENYFYIAMENMKGGSIKTHIKKNKPLDEKQIAFWSKQILEGLKYLHDQEFVYRDLKTSNILIDDKNDVKLPSVSLSKYLHDYNRKPEQMGYQDNLPLRYMAPEILQQHPYGIKADVWSFGAIIVEMVTGIQPYSELNETDAIQRIIQDRTIKYNTTAIS-HNLKEFIGLCLIFNPEERSSDDKLMNHSFL 740          
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Match: SMESG000074913.1 (SMESG000074913.1)

HSP 1 Score: 281.952 bits (720), Expect = 8.756e-84
Identity = 221/725 (30.48%), Postives = 372/725 (51.31%), Query Frame = 3
Query:  120 GGEKPRFICQNPKSFRTNDNSCADYNDVCIKTGDPDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESNAGRTNKMIGLL--------------IATXXXXXXXXXXXXXXXRFSIITRCLKIRKKKSFSSQRPLLDSTDNQNNLNQAKYQNYFENIKDL--------------FDTKFTEVIGIVK---NLSEIYS-MQFQVAGSENLIKVKVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDLEDNKCLLSQISFQPDVIIKCEFDETRKSNGILDLRIRDFNGKVKLYQFYKNQTVKDVKETLLPDGVGEAIVLK--------NTKK----LENTDKLAKCDLDDDSLLTLIKSEHTKLSMNYMFYEDQKLSVTYCTTDPIKNILVNIANQMNTNIKNLVLFIDRLYLDVGKYLYEYGKDIQNQPVLVCVMKRFCDIELQEQIYSGSFYKFHEALEKTKNEKILIKKY------QIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSSIYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVRDLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKK------CLFVRYLAPEILKEMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLSRLNFKE-LESFISNCLKSNPMERASITQLISHSFL 2123
             GE PR  C+N K F+T D  C ++++VCIK GD DC +F   C QCP +NYS++M+ D+  +K ++  +K  M N+  ++++   +  K+   L                 +++N++   LL++E+RF IIT+ +  RK+K  S+Q  +L+S  +         +NYF + K++               ++K  E++ I+    NLS++    +F++ G  N IK+K+  +D  V +KR+I H++      +YKI+K+K N K LEDN+   S  +   D  I CE D +  SN IL ++         L Q  K+QT+ D+K+  L  G+ +A  L+        N KK    LE    +A+C++ D+  L  I  E  KL+++ +F E     + Y  TD I  + +++   +N  +++ VL I +  L    + +EY     N PV  C + +   IE+ + +  G+      A  +  N+K+LIKKY      +  D   I++E+  FQ+TK   RF+ +  VY+D    YVA+E M  G +  ++  +       I+KWS Q+LEGL++LH    I RDLNP+SIL++ + D+KL + N SKY    +PSS   K       L ++Y APEIL+   + + AD+WSFGA++ K+ + +  +      +            +  S L   E L + I +CLK +   R+++  L++  F+
Sbjct:   17 SGETPRMTCRNLKPFKTADYQCDNFSNVCIKKGDQDCESFMEICAQCPATNYSVLMFYDITKIKGELENTKLNMNNIATEMKTTKEKLIKITNQLKFSEQGKNIIYILLWIIIIINILMFFLLLLEIRFKIITKLIDHRKRKG-SNQYKILESRKSMF------LKNYFMDTKEVNEKFELQHYKFEHKIESKLIEILNILNTSTNLSKLKEKSKFRMNG--NTIKIKIEKKDNCVVIKRRICHKLYLVKSEDYKILKLKYNGKTLEDNQ-YFSTFNIPTDEEILCEKDLSINSNNILVVKPAGNIQLPDLIQIQKHQTISDLKK--LTPGISDAENLRIFAEIKDGNDKKQFKILEEESTVAQCNIIDEEFLYFISREVKKLAISSIFDEGNSAVIDYDNTDTILAMKMSLCTPLNCCLEDFVL-IQKGTLSEKAFAFEYDF-TGNDPVKYCRISKLVAIEIGDCVNDGNHSDLFRAKMRVTNKKLLIKKYFHTTEKKFADNIYIIREIITFQLTKDHPRFVNLYGVYNDPKCFYVAMENMELGTLKSFIK-VNKPTENDIKKWSSQMLEGLKYLHDQQVIHRDLNPSSILLNESKDLKLSSFNLSKYKILNEPSSVFVKDVEDLHKLPIKYFAPEILRNERFTTKADVWSFGAILIKIITQRAPFPGKPKLEIKTGFANNEIGDYDCSALQCGEGLRTIIMSCLKIDQGTRSTVESLLNEDFI 726          
The following BLAST results are available for this feature:
BLAST of Protein kinase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STK44.258e-2225.90serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK37.476e-2227.45serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
STK37.737e-2227.45serine/threonine kinase 3 [Source:HGNC Symbol;Acc:... [more]
STK41.600e-2125.90serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
STK17B3.277e-1927.84serine/threonine kinase 17b [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cst-21.281e-2327.24Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
