MATH domain-containing protein

Overview
NameMATH domain-containing protein
Smed IDSMED30025885
Length (bp)1803
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of MATH domain-containing protein (SMED30025885) t-SNE clustered cells

Violin plots show distribution of expression levels for MATH domain-containing protein (SMED30025885) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MATH domain-containing protein (SMED30025885) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MATH domain-containing protein (SMED30025885) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025885

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pigment cellSMED30025885SMESG000067198.1 SmedASXL_001853SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30025885SMESG000067198.1 SmedASXL_001878SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025885SMESG000067198.1 SmedASXL_001878SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025885SMESG000067198.1 SmedASXL_001853SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025885SMESG000067198.1 SmedASXL_001853SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30025885SMESG000067198.1 dd_Smed_v4_16468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025885SMESG000067198.1 dd_Smed_v4_16468_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30025885SMESG000067198.1 dd_Smed_v6_16468_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30025885SMESG000067198.1 dd_Smed_v6_15397_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30025885SMESG000067198.1 SMED30025885smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30025885SMESG000067198.1 SMED30025885smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30025885SMESG000067198.1 dd_Smed_v4_16468_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30025885SMESG000067198.1 dd_Smed_v4_15397_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025885SMESG000067198.1 SMED_10009_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025885SMESG000067198.1 SMED_10009_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025885SMESG000067198.1 SMED_10009_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025885SMESG000067198.1 SMED_10009_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MATH domain-containing protein vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 56.225 bits (134), Expect = 1.225e-7
Identity = 49/161 (30.43%), Postives = 74/161 (45.96%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            L V S  V  W+I +   +   AK     E  S  FY+H  GYK+Q+  F NG GSG  +H+S+ + +L G +D LL WP    +   L+DQ    +     V  +F    N++N  KP   R +       +   +FI +  +   N    DA+ +R  V
Sbjct:  302 LSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAV 462          
BLAST of MATH domain-containing protein vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 51.6026 bits (122), Expect = 3.643e-6
Identity = 38/111 (34.23%), Postives = 59/111 (53.15%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNN 1448
             VF W+I + + KR  A       I S  FY+   GYKM L ++ NG G+G  +H+S+  ++++G  D LL WP +  + + L+DQ  N   V+ +F       SF+R  N
Sbjct:  352 GVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ-NNREHVIDAFRPDVTSSSFQRPVN 461          
BLAST of MATH domain-containing protein vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 63.929 bits (154), Expect = 2.102e-10
Identity = 47/144 (32.64%), Postives = 70/144 (48.61%), Query Frame = 3
Query: 1128 WQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVE--NESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            W+I + S K   A+     E+ S  FY+   GYK+Q  +F NG G G ++HVSV + +L G+YD LL WP    +   L +Q     +  V  SF       +F+R +N      +   RFI +  L+S      D + LR +V
Sbjct:  335 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKV 478          
BLAST of MATH domain-containing protein vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 63.929 bits (154), Expect = 2.329e-10
Identity = 47/144 (32.64%), Postives = 70/144 (48.61%), Query Frame = 3
Query: 1128 WQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVE--NESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            W+I + S K   A+     E+ S  FY+   GYK+Q  +F NG G G ++HVSV + +L G+YD LL WP    +   L +Q     +  V  SF       +F+R +N      +   RFI +  L+S      D + LR +V
Sbjct:  326 WKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHELLHSRPFIKGDTVFLRVKV 469          
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 58.151 bits (139), Expect = 1.842e-8
Identity = 40/108 (37.04%), Postives = 58/108 (53.70%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I   S +R  A       + S  FYS   GYKM L L+ NG G+G  SH+S+  ++++GKYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:  383 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDVSSTSFQR 489          
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 58.151 bits (139), Expect = 1.842e-8
Identity = 40/108 (37.04%), Postives = 58/108 (53.70%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I   S +R  A       + S  FYS   GYKM L L+ NG G+G  SH+S+  ++++GKYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:  383 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDVSSTSFQR 489          
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 57.7658 bits (138), Expect = 2.308e-8
Identity = 40/108 (37.04%), Postives = 58/108 (53.70%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I   S +R  A       + S  FYS   GYKM L L+ NG G+G  SH+S+  ++++GKYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:  396 GVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDVSSTSFQR 502          
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 56.225 bits (134), Expect = 7.462e-8
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILR 1544
            L V    V  W++ + S K   AK     E  S  FY+H  GYK+Q+  F NG GSG  SH+S+ + +L G+YD LL WP  + +   ++DQ    +     +  +F    N++N  KP   R +       +   +FI +  +   N    ++I L+
Sbjct:  302 LSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRNYIRDNSIFLK 459          
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 56.225 bits (134), Expect = 7.462e-8
Identity = 47/158 (29.75%), Postives = 75/158 (47.47%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILR 1544
            L V    V  W++ + S K   AK     E  S  FY+H  GYK+Q+  F NG GSG  SH+S+ + +L G+YD LL WP  + +   ++DQ    +     +  +F    N++N  KP   R +       +   +FI +  +   N    ++I L+
Sbjct:  302 LSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPCSSRNSLDESTLGFGYPKFISHEEIKKRNYIRDNSIFLK 459          
