Forkhead associated phosphopeptide binding domain 1

Overview
NameForkhead associated phosphopeptide binding domain 1
Smed IDSMED30025883
Length (bp)4623
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Forkhead associated phosphopeptide binding domain 1 (SMED30025883) t-SNE clustered cells

Violin plots show distribution of expression levels for Forkhead associated phosphopeptide binding domain 1 (SMED30025883) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Forkhead associated phosphopeptide binding domain 1 (SMED30025883) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Forkhead associated phosphopeptide binding domain 1 (SMED30025883) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025883

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025883SMESG000071072.1 SmedASXL_017209SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025883SMESG000071072.1 dd_Smed_v6_14350_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30025883SMESG000081498.1 SMESG000071072.1 SMESG000081971.1 SMESG000076736.1 Contig33432newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025883SMESG000081498.1 SMESG000071072.1 SMESG000081971.1 SMESG000076736.1 Contig33432uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
non-ciliated epidermisSMED30025883SMESG000071072.1 dd_Smed_v4_14350_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Human
Match: FHAD1 (forkhead associated phosphopeptide binding domain 1 [Source:HGNC Symbol;Acc:HGNC:29408])

HSP 1 Score: 110.153 bits (274), Expect = 2.491e-23
Identity = 140/598 (23.41%), Postives = 274/598 (45.82%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYM--------------TTQPIQKSGWQINP-----KSFPQQSSSNQITSFPTINYSQPQAFQHRHTVN-DPGMVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSY----------EIESLIQQINDP-----NNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNK-----QFDEAKAL--ITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLS-TPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKL 1988
            + +L+S EG F L+   TI   E+ D  +Q+  +DN  A+IEY E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE       +I  EN  P++ P+M              T QP Q       P     +  P Q S +Q  +FP      P +  HR  V+ +  M S+          R    +     N  +L+  +     P  V         P++ ++ ++  QQ+ D+ ++ L  E+ RL   E   IE  Y          E+  L Q++++      N   +  + + L +++  K  EI+ L S +  L +  ++    + +  +S     + + E  ++D  I++G+V++LQKD+   DE +++L  +   L  +  +K+  +  L ++ S LK+  ++E   ++          +L   ++++ +  + ++ L   L K      + S  LR+ +K     Q D  + L  + ++   ES+++++ + +  + + F ++V++        F+  D  + + ++I+ + ++ +  I   ++    QK    +N K  +  E+++K +T L
Sbjct:    2 KAYLKSAEGFFVLNKSTTIGRHENSDLVLQSPDIDNHHALIEYNEAECSFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGLTYEL------VI--ENPPPVSFPWMRGPAPWPGPQPPRATQQPNQAPPPSHIPFHQGVQPAPMQRSWSQ--AFPRPTVVLPAS--HRRPVSANKEMFSFV-----VDDARKPPVIKQVWTNAMKLSEKSVAEGIPGAV--------PPAEIYVEEDLAQQDKDEIILLLGKEVSRLSDYE---IESKYKDVIIANLQNEVAELSQKVSETTTSRQNEKEISQKCQVLDEDIDAKQKEIQSLKSQISALQKGYSKVLCQTLSERNSEITSLKNEGENLKRDNAITSGMVSSLQKDILAKDEQVQQLKEEVSHLKSQNKDKDHQLEALGSRCSVLKEELKQEDAHRELRE---AQEKELKLCKTQIQDMEKEMKKLRAELRKSCTEQSVISRTLREKSKVEEKLQEDSRRKLLQLQEMGNRESVIKINLERAVGQLEHFRSQVIKATYGRAKPFR--DKPVTDQQLIEKITQVTEDNINFQQKKWTLQKETQLSNSKQEETTENIEKLRTSL 566          

HSP 2 Score: 104.76 bits (260), Expect = 9.079e-22
Identity = 136/517 (26.31%), Postives = 249/517 (48.16%), Query Frame = 3
Query: 2694 WKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQ-----DKLIQNLNKIEQEGRIVNELAV----IGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS----KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            ++ EI  YKE+  QHA TI SL  ++ K+ + +  ++ ++A  K +       +     +       + + K + Y  +  ++  +AA        K  +++ E  MK L  DL  A +R+SDL+GEL+E QK E++   + ++    E + L+ ++A++S +V++  +EL           + L EA +  QEK     + E + K  +     D  +Q +  +  E    ++       +G +C+G RH+++I+ QK AL E+R ++K +E      +  P+      E   +L  LR     +K + D+ P  + +LS +          +LA P++                    +   +F   MEKS   D  ++L+ SEK YL + + LGS++ + ++ G      LS +++E +   R+    L+  KI  LK ++ RKEELL GYE+D+ +L++++      Q Q+  +   +  + EE  LL+E L R +  L +EKR N AI++ K
Sbjct:  918 FEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKKIEGEIATLKDN---DPAPKEERPQDPLVAPMTESSAKDMAYEHL--IDDLLAAQ-------KEILSQQEVIMK-LRKDLTEAHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL-----------KALEEALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQ-IEPVHTEAFSSSQEQQSFSDLGVRCKGSRHEEVIQRQKKALSELRARIKELE-----KARSPDHKDHQNESFLDLKNLRMENNVQKILLDAKP-DLPTLSRI---------EILA-PQN-------------------GLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKNMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRSKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQK 1374          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Human
Match: FHAD1 (forkhead associated phosphopeptide binding domain 1 [Source:HGNC Symbol;Acc:HGNC:29408])

HSP 1 Score: 110.153 bits (274), Expect = 2.491e-23
Identity = 140/598 (23.41%), Postives = 274/598 (45.82%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYM--------------TTQPIQKSGWQINP-----KSFPQQSSSNQITSFPTINYSQPQAFQHRHTVN-DPGMVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSY----------EIESLIQQINDP-----NNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNK-----QFDEAKAL--ITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLS-TPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKL 1988
            + +L+S EG F L+   TI   E+ D  +Q+  +DN  A+IEY E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE       +I  EN  P++ P+M              T QP Q       P     +  P Q S +Q  +FP      P +  HR  V+ +  M S+          R    +     N  +L+  +     P  V         P++ ++ ++  QQ+ D+ ++ L  E+ RL   E   IE  Y          E+  L Q++++      N   +  + + L +++  K  EI+ L S +  L +  ++    + +  +S     + + E  ++D  I++G+V++LQKD+   DE +++L  +   L  +  +K+  +  L ++ S LK+  ++E   ++          +L   ++++ +  + ++ L   L K      + S  LR+ +K     Q D  + L  + ++   ES+++++ + +  + + F ++V++        F+  D  + + ++I+ + ++ +  I   ++    QK    +N K  +  E+++K +T L
Sbjct:    2 KAYLKSAEGFFVLNKSTTIGRHENSDLVLQSPDIDNHHALIEYNEAECSFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGLTYEL------VI--ENPPPVSFPWMRGPAPWPGPQPPRATQQPNQAPPPSHIPFHQGVQPAPMQRSWSQ--AFPRPTVVLPAS--HRRPVSANKEMFSFV-----VDDARKPPVIKQVWTNAMKLSEKSVAEGIPGAV--------PPAEIYVEEDLAQQDKDEIILLLGKEVSRLSDYE---IESKYKDVIIANLQNEVAELSQKVSETTTSRQNEKEISQKCQVLDEDIDAKQKEIQSLKSQISALQKGYSKVLCQTLSERNSEITSLKNEGENLKRDNAITSGMVSSLQKDILAKDEQVQQLKEEVSHLKSQNKDKDHQLEALGSRCSVLKEELKQEDAHRELRE---AQEKELKLCKTQIQDMEKEMKKLRAELRKSCTEQSVISRTLREKSKVEEKLQEDSRRKLLQLQEMGNRESVIKINLERAVGQLEHFRSQVIKATYGRAKPFR--DKPVTDQQLIEKITQVTEDNINFQQKKWTLQKETQLSNSKQEETTENIEKLRTSL 566          

HSP 2 Score: 104.76 bits (260), Expect = 9.079e-22
Identity = 136/517 (26.31%), Postives = 249/517 (48.16%), Query Frame = 3
Query: 2694 WKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQ-----DKLIQNLNKIEQEGRIVNELAV----IGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS----KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            ++ EI  YKE+  QHA TI SL  ++ K+ + +  ++ ++A  K +       +     +       + + K + Y  +  ++  +AA        K  +++ E  MK L  DL  A +R+SDL+GEL+E QK E++   + ++    E + L+ ++A++S +V++  +EL           + L EA +  QEK     + E + K  +     D  +Q +  +  E    ++       +G +C+G RH+++I+ QK AL E+R ++K +E      +  P+      E   +L  LR     +K + D+ P  + +LS +          +LA P++                    +   +F   MEKS   D  ++L+ SEK YL + + LGS++ + ++ G      LS +++E +   R+    L+  KI  LK ++ RKEELL GYE+D+ +L++++      Q Q+  +   +  + EE  LL+E L R +  L +EKR N AI++ K
Sbjct:  918 FEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKKIEGEIATLKDN---DPAPKEERPQDPLVAPMTESSAKDMAYEHL--IDDLLAAQ-------KEILSQQEVIMK-LRKDLTEAHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL-----------KALEEALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQ-IEPVHTEAFSSSQEQQSFSDLGVRCKGSRHEEVIQRQKKALSELRARIKELE-----KARSPDHKDHQNESFLDLKNLRMENNVQKILLDAKP-DLPTLSRI---------EILA-PQN-------------------GLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKNMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRSKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQK 1374          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Human
Match: FHAD1 (forkhead associated phosphopeptide binding domain 1 [Source:HGNC Symbol;Acc:HGNC:29408])