cst-11.974e-2327.24Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-12.370e-2327.24Serine/threonine-protein kinase cst-1 Serine/threo... [more]
max-29.734e-1825.69Serine/threonine-protein kinase max-2 [Source:Uni... [more]
air-11.752e-1725.52Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PhKgamma1.710e-1824.11gene:FBgn0011754 transcript:FBtr0343587[more]
PhKgamma2.545e-1824.02gene:FBgn0011754 transcript:FBtr0090002[more]
PhKgamma2.545e-1824.02gene:FBgn0011754 transcript:FBtr0343648[more]
hpo7.152e-1825.39gene:FBgn0261456 transcript:FBtr0331920[more]
hpo7.152e-1825.39gene:FBgn0261456 transcript:FBtr0086500[more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk32.751e-2125.90serine/threonine kinase 3 (STE20 homolog, yeast) [... [more]
stk32.751e-2125.90serine/threonine kinase 3 (STE20 homolog, yeast) [... [more]
stk24a1.644e-1828.57serine/threonine kinase 24a (STE20 homolog, yeast)... [more]
stk24b3.917e-1829.59serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
stk24b4.044e-1829.59serine/threonine kinase 24b (STE20 homolog, yeast)... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
elp44.249e-2327.09elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.655e-2327.09elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.862e-2327.09elongator acetyltransferase complex subunit 4 [Sou... [more]
elp44.992e-2327.09elongator acetyltransferase complex subunit 4 [Sou... [more]
elp45.553e-2327.09elongator acetyltransferase complex subunit 4 [Sou... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stk41.865e-2125.90serine/threonine kinase 4 [Source:MGI Symbol;Acc:M... [more]
Stk32.649e-2126.38serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Stk33.542e-2126.38serine/threonine kinase 3 [Source:MGI Symbol;Acc:M... [more]
Aurkc1.435e-1825.37aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
Aurkc1.435e-1825.37aurora kinase C [Source:MGI Symbol;Acc:MGI:1321119... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8XJW8|CST1_CAEBR1.043e-2227.60Serine/threonine-protein kinase cst-1 OS=Caenorhab... [more]
sp|Q9S7U9|M2K2_ARATH1.795e-2230.40Mitogen-activated protein kinase kinase 2 OS=Arabi... [more]
sp|Q9NB31|CST1_CAEEL2.511e-2227.24Serine/threonine-protein kinase cst-1 OS=Caenorhab... [more]
sp|Q6IP06|STK3_XENLA3.751e-2227.09Serine/threonine-protein kinase 3 OS=Xenopus laevi... [more]
sp|Q802A6|STK4_SQUAC3.110e-2127.24Serine/threonine-protein kinase 3/4 OS=Squalus aca... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1R2CIP84.344e-2328.83Protein kinase domain-containing protein OS=Stento... [more]
A0A194YJT72.822e-2230.77Uncharacterized protein OS=Sorghum bicolor OX=4558... [more]
A0A1R2AP633.018e-2232.53Protein kinase domain-containing protein OS=Stento... [more]
A0A0N4V5X84.552e-2228.40Uncharacterized protein OS=Enterobius vermicularis... [more]
A7S0A94.668e-2227.17Predicted protein OS=Nematostella vectensis OX=453... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stk34.762e-2226.77serine/threonine kinase 3 [Source:NCBI gene;Acc:10... [more]
STK45.712e-2026.83serine/threonine kinase 4 [Source:HGNC Symbol;Acc:... [more]
stk25b1.187e-1827.66serine/threonine-protein kinase 25-like [Source:NC... [more]
stk17a1.763e-1826.04serine/threonine kinase 17a [Source:NCBI gene;Acc:... [more]