BLAST of MATH domain-containing protein vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 62.3882 bits (150), Expect = 1.116e-9
Identity = 53/161 (32.92%), Postives = 78/161 (48.45%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            L V S  V  W+I + S K   AK     E  S  FY+H  GYK+Q+  F NG GSG  S++SV + +L G+YD LL WP  + +   L+DQ    +     +  +F    N++N  KP+  R +       +   +FI +  +   N    +AI LR  V
Sbjct:  302 LSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNFQKPTGSRNSLDESTLGFGYPKFISHEDIRKRNYVRDNAIFLRASV 462          
BLAST of MATH domain-containing protein vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 55.4546 bits (132), Expect = 1.419e-7
Identity = 48/161 (29.81%), Postives = 74/161 (45.96%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            L + S  V  W+I +   +   AK     E  S  FY+H  GYK+Q+  F NG GSG  +H+S+ + +L G +D LL WP    +   L+DQ    +     V  +F    N++N  KP   R +       +   +FI +  +   N    DA+ +R  V
Sbjct:  302 LSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASV 462          
BLAST of MATH domain-containing protein vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 50.447 bits (119), Expect = 5.361e-6
Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I + + KR  A       I S  FY+   GYKM L ++ NG G+G  +H+S+  ++++G  D LL WP +  + + L+D   N   V+ +F       SF+R
Sbjct:  359 GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDVTSSSFQR 465          
BLAST of MATH domain-containing protein vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 50.447 bits (119), Expect = 5.505e-6
Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I + + KR  A       I S  FY+   GYKM L ++ NG G+G  +H+S+  ++++G  D LL WP +  + + L+D   N   V+ +F       SF+R
Sbjct:  352 GVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH-NNREHVIDAFRPDVTSSSFQR 458          
BLAST of MATH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 5.884e-7
Identity = 49/161 (30.43%), Postives = 74/161 (45.96%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            L V S  V  W+I +   +   AK     E  S  FY+H  GYK+Q+  F NG GSG  +H+S+ + +L G +D LL WP    +   L+DQ    +     V  +F    N++N  KP   R +       +   +FI +  +   N    DA+ +R  V
Sbjct:  302 LSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRAAV 462          
BLAST of MATH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 55.4546 bits (132), Expect = 9.923e-7
Identity = 48/161 (29.81%), Postives = 74/161 (45.96%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            L + S  V  W+I +   +   AK     E  S  FY+H  GYK+Q+  F NG GSG  +H+S+ + +L G +D LL WP    +   L+DQ    +     V  +F    N++N  KP   R +       +   +FI +  +   N    DA+ +R  V
Sbjct:  302 LSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKRNYVRDDAVFIRASV 462          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 3.535e-16
Identity = 124/506 (24.51%), Postives = 230/506 (45.45%), Query Frame = 3
Query:  120 IWNLLDKYNFD-IDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIV----DVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKV--HSEII-----EMQSLQAHENENRNCLSDKIIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQ-----LTEELQNAKEQ----LSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEI-SNSKEKNENITCLQRRFKCFSFSKSLLVESLSV-FEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNY----RNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAH-KDAIILRCRV 1553
            +  LL KYN   +D     DLLC++C  ++ +   S C C YC+ C   Y+S    YCPG    CK++ +    DV ++I + +    +IS+I+VKCP   CN+  E+  +  H+     K + E      + +   +E  L+  M        + LT +V  H+++I     E++S   H NE          E  + L ++    K L D +  +++ L +E     LRN+      L++++Q  K +    L+S + +L+K    ++I ++ ++   F +N    +  G T +K  + D   E F +        K  I SN++E+   +  L R  K        L  ++ + F W+I   S KR        T++ S++F SH+  + + L ++ +        ++ +  +I++G+ D  L WPM   + + +I+Q   ++   T F Y    RN K +F+R  +         +  + Y+++    +    D+II+ C V
Sbjct:    9 VQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLST----RISRIVVKCPNIRCNYTSELLRLKEHL----DKCTPESVECPCVTIGCEEEPLLKDEM-------AKHLTDQVLRHTQLIMSFCNELKSEINHNNETTK-------EDISHLKEVLRVQKALNDEKTAQMEFLIEE-----LRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIE---FMKNDLEVV--GSTDIKNQVKDLKKEIFGI--------KMNIDSNNEERERKMNNLIRLNK--------LCPNVDMDFMWRIEEYSKKRRTV-----TDVYSDSFQSHNYKFCLNLYIYGD--------NLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRN-KKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVV 452          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 78.5666 bits (192), Expect = 8.642e-13
Identity = 42/110 (38.18%), Postives = 62/110 (56.36%), Query Frame = 3
Query:  120 IWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHI 449
            I  LL  YNF+++     +L C +CKN+L N  +S C C +C KC  +Y+S G  YCPG  + CK+E + +  +IH       KI+++ VKCP E C    E+  I  H+
Sbjct:    6 INRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHL 115          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: A0A4W4GYA1 (TNF receptor-associated factor OS=Electrophorus electricus OX=8005 GN=LOC113588078 PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 5.038e-9
Identity = 99/441 (22.45%), Postives = 179/441 (40.59%), Query Frame = 3
Query:  183 CVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIV-----DVLKSIHVYSE--AVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIE--MSNSTELLMNYFDEVR-----LEMNMFSLDFEKT----EELTSKVHSEIIEMQSLQAHENENRNCLSDKIIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIE----IKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
            C  CK +L  P+++ C   +C  CF++  S G    P  C  C+ E +      +L     + +  A  +I  +  KCP E C++   +K        H+ +   E     + ++L+   D  R      E    +  + K     +++  K H EI +   +Q  +   +    +K  E +        K K+    +EI    +    K+       +TE L+     LS+++ +       ++ +   L+      NR +E      E  T+ +  LD    E  +   R++++  T       ++E            S  +        +F W+I + S +R  A       + S  FYS   GYKM L L+ NG G+G ++H+S+  +++ GKYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:   42 CQQCKEVLRKPFQAQCGHRFCVFCFKELTSSG----PIPCEACRAEGIFEEQLSMLNITEAFPDNAARREIDSLPAKCPNEGCSWTGTLKDYEGQ---HEGRCEFERVTCEACQVLILLSDRDRHNERECEARTLNCKYCKVSFNFKDI--KAHDEICQKFPMQCKDCGKKKIPREKFQEHSKSCA----KSKSACQFREIGCRAVVDNGKQHEHEQASITEHLRLMLAVLSAVRLRADGAGECVQQKMTALENIACVLNREVERTALTLEALTR-QHRLDQEKIESLSTKVRQLERTLTMRDLKLAESEQ-----------SLRELQFCTYDGMFIWKISDFSHRRQDALAGRSPALFSPAFYSSKYGYKMCLRLYMNGDGTGRNTHLSLFFVVMRGKYDALLKWPFGQKVTLMLLDQ-NNREHIIDAFRPDTSSTSFQR 456          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: A0A2G8K8V3 (Putative TNF receptor-associated factor 4 (Fragment) OS=Stichopus japonicus OX=307972 GN=BSL78_18713 PE=4 SV=1)