HSP 1 Score: 101.293 bits (251), Expect = 2.177e-21
Identity = 113/408 (27.70%), Postives = 201/408 (49.26%), Query Frame = 3
Query: 3021 LNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQ-----DKLIQNLNKIEQEGRIVNELAV----IGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLR----SKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            L  DL  A +R+SDL+GEL+E QK E++   + ++    E + L+ ++A++S +V++  +EL           + L EA +  QEK     + E + K  +     D  +Q +  +  E    ++       +G +C+G RH+++I+ QK AL E+R ++K +E      +  P+      E   +L  LR     +K + D+ P  + +LS +          +LA P++                    +   +F   MEKS   D  ++L+ SEK YL + + LGS++ + ++ G      LS +++E +   R+    L+  KI  LK ++ RKEELL GYE+D+ +L++++      Q Q+  +   +  + EE  LL+E L R +  L +EKR N AI++ K
Sbjct:   31 LRKDLTEAHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL-----------KALEEALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQ-IEPVHTEAFSSSQEQQSFSDLGVRCKGSRHEEVIQRQKKALSELRARIKELE-----KARSPDHKDHQNESFLDLKNLRMENNVQKILLDAKPD-LPTLSRI---------EILA-PQN-------------------GLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKNMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRSKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQK 391          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Human
Match: FHAD1 (forkhead associated phosphopeptide binding domain 1 [Source:HGNC Symbol;Acc:HGNC:29408])

HSP 1 Score: 102.064 bits (253), Expect = 3.759e-21
Identity = 137/520 (26.35%), Postives = 250/520 (48.08%), Query Frame = 3
Query: 2694 WKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQ-----DKLIQNLNKIEQEGRIVNELAV----IGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLR----SKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYV 4214
            ++ EI  YKE+  QHA TI SL  ++ K+ + +  ++ ++A  K +       +     +       + + K + Y  +  ++  +AA        K  +++ E  MK L  DL  A +R+SDL+GEL+E QK E++   + ++    E + L+ ++A++S +V++  +EL           + L EA +  QEK     + E + K  +     D  +Q +  +  E    ++       +G +C+G RH+++I+ QK AL E+R ++K +E      +  P+      E   +L  LR     +K + D+ P  + +LS +          +LA P++                    +   +F   MEKS   D  ++L+ SEK YL + + LGS++ + ++ G      LS +++E +   R+    L+  KI  LK ++ RKEELL GYE+D+ +L++++      Q Q+  +   +  + EE  LL+E L R +  L +EKR N AI++ K  V
Sbjct:  189 FEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKKIEGEIATLKDN---DPAPKEERPQDPLVAPMTESSAKDMAYEHL--IDDLLAAQ-------KEILSQQEVIMK-LRKDLTEAHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL-----------KALEEALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQ-IEPVHTEAFSSSQEQQSFSDLGVRCKGSRHEEVIQRQKKALSELRARIKELE-----KARSPDHKDHQNESFLDLKNLRMENNVQKILLDAKP-DLPTLSRI---------EILA-PQN-------------------GLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKNMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRSKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQKRRV 648          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Human
Match: FHAD1 (forkhead associated phosphopeptide binding domain 1 [Source:HGNC Symbol;Acc:HGNC:29408])

HSP 1 Score: 101.293 bits (251), Expect = 5.197e-21
Identity = 136/517 (26.31%), Postives = 249/517 (48.16%), Query Frame = 3
Query: 2694 WKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQ-----DKLIQNLNKIEQEGRIVNELAV----IGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLR----SKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            ++ EI  YKE+  QHA TI SL  ++ K+ + +  ++ ++A  K +       +     +       + + K + Y  +  ++  +AA        K  +++ E  MK L  DL  A +R+SDL+GEL+E QK E++   + ++    E + L+ ++A++S +V++  +EL           + L EA +  QEK     + E + K  +     D  +Q +  +  E    ++       +G +C+G RH+++I+ QK AL E+R ++K +E      +  P+      E   +L  LR     +K + D+ P  + +LS +          +LA P++                    +   +F   MEKS   D  ++L+ SEK YL + + LGS++ + ++ G      LS +++E +   R+    L+  KI  LK ++ RKEELL GYE+D+ +L++++      Q Q+  +   +  + EE  LL+E L R +  L +EKR N AI++ K
Sbjct:  153 FEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKKIEGEIATLKDN---DPAPKEERPQDPLVAPMTESSAKDMAYEHL--IDDLLAAQ-------KEILSQQEVIMK-LRKDLTEAHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL-----------KALEEALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQ-IEPVHTEAFSSSQEQQSFSDLGVRCKGSRHEEVIQRQKKALSELRARIKELE-----KARSPDHKDHQNESFLDLKNLRMENNVQKILLDAKP-DLPTLSRI---------EILA-PQN-------------------GLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKNMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRSKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQK 609          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Zebrafish
Match: fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-041210-354])

HSP 1 Score: 106.301 bits (264), Expect = 5.013e-25
Identity = 52/119 (43.70%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGR-ESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPI 680
            RGFL++   VF L PK T IGR +  D  +QN  VD   A I++ E +  +V++DLNS HG+YVNDCRI NATVRL+ GD L FG+    YE   +N    +  + +P   P + T  +
Sbjct:    2 RGFLKTPNWVFKLQPKTTTIGRHKDSDLCLQNSGVDEYHATIDWCEADSCYVIRDLNSAHGTYVNDCRIHNATVRLSPGDQLHFGYGGSTYELSIDN----EKSSPVPQAWPRVRTTSV 116          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Zebrafish
Match: fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-041210-354])

HSP 1 Score: 105.916 bits (263), Expect = 5.275e-25
Identity = 52/122 (42.62%), Postives = 74/122 (60.66%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGR-ESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEI---IDSENNIPLTSPYMTTQPI 680
            RGFL++   VF L PK T IGR +  D  +QN  VD   A I++ E +  +V++DLNS HG+YVNDCRI NATVRL+ GD L FG+    YE   +N +    + +++ +P   P + T  +
Sbjct:    2 RGFLKTPNWVFKLQPKTTTIGRHKDSDLCLQNSGVDEYHATIDWCEADSCYVIRDLNSAHGTYVNDCRIHNATVRLSPGDQLHFGYGGSTYELSIDNEKSFPHLAAQSPVPQAWPRVRTTSV 123          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Zebrafish
Match: fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-041210-354])

HSP 1 Score: 106.686 bits (265), Expect = 4.562e-24
Identity = 52/122 (42.62%), Postives = 74/122 (60.66%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGR-ESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEI---IDSENNIPLTSPYMTTQPI 680
            RGFL++   VF L PK T IGR +  D  +QN  VD   A I++ E +  +V++DLNS HG+YVNDCRI NATVRL+ GD L FG+    YE   +N +    + +++ +P   P + T  +
Sbjct:    2 RGFLKTPNWVFKLQPKTTTIGRHKDSDLCLQNSGVDEYHATIDWCEADSCYVIRDLNSAHGTYVNDCRIHNATVRLSPGDQLHFGYGGSTYELSIDNEKSFPHLAAQSPVPQAWPRVRTTSV 123          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Zebrafish
Match: fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-041210-354])

HSP 1 Score: 106.686 bits (265), Expect = 4.562e-24
Identity = 52/122 (42.62%), Postives = 74/122 (60.66%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGR-ESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEI---IDSENNIPLTSPYMTTQPI 680
            RGFL++   VF L PK T IGR +  D  +QN  VD   A I++ E +  +V++DLNS HG+YVNDCRI NATVRL+ GD L FG+    YE   +N +    + +++ +P   P + T  +
Sbjct:    2 RGFLKTPNWVFKLQPKTTTIGRHKDSDLCLQNSGVDEYHATIDWCEADSCYVIRDLNSAHGTYVNDCRIHNATVRLSPGDQLHFGYGGSTYELSIDNEKSFPHLAAQSPVPQAWPRVRTTSV 123          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Zebrafish
Match: fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-041210-354])

HSP 1 Score: 106.686 bits (265), Expect = 4.582e-24
Identity = 52/119 (43.70%), Postives = 71/119 (59.66%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGR-ESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPI 680
            RGFL++   VF L PK T IGR +  D  +QN  VD   A I++ E +  +V++DLNS HG+YVNDCRI NATVRL+ GD L FG+    YE   +N    +  + +P   P + T  +
Sbjct:    2 RGFLKTPNWVFKLQPKTTTIGRHKDSDLCLQNSGVDEYHATIDWCEADSCYVIRDLNSAHGTYVNDCRIHNATVRLSPGDQLHFGYGGSTYELSIDN----EKSSPVPQAWPRVRTTSV 116          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 61.6178 bits (148), Expect = 1.234e-8
Identity = 37/114 (32.46%), Postives = 65/114 (57.02%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNA---TVRLNDGDILKFGFSVG------QYEFHTENVEIIDSENNI 644
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y  +++   +KDL S +G++VND RI +    T++L+D   ++FG+ +       Q++   E +++ +  NN 
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDN--IRFGYDILFLWGGIQHQVPEEALKVSEKSNNF 118          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Xenopus
Match: CEP170 (centrosomal protein 170kDa [Source:NCBI gene;Acc:779465])

HSP 1 Score: 61.6178 bits (148), Expect = 1.251e-8
Identity = 31/87 (35.63%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSV 587
            FL S+ G     P+  I +GR+ C+  +Q+ +VD Q AV+ Y  + +  ++KDL S +G+++ND RI   T + L   D L+FG+ +
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVVNYDSSSDVHMVKDLGSLNGTFINDVRIPEQTYITLKLDDKLRFGYDI 93          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Xenopus
Match: CEP170 (centrosomal protein 170kDa [Source:NCBI gene;Acc:779465])

HSP 1 Score: 61.6178 bits (148), Expect = 1.308e-8
Identity = 31/87 (35.63%), Postives = 52/87 (59.77%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSV 587
            FL S+ G     P+  I +GR+ C+  +Q+ +VD Q AV+ Y  + +  ++KDL S +G+++ND RI   T + L   D L+FG+ +
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVVNYDSSSDVHMVKDLGSLNGTFINDVRIPEQTYITLKLDDKLRFGYDI 93          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 61.6178 bits (148), Expect = 1.361e-8
Identity = 33/89 (37.08%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNA---TVRLNDGDILKFGFSV 587
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y  +++   +KDL S +G++VND RI +    T++L+D   ++FG+ +
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDN--IRFGYDI 93          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Xenopus
Match: colec10 (collectin subfamily member 10 [Source:Xenbase;Acc:XB-GENE-945586])