stk24b3.853e-1828.79serine/threonine-protein kinase 24-like [Source:NC... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008193.18.828e-1927.37pep scaffold:Pmarinus_7.0:GL476850:102262:127365:-... [more]
RPS6KA37.124e-1823.08ribosomal protein S6 kinase A3 [Source:HGNC Symbol... [more]
ENSPMAT00000001965.11.016e-1726.63pep scaffold:Pmarinus_7.0:GL477178:11064:57293:1 g... [more]
ENSPMAT00000001973.11.040e-1726.63pep scaffold:Pmarinus_7.0:GL477178:11064:57290:1 g... [more]
stk17b1.476e-1724.90serine/threonine kinase 17b (apoptosis-inducing) [... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RAD532.157e-1925.00DNA damage response protein kinase; required for c... [more]
TPK32.799e-1724.88cAMP-dependent protein kinase catalytic subunit; p... [more]
KIN23.656e-1725.46Serine/threonine protein kinase involved in regula... [more]
SCH95.044e-1726.89AGC family protein kinase; functional ortholog of ... [more]
SKM15.621e-1724.31Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428456.455e-2627.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO414106.486e-2228.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444393.906e-2024.82Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466471.537e-1826.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO375751.885e-1826.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000044704.16.431e-2428.46serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
ENSORLT00000024938.21.746e-2328.46serine/threonine-protein kinase 4 [Source:NCBI gen... [more]
stk32.589e-2226.56serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
stk33.190e-2226.56serine/threonine-protein kinase 3 [Source:NCBI gen... [more]
ENSORLT00000022068.22.455e-1829.80serine/threonine-protein kinase 24 [Source:NCBI ge... [more]
back to top
BLAST of Protein kinase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000074945.10.000e+097.29SMESG000074945.1[more]
SMESG000074944.10.000e+096.96SMESG000074944.1[more]
SMESG000074941.11.078e-9733.08SMESG000074941.1[more]
SMESG000074938.13.963e-9230.03SMESG000074938.1[more]
SMESG000074913.18.756e-8430.48SMESG000074913.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025887 ID=SMED30025887|Name=Protein kinase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2296bp
CGACAATAAAAAAAATAAATCTGTCAAAAATATGAACCATCTATAGAATT
TGAGCATCATTTTTACATTTTATGTCAAATTTGATATTCATTTTTTTATT
GTCGGGTGTTATTTGTGCTGGCGGGGAAAAGCCAAGATTCATTTGTCAAA
ATCCCAAATCGTTCCGGACCAATGATAATTCGTGCGCAGATTATAATGAT
GTTTGTATTAAAACAGGAGATCCAGACTGTGCGAATTTCCAAACTGCTTG
TAATCAGTGCCCTCCATCCAATTACAGCATAATGATGTACATTGACATGA
TGAATATGAAAAATCAAATTATAATTTCAAAGAGTCAAATGAAAAATCTA
ACAGATAAAGTTGAAAGTAATGCCGGGAGAACAAATAAAATGATCGGATT
GTTGATAGCAACTCTGGTTGTGAACCTCATTTTTGTTCTTTTGCTGATAG
TCGAAGTCCGATTCAGCATAATAACTAGATGCCTCAAAATACGAAAAAAA
AAATCCTTCTCATCCCAAAGGCCTCTTTTAGATTCTACAGATAATCAAAA
TAATTTGAATCAGGCGAAATATCAAAATTATTTTGAAAATATTAAAGATT
TATTTGATACAAAATTTACTGAGGTGATTGGCATCGTGAAAAATTTATCG
GAAATATATTCTATGCAATTTCAAGTGGCTGGAAGTGAAAATCTGATAAA
GGTAAAGGTCTCTCCCGAAGATACAGTGGTGAAAGTAAAAAGAAAGATTT
TTCATCAAATTCGTGAAAAGTCTTTGGGAAATTATAAAATTATGAAAATG
AAATGCAATGAAAAAGATCTCGAGGATAACAAATGTCTTTTGTCTCAAAT
CTCTTTTCAACCCGATGTAATCATCAAATGTGAATTTGATGAGACAAGAA
AATCAAATGGAATTCTTGATCTACGAATTCGAGATTTTAACGGAAAGGTC
AAATTATACCAATTCTACAAAAATCAGACGGTTAAAGATGTGAAAGAGAC
ATTGTTACCCGATGGAGTCGGAGAAGCTATTGTTTTGAAAAACACAAAGA