HSP 1 Score: 69.3218 bits (168), Expect = 8.928e-9
Identity = 48/145 (33.10%), Postives = 74/145 (51.03%), Query Frame = 3
Query: 1128 WQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESK---VLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRV 1553
            W+I   S +   AK   E E+ S  F++   GYK+Q+ LFPNG GSG  SH+SV + ++ G+YD LL WP    +   L+DQ +N  K   +  SF       +F+R +       Y    F+ + +L + +    D + LR +V
Sbjct:  246 WKIDRYSQRVANAKSESEIELCSPPFFTGRYGYKLQVSLFPNGNGSGEGSHLSVYVRVMCGEYDSLLKWPFTHPISFTLLDQADNSPKRMHIKESFKPEPTWKNFQRPSKDVHTLGYGYPTFVSHVFLKTRHYVKNDVMFLRVKV 390          
BLAST of MATH domain-containing protein vs. TrEMBL
Match: T1IH91 (MATH domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 2.310e-8
Identity = 36/95 (37.89%), Postives = 58/95 (61.05%), Query Frame = 3
Query: 1104 VESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENES 1388
            + S   F W++ N +  ++  K   E  + S+ FYS   GYKM+L+LFPNGIG G   H+S+ L I++G YD +L WP+++     ++DQ ++E 
Sbjct:   88 LPSSGHFTWKVENFAQLQINVKSGSEKGVYSDPFYSSEFGYKMRLMLFPNGIGIGKEPHLSIALQIMKGPYDAVLKWPIEYRASFSVLDQSKHEG 182          
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 58.5362 bits (140), Expect = 1.106e-8
Identity = 49/158 (31.01%), Postives = 78/158 (49.37%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ----VENESKVLTSF----NYRNL-KPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILR 1544
            L V    V  W++ + S K   AK +   E  S  FY+H  GYK+Q+  F NG GSG  SH+S+ + +L G+YD LL WP  + +   ++DQ    +     +  +F    N++N  KPS  R +       +   +FI ++ +   N    +AI L+
Sbjct:  302 LSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNFQKPSSSRNSLDESTLGFGYPKFISHDEIRKRNYIRDNAIFLK 459          
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 58.151 bits (139), Expect = 1.903e-8
Identity = 40/108 (37.04%), Postives = 58/108 (53.70%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I + S +R  A       + S  FYS   GYKM L L+ NG G+G  SH+S+  +++ GKYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:  382 GVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDISSTSFQR 488          
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Match: traf4b (TNF receptor-associated factor 4-like [Source:NCBI gene;Acc:103043275])