HSP 1 Score: 61.6178 bits (148), Expect = 1.361e-8
Identity = 33/89 (37.08%), Postives = 55/89 (61.80%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNA---TVRLNDGDILKFGFSV 587
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y  +++   +KDL S +G++VND RI +    T++L+D   ++FG+ +
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDN--IRFGYDI 93          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Mouse
Match: Fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:MGI Symbol;Acc:MGI:1920323])

HSP 1 Score: 115.931 bits (289), Expect = 2.758e-25
Identity = 109/411 (26.52%), Postives = 194/411 (47.20%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTEN-----VEIIDSENNIPLTSPYMTTQPIQKSGWQ-INPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPG-MVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLEND-------IIEKSYEIESLIQQIND---------PNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKD 1487
            + +L+S +G F L+   TI      D  +Q+  +DN  A+IE+ E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE   EN        +      P   P++++ P        I P +   Q S +Q    PT+    P    H+  ++  G M S+   PK+P                 Q+  +A  +     +    G+I  P++ F+  +  QQ+ D+ ++ L  E++RL   E +       I+    E+  L Q++++          N  +   Q  +  D+L  K  EIE + S +  L +  ++  S +    ++  +  + + E  ++D  I++G+VT+LQKD+S  +E +++L  +  RL  E  EK   +  L+++ S +K+
Sbjct:    2 KAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFNEAEGTFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCPWVRGPAPWPSPQPHLSSSPPDMPFHHGIQPATV--QRSWSQGCPRPTMVPPAP----HQRPMSASGKMFSFVMDPKSPVIN--------------QVWANAMDMSEQCMMDGLSGTIP-PTEIFMDHDLSQQDKDEIILLLGREVNRLSDFEMESKYKDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGVDEGDDLRQK--EIESMKSQINALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSGMVTSLQKDMSARNEQVQQLQEEVNRLRIENREKEYQLEALSSRCSVMKE 389          

HSP 2 Score: 115.161 bits (287), Expect = 4.988e-25
Identity = 114/409 (27.87%), Postives = 205/409 (50.12%), Query Frame = 3
Query: 3021 LNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKD-------------SKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS-KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            L  DL  A +R+SDL+GELSE QK E++     ++    E + L+ ++A+ +G++++  +EL           + L EA +  QEK              S+  D+ +Q++        +     QE +  ++L   G +C+G RH++ I+ Q+ AL E+R +++ +E  N  N     +++  LE+ R L M ++ +K + D+ P  +++L+          R  +  P++   P +  S                  L MEKS   D  ++L+ SEK Y  +++ LGS++ +  +       +LS +++E +   R++   L+  KI  LK R+QRKEELL GYEQ+L +L+ ++      Q Q+  +   +  + EE  LL+E L RT+  L++E+R N   K+ K
Sbjct:  986 LRTDLGEAHSRMSDLRGELSEKQKMELERQVALVRQQSGELSMLKAKVAQTTGLMEKKDREL-----------KVLREALRASQEKPRPHLSTEQKPRTLSQKCDISLQIEPAHPDSFSSF----QEEQSFSDL---GVKCKGSRHEETIQRQRKALSELRTRVRELEKANSCNHK-DHVNESFLEL-RTLRMEKNVQKILLDAKP-DLTTLA----------RVEIRPPQN--SPFNSGST-----------------LVMEKSVKTDAGEALELSEKLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLVFDKITQLKTRLQRKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLKEALERTEQQLSQERRFNRVFKQQK 1344          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Mouse
Match: Fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:MGI Symbol;Acc:MGI:1920323])

HSP 1 Score: 115.931 bits (289), Expect = 2.758e-25
Identity = 109/411 (26.52%), Postives = 194/411 (47.20%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTEN-----VEIIDSENNIPLTSPYMTTQPIQKSGWQ-INPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPG-MVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLEND-------IIEKSYEIESLIQQIND---------PNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKD 1487
            + +L+S +G F L+   TI      D  +Q+  +DN  A+IE+ E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE   EN        +      P   P++++ P        I P +   Q S +Q    PT+    P    H+  ++  G M S+   PK+P                 Q+  +A  +     +    G+I  P++ F+  +  QQ+ D+ ++ L  E++RL   E +       I+    E+  L Q++++          N  +   Q  +  D+L  K  EIE + S +  L +  ++  S +    ++  +  + + E  ++D  I++G+VT+LQKD+S  +E +++L  +  RL  E  EK   +  L+++ S +K+
Sbjct:    2 KAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFNEAEGTFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCPWVRGPAPWPSPQPHLSSSPPDMPFHHGIQPATV--QRSWSQGCPRPTMVPPAP----HQRPMSASGKMFSFVMDPKSPVIN--------------QVWANAMDMSEQCMMDGLSGTIP-PTEIFMDHDLSQQDKDEIILLLGREVNRLSDFEMESKYKDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGVDEGDDLRQK--EIESMKSQINALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSGMVTSLQKDMSARNEQVQQLQEEVNRLRIENREKEYQLEALSSRCSVMKE 389          

HSP 2 Score: 115.161 bits (287), Expect = 4.988e-25
Identity = 114/409 (27.87%), Postives = 205/409 (50.12%), Query Frame = 3
Query: 3021 LNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKD-------------SKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS-KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            L  DL  A +R+SDL+GELSE QK E++     ++    E + L+ ++A+ +G++++  +EL           + L EA +  QEK              S+  D+ +Q++        +     QE +  ++L   G +C+G RH++ I+ Q+ AL E+R +++ +E  N  N     +++  LE+ R L M ++ +K + D+ P  +++L+          R  +  P++   P +  S                  L MEKS   D  ++L+ SEK Y  +++ LGS++ +  +       +LS +++E +   R++   L+  KI  LK R+QRKEELL GYEQ+L +L+ ++      Q Q+  +   +  + EE  LL+E L RT+  L++E+R N   K+ K
Sbjct:  986 LRTDLGEAHSRMSDLRGELSEKQKMELERQVALVRQQSGELSMLKAKVAQTTGLMEKKDREL-----------KVLREALRASQEKPRPHLSTEQKPRTLSQKCDISLQIEPAHPDSFSSF----QEEQSFSDL---GVKCKGSRHEETIQRQRKALSELRTRVRELEKANSCNHK-DHVNESFLEL-RTLRMEKNVQKILLDAKP-DLTTLA----------RVEIRPPQN--SPFNSGST-----------------LVMEKSVKTDAGEALELSEKLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLVFDKITQLKTRLQRKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLKEALERTEQQLSQERRFNRVFKQQK 1344          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Mouse
Match: Fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:MGI Symbol;Acc:MGI:1920323])

HSP 1 Score: 115.931 bits (289), Expect = 2.758e-25
Identity = 109/411 (26.52%), Postives = 194/411 (47.20%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTEN-----VEIIDSENNIPLTSPYMTTQPIQKSGWQ-INPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPG-MVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLEND-------IIEKSYEIESLIQQIND---------PNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKD 1487
            + +L+S +G F L+   TI      D  +Q+  +DN  A+IE+ E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE   EN        +      P   P++++ P        I P +   Q S +Q    PT+    P    H+  ++  G M S+   PK+P                 Q+  +A  +     +    G+I  P++ F+  +  QQ+ D+ ++ L  E++RL   E +       I+    E+  L Q++++          N  +   Q  +  D+L  K  EIE + S +  L +  ++  S +    ++  +  + + E  ++D  I++G+VT+LQKD+S  +E +++L  +  RL  E  EK   +  L+++ S +K+
Sbjct:    2 KAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFNEAEGTFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCPWVRGPAPWPSPQPHLSSSPPDMPFHHGIQPATV--QRSWSQGCPRPTMVPPAP----HQRPMSASGKMFSFVMDPKSPVIN--------------QVWANAMDMSEQCMMDGLSGTIP-PTEIFMDHDLSQQDKDEIILLLGREVNRLSDFEMESKYKDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGVDEGDDLRQK--EIESMKSQINALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSGMVTSLQKDMSARNEQVQQLQEEVNRLRIENREKEYQLEALSSRCSVMKE 389          

HSP 2 Score: 115.161 bits (287), Expect = 4.988e-25
Identity = 114/409 (27.87%), Postives = 205/409 (50.12%), Query Frame = 3
Query: 3021 LNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKD-------------SKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS-KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            L  DL  A +R+SDL+GELSE QK E++     ++    E + L+ ++A+ +G++++  +EL           + L EA +  QEK              S+  D+ +Q++        +     QE +  ++L   G +C+G RH++ I+ Q+ AL E+R +++ +E  N  N     +++  LE+ R L M ++ +K + D+ P  +++L+          R  +  P++   P +  S                  L MEKS   D  ++L+ SEK Y  +++ LGS++ +  +       +LS +++E +   R++   L+  KI  LK R+QRKEELL GYEQ+L +L+ ++      Q Q+  +   +  + EE  LL+E L RT+  L++E+R N   K+ K
Sbjct:  986 LRTDLGEAHSRMSDLRGELSEKQKMELERQVALVRQQSGELSMLKAKVAQTTGLMEKKDREL-----------KVLREALRASQEKPRPHLSTEQKPRTLSQKCDISLQIEPAHPDSFSSF----QEEQSFSDL---GVKCKGSRHEETIQRQRKALSELRTRVRELEKANSCNHK-DHVNESFLEL-RTLRMEKNVQKILLDAKP-DLTTLA----------RVEIRPPQN--SPFNSGST-----------------LVMEKSVKTDAGEALELSEKLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLVFDKITQLKTRLQRKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLKEALERTEQQLSQERRFNRVFKQQK 1344          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Mouse
Match: Fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:MGI Symbol;Acc:MGI:1920323])