AATTGGAAAACACTGACAAATTAGCGAAATGTGATTTAGATGATGATTCC
TTGTTGACTTTGATAAAGAGTGAGCACACGAAACTTTCTATGAATTACAT
GTTCTATGAGGACCAGAAGCTCTCCGTCACTTACTGTACGACAGATCCGA
TCAAAAATATACTTGTAAATATTGCCAACCAAATGAATACGAATATAAAA
AATCTGGTTTTATTTATTGACAGACTTTATTTAGACGTAGGGAAATATTT
ATACGAATATGGAAAGGACATTCAAAATCAGCCGGTGCTAGTTTGCGTCA
TGAAAAGATTTTGTGACATAGAATTACAGGAACAAATTTACAGCGGATCT
TTCTATAAGTTTCACGAAGCATTGGAAAAAACTAAGAATGAAAAAATTTT
AATTAAGAAATATCAAATTGGAGACCTGAAATTAATTTTAAAAGAATTGG
CAGTATTTCAGATAACGAAGTCTTGTTCAAGATTTATTCAGATTTCCAAT
GTTTATAGTGATGATAGCAGCATATACGTTGCCATCGAGTACATGTCTCA
GGGAGTCATGGCAGAATATCTGAGTCACATCGAAGGCATAGACATCCGTA
TGATTCAGAAATGGTCCCGTCAAATTTTAGAAGGCTTGCAGTTTCTACAT
CAAAACGATACAATTGTCCGGGACCTAAATCCGACTAGCATCCTCATTGA
CGCCAACGACGACGTCAAACTTTTCAATCTCAATTTTTCTAAATATACCG
ATTATAGAAAGCCGAGTTCGTCAATTAAGAAGTGTTTATTTGTTAGGTAT
CTTGCACCAGAGATTCTGAAAGAAATGATCTACGATTCTAGCGCAGATAT
ATGGTCATTTGGGGCCCTTGTGTTCAAGCTTGAATCTGGAAAAGAGCTTT
ATGCGGATTTGGATAATGATAAAGCAGTCAAAAGCATCCTTGAATATTCT
AACATTCAATTCAAATTGTCTCGGCTCAATTTCAAAGAATTAGAAAGTTT
CATCAGCAACTGCTTGAAGTCAAATCCTATGGAGAGAGCTTCAATCACTC
AACTAATCTCACATTCCTTTCTTGCAAAAAACTCTTTCTAAAAAATAATG
AAAATTGATGCAAAACTTGATATTACTGATAATTTTAAATGATATTTGAT
CATATCTGATTTATTTTTCTGAATTTTTAACCCTTTGATTTATTTATTTT
CATACATAATTATTTTCAAAATATTATTATGTTTATTATCCTAGAA
back to top

protein sequence of SMED30025887-orf-1

>SMED30025887-orf-1 ID=SMED30025887-orf-1|Name=SMED30025887-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=690bp
MSNLIFIFLLSGVICAGGEKPRFICQNPKSFRTNDNSCADYNDVCIKTGD
PDCANFQTACNQCPPSNYSIMMYIDMMNMKNQIIISKSQMKNLTDKVESN
AGRTNKMIGLLIATLVVNLIFVLLLIVEVRFSIITRCLKIRKKKSFSSQR
PLLDSTDNQNNLNQAKYQNYFENIKDLFDTKFTEVIGIVKNLSEIYSMQF
QVAGSENLIKVKVSPEDTVVKVKRKIFHQIREKSLGNYKIMKMKCNEKDL
EDNKCLLSQISFQPDVIIKCEFDETRKSNGILDLRIRDFNGKVKLYQFYK
NQTVKDVKETLLPDGVGEAIVLKNTKKLENTDKLAKCDLDDDSLLTLIKS
EHTKLSMNYMFYEDQKLSVTYCTTDPIKNILVNIANQMNTNIKNLVLFID
RLYLDVGKYLYEYGKDIQNQPVLVCVMKRFCDIELQEQIYSGSFYKFHEA
LEKTKNEKILIKKYQIGDLKLILKELAVFQITKSCSRFIQISNVYSDDSS
IYVAIEYMSQGVMAEYLSHIEGIDIRMIQKWSRQILEGLQFLHQNDTIVR
DLNPTSILIDANDDVKLFNLNFSKYTDYRKPSSSIKKCLFVRYLAPEILK
EMIYDSSADIWSFGALVFKLESGKELYADLDNDKAVKSILEYSNIQFKLS
RLNFKELESFISNCLKSNPMERASITQLISHSFLAKNSF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
IPR029071Ubiquitin-like_domsf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0006972hyperosmotic response
GO:0010590regulation of cell separation after cytokinesis
GO:0016310phosphorylation
GO:0031156regulation of sorocarp development
GO:0032956regulation of actin cytoskeleton organization
GO:0035329hippo signaling
GO:0046777protein autophosphorylation
GO:0051781positive regulation of cell division
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0015629actin cytoskeleton
GO:0032154cleavage furrow
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 77..328
e-value: 4.3E-23
score: 92.7
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 79..328
e-value: 3.0E-39
score: 135.0
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 77..328
score: 31.142
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 59..331
e-value: 7.6E-47
score: 161.6
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 95..328
e-value: 3.5E-25
score: 86.2
NoneNo IPR availablePANTHERPTHR43895FAMILY NOT NAMEDcoord: 49..330
NoneNo IPR availablePANTHERPTHR43895:SF32coord: 49..330
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 74..330