HSP 1 Score: 55.8398 bits (133), Expect = 7.903e-8
Identity = 32/88 (36.36%), Postives = 51/88 (57.95%), Query Frame = 3
Query: 1116 SVFEWQIVNLS--MKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ 1373
             V  W+I +    ++  R +     E+ S  FYSH +GY++Q+  F NG GSG  S++S+ + +L G+YD LL WP  + +   L+DQ
Sbjct:  308 GVLLWKIPDYCRRLQEARTRTTGSAELFSPAFYSHRHGYRLQVSAFLNGNGSGEGSYLSIYIRVLPGEYDGLLEWPFPYRVTFSLLDQ 395          
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 51.6026 bits (122), Expect = 1.751e-6
Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I + S KR  A       + S  FY+   GYKM L ++ NG G+G  +H+S+  +++ G  D LL WP +  + + L+DQ  N   ++ +F       SF+R
Sbjct:  423 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSFQR 529          
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 51.6026 bits (122), Expect = 1.933e-6
Identity = 36/108 (33.33%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             VF W+I + S KR  A       + S  FY+   GYKM L ++ NG G+G  +H+S+  +++ G  D LL WP +  + + L+DQ  N   ++ +F       SF+R
Sbjct:  310 GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ-NNREHIIDAFRPDISSSSFQR 416          
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 62.7734 bits (151), Expect = 1.914e-10
Identity = 64/253 (25.30%), Postives = 119/253 (47.04%), Query Frame = 3
Query:  705 KTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLS--GREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVE---SLS---VFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
            KT L+  + E  ++K+   + + R   + + + N K  ++ I  +  ++N + ++R R  D    F+ +    KE    L + L+  +  Q N +   R + + ++ I+  K K               F + L ++   ++S    F W+I   + +   AK    T I S  FY+H  GYK+   LFPNG GS   +++S+ + ++ G+YD +L WP    + + LIDQ +N   +  +F+      SF+R
Sbjct:  251 KTELERHKYEFAQMKERFNDQNARLGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMR--DKLKKFKVKTKANKECLLSLMKRLEVQDDSQTNPNKLNRRLSQLESSITIHKTK--------------LFQEDLRIQIQQAISYDGTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQ-DNGMNISETFDPDPCSISFQR 486          
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Match: EDO37750 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SER6])

HSP 1 Score: 61.6178 bits (148), Expect = 4.952e-10
Identity = 43/142 (30.28%), Postives = 73/142 (51.41%), Query Frame = 3
Query: 1128 WQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESK---VLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILR 1544
            W+I +        K    TE+ S  FY+ + GYK ++VLFP G GSG  +H+S+ + +L G+YD LL WP +  + + L+DQ  ++     +  SF+      SF+R +  S    +   +F+ +  L S+     D + L+
Sbjct:  317 WRIDDFWEAFDEGKRKPGTELHSPVFYTSNYGYKFKVVLFPYGNGSGEGTHLSLYIRLLPGEYDSLLPWPFEGQITLTLLDQSTDKRAKRHISQSFSPDPNWKSFQRPSKNSTSLGFGYPQFVSHRGLESIGYVRDDVLFLK 458          
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Match: EDO41243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z7])

HSP 1 Score: 58.5362 bits (140), Expect = 4.056e-9
Identity = 32/87 (36.78%), Postives = 53/87 (60.92%), Query Frame = 3
Query: 1122 FEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVEN 1382
            F W+I + +    +AK  ++  + SE F++  NGYK++  L+PNG  SG ++H+S  + I  G+YD +L WP    + + L+DQ EN
Sbjct:  320 FVWRIPDFADSLRQAKLGLKVRLDSEPFFTEKNGYKLRATLYPNGTMSGKNTHISAFVSINRGEYDGILAWPFTRVIKITLLDQKEN 406          
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 54.6842 bits (130), Expect = 6.638e-8
Identity = 38/108 (35.19%), Postives = 59/108 (54.63%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
            SV  W+I N++ KR  A     T   S  F++  +GYKM   ++ NG G G + HVS+  +I+ G++D LL WP    + + L+DQ +N   V+ +F       SF+R
Sbjct:  333 SVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQ-DNVEHVIDAFRPDPSSSSFQR 439          
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Match: EDO29145 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T4G8])