HSP 1 Score: 115.931 bits (289), Expect = 2.758e-25
Identity = 109/411 (26.52%), Postives = 194/411 (47.20%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTEN-----VEIIDSENNIPLTSPYMTTQPIQKSGWQ-INPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPG-MVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLEND-------IIEKSYEIESLIQQIND---------PNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKD 1487
            + +L+S +G F L+   TI      D  +Q+  +DN  A+IE+ E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE   EN        +      P   P++++ P        I P +   Q S +Q    PT+    P    H+  ++  G M S+   PK+P                 Q+  +A  +     +    G+I  P++ F+  +  QQ+ D+ ++ L  E++RL   E +       I+    E+  L Q++++          N  +   Q  +  D+L  K  EIE + S +  L +  ++  S +    ++  +  + + E  ++D  I++G+VT+LQKD+S  +E +++L  +  RL  E  EK   +  L+++ S +K+
Sbjct:    2 KAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFNEAEGTFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCPWVRGPAPWPSPQPHLSSSPPDMPFHHGIQPATV--QRSWSQGCPRPTMVPPAP----HQRPMSASGKMFSFVMDPKSPVIN--------------QVWANAMDMSEQCMMDGLSGTIP-PTEIFMDHDLSQQDKDEIILLLGREVNRLSDFEMESKYKDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGVDEGDDLRQK--EIESMKSQINALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSGMVTSLQKDMSARNEQVQQLQEEVNRLRIENREKEYQLEALSSRCSVMKE 389          

HSP 2 Score: 115.161 bits (287), Expect = 4.988e-25
Identity = 114/409 (27.87%), Postives = 205/409 (50.12%), Query Frame = 3
Query: 3021 LNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKD-------------SKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS-KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            L  DL  A +R+SDL+GELSE QK E++     ++    E + L+ ++A+ +G++++  +EL           + L EA +  QEK              S+  D+ +Q++        +     QE +  ++L   G +C+G RH++ I+ Q+ AL E+R +++ +E  N  N     +++  LE+ R L M ++ +K + D+ P  +++L+          R  +  P++   P +  S                  L MEKS   D  ++L+ SEK Y  +++ LGS++ +  +       +LS +++E +   R++   L+  KI  LK R+QRKEELL GYEQ+L +L+ ++      Q Q+  +   +  + EE  LL+E L RT+  L++E+R N   K+ K
Sbjct:  986 LRTDLGEAHSRMSDLRGELSEKQKMELERQVALVRQQSGELSMLKAKVAQTTGLMEKKDREL-----------KVLREALRASQEKPRPHLSTEQKPRTLSQKCDISLQIEPAHPDSFSSF----QEEQSFSDL---GVKCKGSRHEETIQRQRKALSELRTRVRELEKANSCNHK-DHVNESFLEL-RTLRMEKNVQKILLDAKP-DLTTLA----------RVEIRPPQN--SPFNSGST-----------------LVMEKSVKTDAGEALELSEKLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLVFDKITQLKTRLQRKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLKEALERTEQQLSQERRFNRVFKQQK 1344          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Mouse
Match: Cep170b (centrosomal protein 170B [Source:MGI Symbol;Acc:MGI:2145043])

HSP 1 Score: 64.3142 bits (155), Expect = 1.116e-9
Identity = 33/92 (35.87%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPK-ITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNA---TVRLNDGDILKFGFSVGQY 596
            FL S+ G     P+ +  +GR+ C+  +Q+ +VD Q AVI Y ++ +   +KDL S +G++VND RI +    T++LN  D+++FG+    Y
Sbjct:    7 FLVSSSGTRHRLPRELIFVGRDECELMLQSRSVDKQHAVINYDQDRDEHWVKDLGSLNGTFVNDVRIPDQKYITLKLN--DVIRFGYDSNMY 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. UniProt/SwissProt
Match: sp|A6PWD2|FHAD1_MOUSE (Forkhead-associated domain-containing protein 1 OS=Mus musculus OX=10090 GN=Fhad1 PE=2 SV=1)

HSP 1 Score: 115.931 bits (289), Expect = 1.929e-24
Identity = 109/411 (26.52%), Postives = 194/411 (47.20%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTEN-----VEIIDSENNIPLTSPYMTTQPIQKSGWQ-INPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPG-MVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLEND-------IIEKSYEIESLIQQIND---------PNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKD 1487
            + +L+S +G F L+   TI      D  +Q+  +DN  A+IE+ E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE   EN        +      P   P++++ P        I P +   Q S +Q    PT+    P    H+  ++  G M S+   PK+P                 Q+  +A  +     +    G+I  P++ F+  +  QQ+ D+ ++ L  E++RL   E +       I+    E+  L Q++++          N  +   Q  +  D+L  K  EIE + S +  L +  ++  S +    ++  +  + + E  ++D  I++G+VT+LQKD+S  +E +++L  +  RL  E  EK   +  L+++ S +K+
Sbjct:    2 KAYLKSADGFFVLNKSTTIGKHADSDLVLQSADIDNHHALIEFNEAEGTFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGMTYELVIENPSPVSCPWVRGPAPWPSPQPHLSSSPPDMPFHHGIQPATV--QRSWSQGCPRPTMVPPAP----HQRPMSASGKMFSFVMDPKSPVIN--------------QVWANAMDMSEQCMMDGLSGTIP-PTEIFMDHDLSQQDKDEIILLLGREVNRLSDFEMESKYKDALIMNLQAEVADLSQRLSETAAVAAARQSNRCDPKLQGVDEGDDLRQK--EIESMKSQINALQKGYSQVLSQTLAERNTEIESLKNEGENLKRDHAITSGMVTSLQKDMSARNEQVQQLQEEVNRLRIENREKEYQLEALSSRCSVMKE 389          

HSP 2 Score: 115.161 bits (287), Expect = 3.489e-24
Identity = 114/409 (27.87%), Postives = 205/409 (50.12%), Query Frame = 3
Query: 3021 LNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKD-------------SKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS-KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            L  DL  A +R+SDL+GELSE QK E++     ++    E + L+ ++A+ +G++++  +EL           + L EA +  QEK              S+  D+ +Q++        +     QE +  ++L   G +C+G RH++ I+ Q+ AL E+R +++ +E  N  N     +++  LE+ R L M ++ +K + D+ P  +++L+          R  +  P++   P +  S                  L MEKS   D  ++L+ SEK Y  +++ LGS++ +  +       +LS +++E +   R++   L+  KI  LK R+QRKEELL GYEQ+L +L+ ++      Q Q+  +   +  + EE  LL+E L RT+  L++E+R N   K+ K
Sbjct:  986 LRTDLGEAHSRMSDLRGELSEKQKMELERQVALVRQQSGELSMLKAKVAQTTGLMEKKDREL-----------KVLREALRASQEKPRPHLSTEQKPRTLSQKCDISLQIEPAHPDSFSSF----QEEQSFSDL---GVKCKGSRHEETIQRQRKALSELRTRVRELEKANSCNHK-DHVNESFLEL-RTLRMEKNVQKILLDAKP-DLTTLA----------RVEIRPPQN--SPFNSGST-----------------LVMEKSVKTDAGEALELSEKLYTDMIKTLGSLMNIKDMSSHTSLKHLSPKEREKVNHLRQKDLDLVFDKITQLKTRLQRKEELLKGYEQELEQLRHSKVSVQMYQTQVAKLEDDVHKEAEEKALLKEALERTEQQLSQERRFNRVFKQQK 1344          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. UniProt/SwissProt
Match: sp|B1AJZ9|FHAD1_HUMAN (Forkhead-associated domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FHAD1 PE=2 SV=2)

HSP 1 Score: 110.153 bits (274), Expect = 1.196e-22
Identity = 140/598 (23.41%), Postives = 274/598 (45.82%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYM--------------TTQPIQKSGWQINP-----KSFPQQSSSNQITSFPTINYSQPQAFQHRHTVN-DPGMVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSY----------EIESLIQQINDP-----NNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNK-----QFDEAKAL--ITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLS-TPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKL 1988
            + +L+S EG F L+   TI   E+ D  +Q+  +DN  A+IEY E E  FVL+D NS +G++VN+C IQN  V+L  GDIL+FG +   YE       +I  EN  P++ P+M              T QP Q       P     +  P Q S +Q  +FP      P +  HR  V+ +  M S+          R    +     N  +L+  +     P  V         P++ ++ ++  QQ+ D+ ++ L  E+ RL   E   IE  Y          E+  L Q++++      N   +  + + L +++  K  EI+ L S +  L +  ++    + +  +S     + + E  ++D  I++G+V++LQKD+   DE +++L  +   L  +  +K+  +  L ++ S LK+  ++E   ++          +L   ++++ +  + ++ L   L K      + S  LR+ +K     Q D  + L  + ++   ES+++++ + +  + + F ++V++        F+  D  + + ++I+ + ++ +  I   ++    QK    +N K  +  E+++K +T L
Sbjct:    2 KAYLKSAEGFFVLNKSTTIGRHENSDLVLQSPDIDNHHALIEYNEAECSFVLQDFNSRNGTFVNECHIQNVAVKLIPGDILRFGSAGLTYEL------VI--ENPPPVSFPWMRGPAPWPGPQPPRATQQPNQAPPPSHIPFHQGVQPAPMQRSWSQ--AFPRPTVVLPAS--HRRPVSANKEMFSFV-----VDDARKPPVIKQVWTNAMKLSEKSVAEGIPGAV--------PPAEIYVEEDLAQQDKDEIILLLGKEVSRLSDYE---IESKYKDVIIANLQNEVAELSQKVSETTTSRQNEKEISQKCQVLDEDIDAKQKEIQSLKSQISALQKGYSKVLCQTLSERNSEITSLKNEGENLKRDNAITSGMVSSLQKDILAKDEQVQQLKEEVSHLKSQNKDKDHQLEALGSRCSVLKEELKQEDAHRELRE---AQEKELKLCKTQIQDMEKEMKKLRAELRKSCTEQSVISRTLREKSKVEEKLQEDSRRKLLQLQEMGNRESVIKINLERAVGQLEHFRSQVIKATYGRAKPFR--DKPVTDQQLIEKITQVTEDNINFQQKKWTLQKETQLSNSKQEETTENIEKLRTSL 566          