HSP 1 Score: 45.0542 bits (105), Expect = 4.515e-6
Identity = 32/91 (35.16%), Postives = 51/91 (56.04%), Query Frame = 3
Query: 1119 VFEWQIVNLSMKRVRAKFNVET-EIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENES 1388
            +F W+I N   +  +A  + E   I S  FY+   GYK++L  + NG   G  +H+S+ ++I++G YD LL WP    +   LIDQ E ++
Sbjct:    3 IFLWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQSEKQN 93          
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 55.4546 bits (132), Expect = 1.007e-7
Identity = 37/108 (34.26%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             +F W+I + S +R  A       + S  FYS   GYKM L L+ NG G+G  +H+S+  +++  KYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:  367 GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDITSTSFQR 473          
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 55.4546 bits (132), Expect = 1.099e-7
Identity = 37/108 (34.26%), Postives = 57/108 (52.78%), Query Frame = 3
Query: 1116 SVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFER 1439
             +F W+I + S +R  A       + S  FYS   GYKM L L+ NG G+G  +H+S+  +++  KYD LL WP    + + L+DQ  N   ++ +F       SF+R
Sbjct:  374 GIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ-NNREHIIDAFRPDITSTSFQR 480          
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 54.6842 bits (130), Expect = 1.803e-7
Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ 1373
            L V    V  W++ + S K   AK     E  S  FY+H  GYK+Q+  F NG GSG  SH+SV + +L G+YD LL WP  + +   ++DQ
Sbjct:  302 LSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQ 393          
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 54.6842 bits (130), Expect = 1.840e-7
Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ 1373
            L V    V  W++ + S K   AK     E  S  FY+H  GYK+Q+  F NG GSG  SH+SV + +L G+YD LL WP  + +   ++DQ
Sbjct:  302 LSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQ 393          
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 54.6842 bits (130), Expect = 1.910e-7
Identity = 37/92 (40.22%), Postives = 51/92 (55.43%), Query Frame = 3
Query: 1098 LLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQ 1373
            L V    V  W++ + S K   AK     E  S  FY+H  GYK+Q+  F NG GSG  SH+SV + +L G+YD LL WP  + +   ++DQ
Sbjct:  295 LSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQ 386          
BLAST of MATH domain-containing protein vs. Planmine SMEST
Match: SMESG000067198.1 (SMESG000067198.1)

HSP 1 Score: 956.436 bits (2471), Expect = 0.000e+0
Identity = 485/487 (99.59%), Postives = 487/487 (100.00%), Query Frame = 3
Query:   96 MAMKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQSLQAHENENRNCLSDKIIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG 1556
            MAMKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQ+LQAHENENRNCLSDK+IERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNGIGSGISSHVSVGLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG
Sbjct:    1 MAMKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQTLQAHENENRNCLSDKLIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNGIGSGISSHVSVGLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG 487          
BLAST of MATH domain-containing protein vs. Planmine SMEST
Match: SMESG000067198.1 (SMESG000067198.1)

HSP 1 Score: 950.658 bits (2456), Expect = 0.000e+0
Identity = 483/485 (99.59%), Postives = 485/485 (100.00%), Query Frame = 3
Query:  102 MKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQSLQAHENENRNCLSDKIIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG 1556
            MKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQ+LQAHENENRNCLSDK+IERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNGIGSGISSHVSVGLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG
Sbjct:    1 MKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQTLQAHENENRNCLSDKLIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNGIGSGISSHVSVGLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG 485          
BLAST of MATH domain-containing protein vs. Planmine SMEST
Match: SMESG000070237.1 (SMESG000070237.1)

HSP 1 Score: 173.326 bits (438), Expect = 1.322e-46
Identity = 159/562 (28.29%), Postives = 253/562 (45.02%), Query Frame = 3
Query:  111 YVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQ----------SKPSIEMSNSTE-----------LLMNYFDEVRLEMNMFSLDFEKTEELTSKV---HSEIIEMQSLQAHENENRNCLSDKIIERNNKLN-DIQLKIKTL------LDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKE-----------QLSSIQDKLQKQNPILK--------IRKRVLDISNFFQNR--------------------FIEIKEGFTQLKQNLDDSNHEQFNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVE---------SLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLK-PSFERFNNT--SFLTSYRVERFIDYNWL-NSLNLAHKDAIILRC 1547
            Y  IW +LD YNF+++ + + DLLC++CK ILNN  ++ C C YC  C   +I+   KYC G    CK+++++    +H  + A   IS ++VKCP EFC+F  E+K +  HIL HQ          + P I +   T+           LLM+     + EM     D +  +   S++   H+ + E       EN + +     + + N KL  D Q  +K +      + +QE  I+K+ ++  E H+ +     ELQ               Q+ S+   L+  + I+K        +  ++ D  N   +R                       IKE F + K+ L D      N+     + ++ E S   E          R  C    + L  E         S++ F W+I N + KR +A+  + + I S+ FYSH +GY++ L +FP G GSG  +H+++G  I++GKYD+ L+WPM+ G+ + LIDQ  N       F YR++   S  RF+             RFI  N L N   L   D+I+LRC
Sbjct:    8 YDDIWRILDAYNFNVNIELHCDLLCILCKKILNNARQAPCGCRYCHACIINFINNESKYCVGDTEDCKKQMINHFNEVHADNAANRMISNLVVKCPEEFCSFTCELKHMESHILIHQIECPFKFIGCNHPRIGLEKMTDHLHKESYSHSTLLMDAIQNSKNEMAFLKEDSQVKDFAVSELQREHNNLKEDMERSFDENASYDERISLLAQENRKLTRDFQGVLKNITEMQSKMHSQEEVINKMVKQIDEVHIYHTMQLNELQTDATKYQKQISVLEIQVDSVHIDLKSFDCIIKNQQEWIEMLEAKINDHINNHGDRNPWENESTRLRVENEEIRSEITSIKEEFLREKEILSDIELSVNNIRSSVERTFEQEESTQNESIVESEVSSVRMDCLISPQKLNDELAQVETPPISIAPFFWKIDNFTEKRQKAQAGIISFINSDPFYSHESGYQLCLSVFPGGCGSGKRTHLTIGCRIMKGKYDEELSWPMELGVTISLIDQKFNTVYTSHRFQYRSIPVKSRVRFDKPKQPINEGVGATRFISLNKLFNDARLFRNDSIVLRC 569          
BLAST of MATH domain-containing protein vs. Planmine SMEST
Match: SMESG000067208.1 (SMESG000067208.1)

HSP 1 Score: 156.762 bits (395), Expect = 1.303e-41
Identity = 139/486 (28.60%), Postives = 238/486 (48.97%), Query Frame = 3
Query:  120 IWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQSK-PSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQSLQAHENENRNCLSDKIIERNNKLNDIQ-LKIKTLLDNQEIEI-DKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSG-REIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKP-SFERFNNTSFLTSYRV--ERFIDYNWLNS-LNLAHKDAIILRCRV 1553
            +W+LL KYNF++  + Y DL+CVICK +L N ++S C C YC+KC EKY+   +K CPGK  GC ++++ +   I V   A  KIS+  VKCP   C F  E++ +  HI  HQ K P  E+  S           ++++N   ++                    L      + N L D I    N  NDI  L+ ++L  ++ + +  KL ++ K +H RN ++ E L   K +++  Q  +  +N    ++  V +++N  +N     K+ + +  Q +   N  Q +++G +   K K  I++ K                  +  +     S F W+I N S K+  AK   ++ I S+TFYSH NGYK+ L +FP+G     +  +SVG  +++ ++DK L WPM   + + L++Q  N+     ++N  ++   + +RF    F  +  V   +F+ +  + S  NL   D+I+++C V
Sbjct:    8 LWDLLVKYNFEVTGKNYRDLICVICKRLLINAHQSCCGCRYCYKCIEKYLEDKKKLCPGKGEGCNEQLISLF-DIQVDHVANVKISKATVKCPDTICQFKDELRKMESHIKSHQIKCPYFEIGCS-----------KVDINNADIN------------------NHLNIEHGNHANLLIDSI---QNMRNDIATLREESLKKDEVLSLTQKLLEDMKIAHNRNEEVIETL---KREINGNQ--IVAKN----LKSEVANLNNELKN----FKKTYKKENQ-IKSMNESQKSMNGNKGSPKTKVTINSPKP-------------ILELTNVINGVKYSPFIWKIENFSDKKNTAKNVCDSFILSDTFYSHVNGYKICLTIFPDGSNVSQNDWLSVGFHLMKSEHDKDLFWPMAMNITIGLVNQKTNQIHASETYNVNSVTDINRDRFFRPVFGMNGAVVAHKFVKFTAITSNANLCKNDSIVIKCVV 433          
BLAST of MATH domain-containing protein vs. Planmine SMEST
Match: SMESG000067158.1 (SMESG000067158.1)