HSP 2 Score: 104.76 bits (260), Expect = 4.360e-21
Identity = 136/517 (26.31%), Postives = 249/517 (48.16%), Query Frame = 3
Query: 2694 WKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQ-----DKLIQNLNKIEQEGRIVNELAV----IGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRS----KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK 4205
            ++ EI  YKE+  QHA TI SL  ++ K+ + +  ++ ++A  K +       +     +       + + K + Y  +  ++  +AA        K  +++ E  MK L  DL  A +R+SDL+GEL+E QK E++   + ++    E + L+ ++A++S +V++  +EL           + L EA +  QEK     + E + K  +     D  +Q +  +  E    ++       +G +C+G RH+++I+ QK AL E+R ++K +E      +  P+      E   +L  LR     +K + D+ P  + +LS +          +LA P++                    +   +F   MEKS   D  ++L+ SEK YL + + LGS++ + ++ G      LS +++E +   R+    L+  KI  LK ++ RKEELL GYE+D+ +L++++      Q Q+  +   +  + EE  LL+E L R +  L +EKR N AI++ K
Sbjct:  918 FEEEIMEYKEQIKQHAQTIVSLEEKLQKVTQHHKKIEGEIATLKDN---DPAPKEERPQDPLVAPMTESSAKDMAYEHL--IDDLLAAQ-------KEILSQQEVIMK-LRKDLTEAHSRMSDLRGELNEKQKMELEQNVVLVQQQSKELSVLKEKMAQMSSLVEKKDREL-----------KALEEALRASQEKHRLQLNTEKEQKPRKKTQTCDTSVQ-IEPVHTEAFSSSQEQQSFSDLGVRCKGSRHEEVIQRQKKALSELRARIKELE-----KARSPDHKDHQNESFLDLKNLRMENNVQKILLDAKP-DLPTLSRI---------EILA-PQN-------------------GLCNARFGSAMEKSGKMDVAEALELSEKLYLDMSKTLGSLMNIKNMSGHVSMKYLSRQEREKVNQLRQRDLDLVFDKITQLKNQLGRKEELLRGYEKDVEQLRRSKVSIEMYQSQVAKLEDDIYKEAEEKALLKEALERMEHQLCQEKRINRAIRQQK 1374          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. UniProt/SwissProt
Match: sp|A0JM08|C170B_XENTR (Centrosomal protein of 170 kDa protein B OS=Xenopus tropicalis OX=8364 GN=cep170b PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 1.567e-8
Identity = 34/92 (36.96%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNA---TVRLNDGDILKFGFSVGQY 596
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y  +++   +KDL S +G++VND RI +    T++L+D   ++FG+ +  Y
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFVNDVRIPDQKYITLKLSDN--IRFGYDINTY 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. UniProt/SwissProt
Match: sp|Q498L0|C170B_XENLA (Centrosomal protein of 170 kDa protein B OS=Xenopus laevis OX=8355 GN=cep170b PE=2 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 1.659e-8
Identity = 33/92 (35.87%), Postives = 56/92 (60.87%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNA---TVRLNDGDILKFGFSVGQY 596
            FL S+ G     P+  I +GRE C+  +++ +VD Q AVI Y  +++   +KDL S +G+++ND RI +    T++LND   ++FG+ +  Y
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLRSRSVDKQHAVINYDSDKDEHRVKDLGSLNGTFINDVRIPDQKYITLKLNDN--IRFGYDINTY 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. UniProt/SwissProt
Match: sp|Q5SW79|CE170_HUMAN (Centrosomal protein of 170 kDa OS=Homo sapiens OX=9606 GN=CEP170 PE=1 SV=1)

HSP 1 Score: 61.6178 bits (148), Expect = 7.295e-8
Identity = 33/85 (38.82%), Postives = 51/85 (60.00%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGF 581
            FL S+ G     P+  I +GR+ C+  +Q+ +VD Q AVI Y  + +  ++KDL S +G++VND RI   T + L   D L+FG+
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYDASTDEHLVKDLGSLNGTFVNDVRIPEQTYITLKLEDKLRFGY 91          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. TrEMBL
Match: A0A1S3JI59 (forkhead-associated domain-containing protein 1 OS=Lingula unguis OX=7574 GN=LOC106173268 PE=4 SV=1)