HSP 1 Score: 156.762 bits (395), Expect = 1.711e-41
Identity = 133/498 (26.71%), Postives = 236/498 (47.39%), Query Frame = 3
Query:  111 YVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYCFKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKCPIEFCNFNKEIKFIPHHILFHQ--SKPSIEMSNSTELLMNYFDEVRLEMNMFSLDFEKTEELTSKVHSEIIEMQSLQAHENENRNCLSDKIIERNNKLNDIQLKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQKQNPIL-KIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQ-------FNLSGREIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVES--LSVFEWQIVNLSMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNXXXXXXXXXXXXXLLILEGKYDKLLTWPMDFGLFVELIDQVEN---ESKVLTSFNYRNLKPSFERFNNTSFLTSYRVERFIDYNWL-NSLNLAHKDAIILRCRVG 1556
            Y  +W LL KY+F I+  KY + +C+IC+ +L N +++ C C YC++C   +I   EK+CPG    C+Q ++D    + +   A   ++ I+V CPI  C    E+K++ HH+  H+  SK S                     N +  DF       +   S +  +       NE    L  ++ E   K+ +IQ  ++ +   Q+  I+ LK       + N + TE+L+ A+E L S ++  QK   I+ K+++ + +I +    +  EI+   TQL++    S  +Q       F LS +      ++  + K K++  TC +      +  +S++  +   + FEW+I  LS K  +A+    + I SE+FYSH  GYK+ L L+P G+       +S+   I +G+YD  L WPM   + ++LIDQ  +    S   + ++  N + +      T   +      F+  N + N+  +   ++I++RC VG
Sbjct:    8 YEGVWKLLRKYHFVIEIAKYEEFICIICRGLLKNAHQNKCGCRYCYECIIDFIHSDEKHCPGPTEECRQGLIDNNSDLQIDHTANRTVANILVPCPISPCGVVIELKYMVHHVKLHKCHSKSS---------------------NFYDADFGDETASETCPSSHVNLLTDRIGFLNEKVEQLQQELDESQEKVINIQSLVEEIKWKQDSAIENLK-------VINDKTTEKLRLARETLLSTEENDQKNQFIIRKLKQSIEEIKSKTARKSKEIEVRLTQLEEYYLQSETKQEKLEQKVFALSSQPPNPQPSK--SHKTKHDLATCFE-----LNSVESIVSNNYRYAPFEWKISELSEKVTKAREGNNSFIFSESFYSHPRGYKICLKLYPIGVDPASGRFLSIYFCIKKGEYDDFLPWPMMQQISLQLIDQKSDTVFSSDEYSYYSCNNAEKAVFSQPTTDINSGLGSSEFVKLNVIFNNKRILFNNSIVIRCLVG 470          
The following BLAST results are available for this feature:
BLAST of MATH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TRAF41.225e-730.43TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF23.643e-634.23TNF receptor associated factor 2 [Source:HGNC Symb... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Traf42.102e-1032.64gene:FBgn0026319 transcript:FBtr0077429[more]
Traf42.329e-1032.64gene:FBgn0026319 transcript:FBtr0334401[more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.842e-837.04Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b1.842e-837.04Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b2.308e-837.04Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf4a7.462e-829.75tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a7.462e-829.75tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
sytl21.116e-932.92synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Traf41.419e-729.81TNF receptor associated factor 4 [Source:MGI Symbo... [more]
Traf25.361e-633.33TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf25.505e-633.33TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of MATH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q9BUZ4|TRAF4_HUMAN5.884e-730.43TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
sp|Q61382|TRAF4_MOUSE9.923e-729.81TNF receptor-associated factor 4 OS=Mus musculus O... [more]
back to top
BLAST of MATH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1013.535e-1624.51TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID88.642e-1338.18TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A4W4GYA15.038e-922.45TNF receptor-associated factor OS=Electrophorus el... [more]
A0A2G8K8V38.928e-933.10Putative TNF receptor-associated factor 4 (Fragmen... [more]
T1IH912.310e-837.89MATH domain-containing protein OS=Strigamia mariti... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a1.106e-831.01TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b1.903e-837.04TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4b7.903e-836.36TNF receptor-associated factor 4-like [Source:NCBI... [more]
traf2a1.751e-633.33TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf2a1.933e-633.33TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MATH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO352371.914e-1025.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO377504.952e-1030.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412434.056e-936.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388736.638e-835.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO291454.515e-635.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of MATH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf2b1.007e-734.26TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.099e-734.26TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf4a1.803e-740.22TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.840e-740.22TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.910e-740.22TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of MATH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067198.10.000e+099.59SMESG000067198.1[more]
SMESG000067198.10.000e+099.59SMESG000067198.1[more]
SMESG000070237.11.322e-4628.29SMESG000070237.1[more]
SMESG000067208.11.303e-4128.60SMESG000067208.1[more]
SMESG000067158.11.711e-4126.71SMESG000067158.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025885 ID=SMED30025885|Name=MATH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1803bp
AAATATACATTTTGAATCTAAATATGTGTATGAAAATATTAGAGATTCTA
ATAATTTTCCAAATGTGATGAAAATTTATTTTAGAATATATTTCTATGGC
TATGAAAAGTTACGTTCCAATATGGAATTTACTCGATAAATATAATTTTG
ACATAGACAATCAGAAATATACTGATTTATTATGTGTCATTTGCAAAAAT
ATTTTAAATAACCCATACAGAAGTCTGTGTGAATGTAGTTATTGTTTTAA
ATGCTTCGAAAAGTATATTTCAGTCGGTGAGAAATATTGTCCTGGAAAAT
GTAATGGTTGTAAACAGGAAATAGTAGATGTTTTGAAATCTATTCATGTA
TACAGTGAAGCAGTGGATAAAATTTCACAGATAATTGTCAAATGTCCAAT
TGAATTTTGCAATTTTAATAAAGAAATAAAGTTCATTCCTCATCATATTT
TGTTTCATCAATCGAAACCATCAATTGAGATGTCGAATAGTACGGAATTA
TTAATGAACTATTTTGATGAAGTGAGATTGGAAATGAATATGTTTTCATT
GGATTTTGAGAAAACTGAGGAATTGACCAGTAAAGTACATTCTGAAATTA
TTGAAATGCAATCCCTGCAAGCTCATGAAAATGAAAACAGAAATTGTTTA
AGCGATAAAATCATTGAAAGAAATAATAAATTGAATGACATTCAACTCAA
AATAAAAACTTTGCTCGATAATCAAGAAATAGAAATCGATAAATTGAAAC
AAGAACAAAAGGAATCGCATTTGAGAAATCGTCAGTTGACTGAAGAATTG
CAAAACGCAAAAGAACAGTTGAGTTCCATTCAAGACAAATTGCAGAAACA
GAATCCCATATTGAAAATACGCAAACGTGTTTTGGATATTTCTAATTTTT
TCCAGAATCGATTTATAGAAATAAAAGAAGGATTTACTCAGTTAAAGCAA
AATCTCGATGATTCTAATCACGAGCAATTTAATCTTTCGGGAAGAGAAAT
AAAAAAATATAAAACCGAAATTTCAAATTCAAAGGAAAAAAATGAAAATA
TTACTTGTTTACAGCGCCGATTTAAATGTTTTTCATTTTCAAAGTCTCTG
TTAGTGGAATCCTTGTCGGTTTTTGAATGGCAAATAGTTAATCTGTCTAT
GAAACGTGTTAGGGCAAAATTTAATGTTGAAACGGAAATCCGCAGTGAAA
CGTTCTATTCTCATAGCAATGGTTATAAAATGCAACTGGTTTTGTTTCCA
AATGGAATTGGATCGGGAATTTCATCCCACGTTTCAGTAGGTTTATTGAT
TTTGGAAGGTAAATATGATAAGTTGTTGACTTGGCCGATGGATTTTGGGC
TATTTGTGGAGTTAATTGATCAAGTCGAAAACGAATCTAAAGTTCTTACA
TCGTTCAATTACAGAAATTTAAAGCCATCTTTTGAAAGATTTAATAACAC
GTCTTTTTTAACGAGTTATCGTGTAGAGCGTTTCATTGATTATAATTGGT
TAAATTCTCTAAATTTAGCTCACAAGGATGCAATCATACTCCGATGTCGT
GTCGGTTAACCCTTCTCACTGGATCCCAAATTCAATGTTTTAGATGTCGT
TTTATATTTATTGTCTCAAATTTTAATAATTTTCTAAATGTTTCTATTTA
AAGAAATAATTATTTTAGATTATTTCAGGAGTTACTAAATATAGTTACAA
TTAAAATAGATGTGTAAAATTGTAAATGAGCAAATAATCATCAGCTAATT
ACATGAATGAATAATAATAATAGTAAATATATGTTTAGTGTTTTTAAAAA
AAA
back to top