HSP 1 Score: 572.778 bits (1475), Expect = 2.659e-175
Identity = 444/1410 (31.49%), Postives = 750/1410 (53.19%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSW----THLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFH-RRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNN---------------ANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQQLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFL----SGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYE--------EKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTINLKWKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPV 4460
            +G+L+  EGVF L+PK+T +GRE CD  IQ+L VD Q AVIEY + E+ +VL+DLN+  G+YVNDCR+QNA VRL  GD+++FGF+   YE   +N +  DS   I     Y   Q + ++ W  +P S P  +SS    S P+   SQP       T   PG +      + L + P S  + RP   + Q     T  +P +      +   R + S P+   L      Q  +QK++++  EI+RL   E +   K    + +I Q+ + NN               A L  ++  L +ELS K  EI  L   L +L + +      ++ ++    +   +LE  +KD  I++GLVT +Q+D+SN D TI +LTR+ ++L +++ EK++ ++ ++ K +RL+D ++ +     R++E++ LRHK  AAE+KV + ++ +++L   +EK + +     +  + L  + D  K    D+QR+E L+RVD +++ K+ +RF +RV+QI  STPG K+ D  + +DE++  LK++   + E  R++ D ++ +  AN    +  + L   K  L +    L    R +  + + + L   + V D +  +KD +   + SE+ +     + LE C  GV  ++++    D   K I    +  ES +  +++L+  +   E        E + +VK  ++D L      A++K + E + K+   +DE++  +    +N       KI E +  ++ L++ L  K +  +  ++S    L   ED KK   EL  +L K+  EK      L         +   E+  YKE+  QH++TI ++  R+ KL K+N D + ++   K   +++K            K   +          +A LE+ + A+R EN  LK+++ E +  +  L  DLAGA AR+SD+ GELSE+QK +++   ++++  + E  + R +LAK+S IVD  K+E+ D   E   L   L +      +K+S++ ++E+ +  E+D+  + L+ +E+EGRI +EL   GAQCRGERH+Q+I  Q+ AL E+R+++K++E          +  QQ+  +K+ELA LR        A Q ++    ++A+                      S+     +    I  +  + D+EKS   +   +LD SE +YL+LLR + S LEM+ +KGLR  +++  +++  L  DRE+ C +L  +I++LKERI RK+ELL  YE+DL +L+QAE LA K   Q+E++   +  K +E + LRE+LNRT+D L++EKR N+AIK+ K Y     +      P   K+ CPP+DI  K+   E+   +K KRK+YE+++LK EL  +++EL QA+ R++ LETS+G+ SEE V
Sbjct:    2 KGYLKGTEGVFLLAPKVTTVGREGCDLAIQSLNVDQQHAVIEYSDQEQCYVLQDLNTATGTYVNDCRVQNAAVRLAPGDVVRFGFNGTPYELQIDNTQQTDSFEPIEPQPGYPVHQQM-RAAW-TSPYSNPVPTSSLPYLSMPS---SQP-VTTWVPTGGAPGALPPHPPPSTLRQRPLSAGARRPSYENLQRVGAATSGSPMVQNKTVGWQASRSAGSSPTNDIL----LLQEKEQKIMRMGDEINRLAAFEAENQRK----DQVIAQLQEENNRLRAIQNTGGVFGMDAQLTQKLLELENELSAKKIEIGHLRDQLNRLQQEAAFRGPTTTPDDLKNMK--NELERVKKDKNITSGLVTQMQRDMSNKDSTISRLTREIEKLKKDVREKDVQMTAMSAKAARLRDSKKVDEHSDARDKELMSLRHKFKAAENKVQDMNDLVKSLKEEIEKLKTSVGEEKEGQKKLQAEVDHGKQQYLDMQRAERLVRVDLEQATKRLERFRSRVVQITFSTPGIKAPDGEISDDELLTKLKKVVDDRTEFRRKLQDTKESLQVANTTNKEVADSLKALKQHLNDAEGRLRDNGRLARHIKQEINLLQSVGVEDRMQWVKDRVVAFMSSELSWEQDIENALERC--GVNVKVST----DEPGKHIANLYNRWESSLSEKEKLNAQIALLETQHKADILEHVTKVKTEMQDKL----TDAVEKAKLESEEKMNKAIDEIRSVEQEKRENAVEAERKKIEELQGTVQQLRQNLTAKAEEDKETLESAKEALTQVEDYKKLEAELRDQLAKLEAEKNAEIAELKLSRSDAAEESNKEVTSYKEQIKQHSVTICAMEERVMKLTKKNKDYQTEVTALKQQIQELKSRPPPQPKVVRPKTPPKHTVVVEPGPDVAALEQILLAVRRENQELKSKLQEQQDVILALRRDLAGASARMSDMTGELSEAQKEKLEQSTVQVQQKQRELDEERQKLAKMSAIVDSQKKEIQDYSNEMSKLKSLLNKLKTETSDKNSQVQELELALTREKDEQKKQLSLVEEEGRITSELTSYGAQCRGERHEQVIARQREALAELRQRIKSLEQVRPPVPTHDQALQQVALLKKELAELR--------ANQALAEDKHIMAST---------------------SLDRQVSKARGIIHSVNAEADIEKSAHRETMDALDDSENSYLTLLRAIASSLEMEEVKGLRSMSHIPKDERRRLYDDREKSCEMLASRIKVLKERISRKDELLQTYERDLARLRQAEQLAEKKNAQVESLTNDVISKLDETQYLRESLNRTRDRLDQEKRLNSAIKQKKTY----HMENEKPEPKWSKHRCPPDDIFGKKAAKERAHREKVKRKNYEMRALKGELTERDRELVQASRRIHDLETSLGLDSEEFV 1352          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. TrEMBL
Match: K1QJE3 (Forkhead-associated domain-containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10014985 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 2.431e-156
Identity = 442/1433 (30.84%), Postives = 752/1433 (52.48%), Query Frame = 3
Query:  327 RGFLRSNEGV-FTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPT--INYS--QPQAFQHRHT----------VNDPGMVSWT-----HLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFH---RRGSISGPS-----KQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQIND-------------PNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQ-QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIX-XXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRS----EIEFLSGLELCI-------SGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTINLKWKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTD-------LKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGI 4442
            R FLR ++G    +  K+T +G E CD  I+   VD Q AVIEY + E  +VLKDLN+  G+YVNDCR+QNA +R+  GD +KFG+    YEF  +N              P ++  P+        P +  Q+ ++ Q    P   +NYS  Q Q F    T          +  P  V WT     +LP+ P S+R     + S+  RR  T  APP+  P P      R G ++G +      Q +  NK Q+ + QK++QL  E+ RLR +E +   K   I++L Q +ND               + NL  +I  L +E+++K  E+  +   L +L  +      +  + ES      + +LE  +K+  I++GLVT +QKD+SN D TI KLTR+ + L +E+ E++I IS ++NKLS+ KD       ++  RE+E++ LR K   AE+K+ E  E I TL   LEK + +        + L  Q D+ K+ ++D+QR+E ++R+D +++ K+ +RF  RV+Q   S+   K+ +  + +D+++D LK+LA+ + E   ++ D +K +   +     F  ++ K +T L++  + L +     + +   + L   +   + I+ ++D + Q L +    E E  + L+ C         G G  + S+       +++Q+  + +E+K      L+ T + ++ +++   + +K++ E   K A++K R E +  L   ++EL+  +    +N     + KI E +  I+ L+  L E+ + F+ ++   ++ +   ++ K   +ELE  ++ +  EKL L   L  +    + K++ +I+ YKE+  QH++TI ++  R+ KL K+N D       LK  + + K++  ++K       +         +            +E+ +  LR EN  LKN +   +  + GL  DLAGA ARLSD+ GELSESQK E++  K ++   E E   LR+Q+AKLS I+D+ K E+   +++        ++    + EK+ +I ++E++++NE+ +  + L+ ++QEGRI +EL  +GAQCRGERH+Q+I  Q+ AL E+R + KN+E          +  QQ++ +K+ELA +++ +A+ ++     S LS  +  +    R +L    +E                           DME+S   +   +LD SE +Y++LLR + S LEM+S+ GLR   ++  +++E L ++RE  C +L  +I++L ERI RKEELL GYE+DL KL+QA++LA +   Q+EN+   ++ + EE + LRE+L+RT+D L++EKR N AIK+ K +  +         PT+  +HC  EDI  K     K   D  +RK+YEI +LK EL  KE+ L    NRLY +E ++G+
Sbjct:    2 RAFLRGHDGSDHQILSKLTTVGCEGCDLVIKTAGVDMQHAVIEYNDQENVYVLKDLNTAQGTYVNDCRVQNAAIRMAPGDQIKFGYMGMPYEFLVDN-------------QPSVSCPPVHSQQTWNQPLTLLQEVTNEQSMLGPPQQMNYSTTQGQIFNQSSTLPFLQTGTACITIPSTV-WTPSDRNNLPRPPISMRGRPLSAGSA--RRVQTMGAPPIPSPAPSMQQSVRNGWVNGMAGRQQVNQNVDINKVQEKE-QKIMQLNEEVGRLRDVEMESFRKDAYIQTLQQLVNDLKTKFAEQQPLIMGQDVNLTQKICQLENEVTSKEQELSAVKEQLSRLQLHQPVSPVSVFDTESKETNQLKIELERAKKEKNITSGLVTQMQKDMSNKDTTISKLTREIETLRKEVRERDIQISSVSNKLSKSKDTPLRSSEDRDAREKEIMSLRQKYKTAENKMQEQEELINTLKQELEKSKVSIFDEKSQQKKLETQIDQLKSELSDVQRTERVVRIDLEQATKRLERFRNRVVQAAYSSGSTKAPEGEITDDQLVDTLKKLAEERTEFHNKVKDMEKQLKLTDSSSNVFKRNITKLRTDLEKSIENLKTNGFLVSSLKHEMELLQSVTGEESILWMRDCLVQLLTNVSAWEKEIETSLQTCGININLSNDGPGKHIVSMH---SKLQVLQKEKENLETK------LANTEKEFKSELEMKIKVMKEENENLVKDAIEKTRAEGEETLNKAIEELKFVESEKRENAIAGEQKKIEELQVTIDQLRVNLQERQREFEEKLQEASSTIHQIDEYKAIQEELEARIKALETEKLELSTQLSSEAQDRDKKYEQDIEAYKEQNKQHSVTICAMEERLIKLMKKNKDYQEEITVLKKTIQEMKTEMIQLKDKAAAAAHTKPAPPPKPKVIVQKPSQDYVAMEQLVVVLRKENSDLKNTIQSRDDVILGLRRDLAGAHARLSDITGELSESQKQEMEKHKEKLVQREREIEGLRLQMAKLSKIIDKQKDEIKSLQKQLSEEKAISIKFQSNMDEKNRRIKELELEVENEKMEQKKQLDLLDQEGRITSELTALGAQCRGERHEQVITRQREALAELRLRCKNLEQAKPPLPTQDQALQQVIMLKKELAEIKANQALSEN-----SELSSGLEREVSRARGMLGSVNAEA--------------------------DMERSAHRETMDALDASESSYITLLRAMASCLEMESVDGLRPIGHIPKDERERLLVERENTCQILANRIKVLLERIARKEELLQGYERDLAKLRQAQELANRNSTQVENLANDVKSRTEETQYLRESLSRTRDRLDQEKRLNKAIKQRKTFHLENERLHQQQVPTS--HHCKEEDIFGKSSARRKASKDSLRRKNYEISTLKKELCSKEQSLYDTENRLYMIENTVGM 1375          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. TrEMBL
Match: A0A433UB86 (FHA domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_001184 PE=4 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 9.410e-139
Identity = 420/1432 (29.33%), Postives = 739/1432 (51.61%), Query Frame = 3
Query:  327 RGFLRSNEG-VFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQP------------------IQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRR-----GSISGP--SKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIE-----------------SLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQQLEV----TRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPD-EIVPLKDVINQNLRSEIEFL----SGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTINLKWKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQL---IQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAM---RDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIK-KHKHYVPDKSLAESHASPTTPK-YHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGI 4442
            + +L+  +G +F L PK+T IGRE+CDFTIQ   VD Q  V+EY E E+ FV++DLN+  G+YVN+ R+QNA VRL  GD ++FG++   +E   +N           +T+  +T +P                   Q+   Q NP      S+S+     P I+Y+   A QH  +     + S    P     LRS    + +    R+   + PP      V   R     G ++ P      +PD    Q  DQ+L++L  E+ RLR  E D + K   I+                 SLI   N   + +   ++ +L  E+S K  EI+ L   L K+ ++ +              +   QL       +KD  I+ GLVT +Q+D+S  D TI +LTR+ + L +++ E+++       +LS  +   +   E   RE+E+  LR K    E+K  E  +TI  L   L+K +    + ++  +    +   A+A +TD+QR+E ++RVD ++ + + +RF +RV+Q+  STP  K+ +  L +D+++  L++LA+ +      I   +  +  A     + +      +  ++   + L    R ++ + + L++    ++ D E+  +K+++  NL++E ++     + LE C  GV  +++  S S   + +  R   ++      + +L    E+++ +M++  +A +++ +   + A++K R E + KL A +DE++  +    ++L      KI + + +IE L+ +L E+    + +++     LK  E L+    EL++ ++ + +E      +   +  ++  K++A++  Y+++  QH++TI S+  R+ K  K+N DL+ +L+K ++D  K              +E+            +A LE  + ALR EN  LK  + + +  M GL  DLAGA+ARLSD  G++SE+QK E++  +  +     E T+LR Q+AKL+ I+D  K+E+   K     L++  + +++L   ++E++ K+  +E +++ E+++  + L+ I+QEGRI +EL  +GA CRGERH QII  Q+ AL E+R K+K +E +        +  QQ++++K+ELA +R  +A+   R  A    SSL   +       R +L        PA+                    + DME+S   +   +L+ SE ++L+LLR + + L+++ I+GLR  A++  +++E L   RE  C LL  +I++LKER+ RK+ELL+GYEQDL KL+ +++LA     Q+E +   +R + EE E LRE+LNRT+D LN+EKR N+AIK K   ++ ++S   +H S    + +HCP ED   K  + EK + D  KRK+YEI++LK +L   EKEL +   +L +L+TS+G 
Sbjct:    3 KAYLKGADGTLFPLLPKVTTIGRENCDFTIQLPGVDYQHCVVEYSEPEDCFVIQDLNTAQGTYVNEVRVQNAAVRLAPGDQIRFGYNGQPFELQVDN--------QTQITAAAVTQRPPLWVHQQQHEQQQQQNYHQQQQQQQQNPYGLLYSSTSSSQFGLPHISYASTPA-QHMPSTWVHPVTSQPPPPLPRPPLRSRPLSAGAVGGARRAVQTLPPSGAGIAVGPCRSTMVGGWVNAPLTRTSSIPDI---QEKDQQLLRLNEEVTRLRTFEFDSVRKDTLIQQLQQQIGDMQNKIGTEPSLIIGGNGGGDFDTSARLLHLETEVSAKKGEIKNLKEQLSKMQQDRSSSPHLLRQELGERVKEVTQLRTELDRVKKDKGITAGLVTQMQRDMSQKDSTISRLTREIEVLKKDIRERDV-------QLSSKRSSPKLAEENSAREKELTTLRQKFKTVEAKQQEHLDTITALRAELDKVKAAVTVETEIAKKNQSELTAARAQVTDIQRTERVVRVDLEQCQNRLERFRSRVIQVAYSTPALKAPEKELSDDDILAALRKLAEERARLMSNISQLETDVASAKAGRGELLGHAATLRDVVQAAVNRLKEKGRNASNLKQELSIIQSAQLGDLELSWIKNLMISNLQAEHDWQLDTEAALEKC--GVNCKISMDSNSKHIEGLYARWESSLSEAKDLKAQLEAQAEAHKAEMQQRDEAAREEAQGRIQDAVEKARLEGEQKLNAAIDEIKASETEKRESLLEAERRKIEDLQASIEQLRGSLAERSSDDEARLEEAKMALKEVEALRMLEKELKERIQTMQKEIEDQIATFANEKSSLESKYQADLTQYQQQVKQHSVTICSMEERLEKSAKKNKDLQEQLSKLRADKSKPSPPPKPKVIVQRPREE------------LAALEHVVNALRQENTVLKKEIRDSQDVMIGLRRDLAGAQARLSDTAGDVSEAQKQEMERNREILAARAAELTELRQQMAKLTKIIDSQKEEI---KVLEGGLSKEKVVSSKLQSGLEERERKLRLLEEELQREKEEQKKQLDIIDQEGRITSELTSLGAACRGERHGQIISRQREALAELRAKVKGLEQSRPPLPTQDQALQQVVQLKKELAEMRVHQALAEDRVLAEATGSSLDREVGRA----RGLLT-------PAN-------------------VEADMERSAHRETMDALECSEASFLTLLRAMAASLDLEEIEGLRPMAHIPKDEREKLVDIRERACQLLANRIQVLKERVSRKDELLMGYEQDLAKLRHSQELAQAKSHQVETLANDIRSRSEESEYLRESLNRTRDRLNQEKRLNSAIKSKRTFHLENES---NHLSNKNSRGHHCPVED--PKATVREKRQKDLIKRKNYEIRTLKGDLCDTEKELFERDRKLVSLQTSLGF 1363          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. TrEMBL
Match: V4B303 (FHA domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_237318 PE=4 SV=1)

HSP 1 Score: 418.698 bits (1075), Expect = 4.325e-119
Identity = 406/1458 (27.85%), Postives = 711/1458 (48.77%), Query Frame = 3
Query:  327 RGFLRSNEG-VFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQS---SSNQITSFPTINYSQPQAFQH-------RHTVNDPGMVSWT----HLPKAXXXXXXXXXXXXXXQNR-----RQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSD-------------------ELSNKTNEIEKLHSLLGKL----AEXXXXXXXXXXXXXXXXXXXXQQLEVTRKDLRISNGLVTTLQKDLSNH-------DETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXX---------XXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRS----EIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTINLKW-------KAEIDLYKEETVQHAITIDSLNNRMTKLNKENT--------------DLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLI-QEKDSK------INDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAM-RDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTL 4424
            + FL+  +G +F LSPK+T IGRE CD TI+   VD Q AVIEY + E+ +VL+DLN+  G+Y+N+ R+QNA VRL   D+++FG +   YE   EN   +      P+      TQP+   G Q    S  Q +    +  +T+ P       Q  Q        R   +  G +        LP         +  S   Q+      RQ+T +               S++ P+   +      Q  +QKL+QL  E+ RLR +E D   K   ++ L Q+     N +LH Q+ +  D                   E++ K +EI  L   + KL     +  N      S      + +  ++E  RKD  I++GLVT +Q+D+S+        D ++ KL R+ + + +EL E++I ++   NK+++LK+     +  ++++         RE++ LR K   AE+K LEF + + TL   ++  +       D  R L  + D AK+   D+QR+E ++RVD +++ K+ +RF  RV+Q+   + G  + +  L +D++++ LK+L + +      I + +    EA     + +E+  K +  L    + L         VN+ + +   +   D    ++DV+   L++    E    + LE C  GV  +L++        +I ++ + A+E K   E +L+    S++E+ ++  ++L + +E   K A++K R E + KL   +DE++     +L++  RE      + +         L +  ++F  Q +   N+L+ + ++  + D L     ++  + + L+QS   + + IN +        + EI  +K++  QHA+TI ++  R+ K+ + N               DLK +L K++  +   K   V+ +N  E                +  LE  I+ LR +N  LK ++   +  + GL  DL GA ARLSD+ GELSE+QK E++  +  +   E +  + R QLAKLS IVD+ K E+         L   L++   ++ Q KDS       I + E ++ +E+++  + L+ ++ EG+I  EL+ +GAQCRGERH+ +I  Q+ AL E+R ++K++E          +  QQ++ +K+ELA +++ +A+  D+   G S L   I N+ R   A   +                             + D+E++  ++ Q SLD+SE++Y SLLR +   L +D  + ++  A+L  +D+  L   RE++C  L++KI++LKE ++RKE +L  YE+DL KL+Q +D++ K   QLE +   ++ + EE   LRE LNRTK+ LN+E R N AIK+ K +  +       + P+ PK     +D   K  + ++ + +  K+KD+EIK+LK +L  KE+EL +   R+ +L
Sbjct:    2 KAFLKGGDGHLFPLSPKVTTIGREGCDVTIKIPGVDYQHAVIEYYDIEDCYVLQDLNTVQGTYINNVRVQNAAVRLAPSDMIQFGSNGATYELFIENPPPVIYP---PVQQRPAWTQPLTVIGDQPATTSHDQSNLPYITTTVTALPPSGMWVQQNQQSPLPRPPLRTRPSSAGSIRRGSFEGRLPNGQVVTTIQQQPSILQQSGNWTGGRQVTTNVI------------SSVTNPNDLMI----MMQEKEQKLLQLTEEVGRLRGVEMDSFRKDQMVQKLRQE-----NLDLHSQMSSFDDQQQHVTDMELTQRLMSLENEVAGKKSEIAILKEQISKLKLESPDTPNIVRQELSERVRELSSVRNEMERLRKDKNITSGLVTQMQRDMSSKCEEDTILDSSLSKLNRELEMVKKELRERDIQLTAANNKITKLKENYAASSLAENKQNVETNNARDRELMSLRQKFKNAETKTLEFQDLVTTLRGEVDNVKTQLFEEKDKNRKLQTELDTAKSQYLDMQRTERVVRVDLEQATKRLERFRNRVIQVTYGSSGLSAPETELTDDDLLETLKKLIEERGSLKTVITELETKKQEAESSKDELMENSQKLQEHLDASLNRLKEKGMKCETVNQEIDILNSVATDDSFTWMRDVVADILKTVSSWEQSIETSLETC--GVNVKLSNEGPDRHILQINEKLLAALEEKSRLETQLTDADVSHKEEFEQKIKSLTEQMENDMKDAVEKARLEGEEKLNKAIDEIR-----LLESERRESMESSDKRKIEELES--ALEQLRESFTKQEEEQANKLEQASNILAQFDMLRSSEAQLRADLIKLDQSKKLEMEEINKQLSEKDQAHQDEILHHKQQVSQHAVTICAMEERLAKVTRINAEYEEQIKALNCKVQDLKTELNKAQKPSIPPKPKVVLQRNTEE----------------MTALEHLISVLRLDNSELKKQLTAQQDVITGLRRDLTGASARLSDITGELSENQKQEMEQNREILCRREKDLNETRQQLAKLSKIVDKQKAEMK-------TLEAALLKEKDIVRQYKDSMDDNVNIIKEYEARLNDEREEQRKQLDLLDHEGKITTELSALGAQCRGERHEAVIMRQREALAELRGRLKSLEHARPPLPTHDQALQQVVILKKELAEMKANQALSEDNVLNGRSVLDREI-NRARGAAAKGGV-----------------------------EADIERTAHKETQDSLDHSEQSYFSLLRGVAGTLAVDEAEVIKPMAHLPRDDRARLLQQREKLCESLVRKIQMLKEVLERKEGMLANYEKDLDKLRQLKDVSEKKSVQLEALVNDVQGRSEETMYLRECLNRTKERLNQEIRLNKAIKEKKTFHLENERIHLESPPSKPKPSNTSDD--NKSILQKRAQKELLKKKDFEIKTLKDQLSTKEEELRRQDQRVMSL 1371          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. TrEMBL
Match: A0A210PX51 (Forkhead-associated domain-containing protein 1 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21049 PE=4 SV=1)