protein sequence of SMED30025885-orf-1

>SMED30025885-orf-1 ID=SMED30025885-orf-1|Name=SMED30025885-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=488bp
MAMKSYVPIWNLLDKYNFDIDNQKYTDLLCVICKNILNNPYRSLCECSYC
FKCFEKYISVGEKYCPGKCNGCKQEIVDVLKSIHVYSEAVDKISQIIVKC
PIEFCNFNKEIKFIPHHILFHQSKPSIEMSNSTELLMNYFDEVRLEMNMF
SLDFEKTEELTSKVHSEIIEMQSLQAHENENRNCLSDKIIERNNKLNDIQ
LKIKTLLDNQEIEIDKLKQEQKESHLRNRQLTEELQNAKEQLSSIQDKLQ
KQNPILKIRKRVLDISNFFQNRFIEIKEGFTQLKQNLDDSNHEQFNLSGR
EIKKYKTEISNSKEKNENITCLQRRFKCFSFSKSLLVESLSVFEWQIVNL
SMKRVRAKFNVETEIRSETFYSHSNGYKMQLVLFPNGIGSGISSHVSVGL
LILEGKYDKLLTWPMDFGLFVELIDQVENESKVLTSFNYRNLKPSFERFN
NTSFLTSYRVERFIDYNWLNSLNLAHKDAIILRCRVG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003810protein-glutamine gamma-glutamyltransferase activity
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0018149peptide cross-linking
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002075pigment cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR027357DHR-2
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 200..252
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 27..451
NoneNo IPR availableCDDcd16449RING-HCcoord: 30..66
e-value: 9.6951E-7
score: 43.2249
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 14..67
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 12..131
e-value: 1.4E-8
score: 36.7
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 287..487
e-value: 6.3E-28
score: 99.7
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 342..486
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 27..451
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 340..486
score: 11.672