HSP 1 Score: 414.846 bits (1065), Expect = 4.184e-118
Identity = 344/1081 (31.82%), Postives = 581/1081 (53.75%), Query Frame = 3
Query: 1299 QLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQ---KLIDEANKKYWQFIEDL----DKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRL----SQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTI-------NLKWKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXX------XXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDS-------KINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHK--HYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGI 4442
            +LE  +KD  I++GLVT +Q+DLS+ D TI KLTR+ + L +EL EK   +S +T K+++LKD  +   E+  RE+E++ LR K  + E+K+ E  + I  L   LEK + T        +    Q D+AKA + D+QR+E ++RVD +++ K+ +RF  R++Q+  STPG K+ +  + +DE+I+ LK++   +    +++ D +   K  D A   + +   DL    +   T LK     ++S ++  + +N ++    L+   D +V   D++   L  E    S LE C  GV  +L++    D   K I       ES +  ++RL    +Q    Y+E++ R +   ++D E   + A++K R   + KL   ++E++  ++  L N  R    +I + E+       +L +  +TF  Q   + +Q + +  +  +++E       + E+ + LE    E  D         + K++ +I  YKE+  QH +TI ++ +R+ K+ K   + ++++   K    +++     +K+    K            + + +Y  + NL   I  LR ++V LK+++   E  + GL  DLAGA ARLSD+ GELSE+QK E +  K  + + E E TD+R QLAKLS I+D+ K+EL        +L  +L +     Q+  S       KI  +EI ++ E+++    L  ++ EGRI +E+  +GAQCRGERH+Q+I  Q+ AL E+R ++K++E++           QQ++ +K+ELA +R+ +A+ +     + SL   ++      R +L     E                           DME+S   +   +LD SE TYL+LLR + S LE+DS++GLR   ++  +++E L ++RE  C L+  +I++L+ER+ RK+ELL GYE+DLVK++Q+++LA +   Q+EN+   ++ K EE + LRE+LNRT+D L++EKR NTAIK+ K  H   +++   S  S T   ++C   DI+ K    ++ + D  KRK+YEI +LKSEL  KEK L     RL TLE SMG+
Sbjct:  294 ELERVKKDKGITSGLVTQMQRDLSSKDSTISKLTREIEMLKKELREKEGYVSTMTAKVNKLKDTGKSTEERDAREKELISLRQKFKSTENKIQEQHDLISKLKEELEKTKLTVFEEKQIQKKTQIQMDQAKAELVDVQRTERVVRVDLEQASKRLERFRNRIIQVTYSTPGIKAPETEIGDDELIETLKKIVDERTSFFQKVKDLEIQLKSTDSAQDSFKKTSTDLRNKLNNIITHLKTNGFNVTSLKQELDLLNSVVTSDTLVWARDMLV---DLLTSALSWEQTIESSLEKC--GVNVKLSN----DEPGKHILLLFAKWESSLSEKERLMSQITQVETQYKEELARNRTMAEEDAENRVRDAIEKTRLGGEEKLNRALEEIRAVEEEKLDNAVRVERQRIEQLEQ-------SLEQLQETFTNQQGDVRSQAEETSQMMMQLEEYTTMETSLREQIVALETQCAELEDKQAHEGQRQDKKYEQDIQSYKEQNKQHGVTICAMEDRLVKMTKRAKEYQDEVTMYKKTIHELRGELTTLKSRPVPKPVPPPKPKVIIQKPSEDYVAMENL---IVFLRKDSVELKSKIQSQEDVILGLRRDLAGAHARLSDITGELSETQKRENEKNKELLIHRERELTDVRQQLAKLSKIIDKQKEELK-------SLECNLSKEKSFSQKYKSNLTDNMDKIKSLEIALELEKEEQKNQLTLLDHEGRITSEMTALGAQCRGERHEQVIMRQREALAELRSRIKSLEVSKPPLPTQDHALQQVIMLKKELAEMRANQALSEDKV-ALGSLDREVSRA----RGLLGNSNPEA--------------------------DMERSAHRETMDALDSSENTYLTLLRAVASCLELDSVEGLRPIGHIPRDERERLIMERENACQLVASRIKVLRERVSRKDELLQGYERDLVKMRQSQELADRKATQVENLVTDVKTKAEETQYLRESLNRTRDRLDQEKRLNTAIKQRKTFHLENERAHIPSARSATYSSHNCGSTDIMGKNAAKKRQQKDVMKRKNYEIHTLKSELVGKEKSLCDTEYRLATLENSMGL 1317          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Cavefish
Match: si:ch73-212j7.1 (centrosomal protein 170B [Source:HGNC Symbol;Acc:HGNC:20362])

HSP 1 Score: 67.3958 bits (163), Expect = 1.359e-10
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFS 584
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y    +  ++KDL S +G++VND RI + T + L   DI++FG+S
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYNPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDIVRFGYS 92          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Cavefish
Match: cep170b (centrosomal protein 170B [Source:NCBI gene;Acc:103032367])

HSP 1 Score: 64.6994 bits (156), Expect = 8.878e-10
Identity = 33/85 (38.82%), Postives = 52/85 (61.18%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGF 581
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y    +  ++KDL S +G++VND RI + T + L   D+++FG+
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDVVRFGY 91          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Cavefish
Match: cep170b (centrosomal protein 170B [Source:NCBI gene;Acc:103032367])

HSP 1 Score: 64.6994 bits (156), Expect = 1.006e-9
Identity = 33/85 (38.82%), Postives = 52/85 (61.18%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGF 581
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AVI Y    +  ++KDL S +G++VND RI + T + L   D+++FG+
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVINYDPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKLSDVVRFGY 91          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Cavefish
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:103025411])

HSP 1 Score: 54.6842 bits (130), Expect = 9.706e-7
Identity = 36/98 (36.73%), Postives = 54/98 (55.10%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPK-ITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFG-----FSVGQYEFH 605
            FL S+ G     P+ +  +GR+ C+  +Q+ +VD Q AVI Y    +   +KDL S +G++VND RIQ    + L   D L+FG     F+V + E H
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEATSDEHKVKDLGSLNGTFVNDVRIQEQMYITLKIDDKLRFGYDTNLFTVVRGELH 104          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Cavefish
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:103025411])

HSP 1 Score: 54.299 bits (129), Expect = 1.264e-6
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPK-ITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSVGQY 596
            FL S+ G     P+ +  +GR+ C+  +Q+ +VD Q AVI Y    +   +KDL S +G++VND RIQ    + L   D L+FG+    +
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEATSDEHKVKDLGSLNGTFVNDVRIQEQMYITLKIDDKLRFGYDTNLF 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Sea Lamprey
Match: fhad1 (forkhead-associated (FHA) phosphopeptide binding domain 1 [Source:ZFIN;Acc:ZDB-GENE-041210-354])

HSP 1 Score: 73.559 bits (179), Expect = 8.850e-14
Identity = 35/94 (37.23%), Postives = 54/94 (57.45%), Query Frame = 3
Query:  327 RGFLRSNEGVFTLSPKITIIGRES-CDFTIQNLT-VDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEF 602
            + +L+   G+  LS K   +G  + C   IQ     + + A++ +   +  +VL+DLNS +G+YVN CR+QNATVRL  GD ++FG S   Y  
Sbjct:    2 KAYLKGANGMLPLSQKPIRVGSGADCQLHIQGCGDTEGRHALLRFSAADGCYVLQDLNSANGTYVNGCRVQNATVRLAPGDTIRFGGSPHSYSL 95          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Sea Lamprey
Match: cep170aa (centrosomal protein 170Aa [Source:NCBI gene;Acc:557463])

HSP 1 Score: 52.7582 bits (125), Expect = 8.072e-7
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  363 LSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSVGQY 596
            L  ++   GRE C+  + + +VD Q AVI Y    +  +LKDL S +G++VN+  + + T V L   D+++FG+    Y
Sbjct:   18 LPRELIFAGREDCELVLHSRSVDKQHAVINYDLVHDQHMLKDLGSLNGTFVNEVPVPDQTYVSLKQSDVIRFGYDPNVY 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Sea Lamprey
Match: cep170aa (centrosomal protein 170Aa [Source:NCBI gene;Acc:557463])

HSP 1 Score: 52.7582 bits (125), Expect = 8.177e-7
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  363 LSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSVGQY 596
            L  ++   GRE C+  + + +VD Q AVI Y    +  +LKDL S +G++VN+  + + T V L   D+++FG+    Y
Sbjct:   18 LPRELIFAGREDCELVLHSRSVDKQHAVINYDLVHDQHMLKDLGSLNGTFVNEVPVPDQTYVSLKQSDVIRFGYDPNVY 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Sea Lamprey
Match: cep170aa (centrosomal protein 170Aa [Source:NCBI gene;Acc:557463])

HSP 1 Score: 52.373 bits (124), Expect = 1.025e-6
Identity = 27/79 (34.18%), Postives = 45/79 (56.96%), Query Frame = 3
Query:  363 LSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSVGQY 596
            L  ++   GRE C+  + + +VD Q AVI Y    +  +LKDL S +G++VN+  + + T V L   D+++FG+    Y
Sbjct:   18 LPRELIFAGREDCELVLHSRSVDKQHAVINYDLVHDQHMLKDLGSLNGTFVNEVPVPDQTYVSLKQSDVIRFGYDPNVY 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Nematostella
Match: EDO42377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1K5])

HSP 1 Score: 219.55 bits (558), Expect = 4.450e-60
Identity = 182/616 (29.55%), Postives = 309/616 (50.16%), Query Frame = 3
Query: 2703 EIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSK------------------------SDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTI--------EQLQFDL---DMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHC-PPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGI 4442
            E+  +KE+T QHA+TI ++ +R+ +L K+N  L+ ++A SK                        S   +    E       E +   Q N +A   + +  LE+ +  LR E    K    +    ++GL  DLAGA AR+SDL GELS+ QK +++  +  I+  + E    R QL KLS +VD  ++E+D ++       + L++  Q I++K +++     ++    +     +++IE E +  ++L   G +CRGERH+ +I  QK AL +MRKK K +E       +  +  QQ++ +K+E+A LR+  A R+                                         DFH+ E  I        EQ   +L     EKS  +D + +LD SEKTYL L R LG++LE+D + G R  A++  E++E L+ DR +   LL+ ++++L+ER+ RKE LL GYE+DLV L++++ +A     +   +   +R + EE+  LRE+L+R +D L++E+R N  +++ K +  D    ++H       + C   E    +E+  ++   ++ KRK+YEI+SLK EL   ++EL     RL   E++  +
Sbjct:   85 EVASFKEQTRQHALTIVAMEDRLLRLTKQNKQLEQEVAFSKQQSGAKHRPTSPRKESRPPSPRKTSPRPQSPKKEPKQTRSVETETSPQSNVEASLKSDVYKLEQLVLLLRREASQAKKEAQDQSDVVQGLRRDLAGASARMSDLAGELSDKQKQKLEEYEERIQLQDKELEGQREQLLKLSTLVDEQQKEIDMREGRLSETEKSLVKHKQDIKKKGTELVKYREKLVETMEDRQTKVDEIEIEKKTASDLYAQGMRCRGERHEHVIARQKEALADMRKKSKLIEQLKPPLPSHEQSLQQIVALKQEIAELRATLASREE----------------------------------------DFHKNESQIHAELRLVREQSSSNLAEKQFEKSTHKDTKDALDLSEKTYLKLARTLGALLEVDPVPGTRSMAHIPAEEREKLEQDRSKAVELLVSRVKLLQERLDRKENLLGGYEKDLVNLRESQTVAGMKSAEASGLKLDVRTRQEEIAYLRESLSRLRDELDQERRVNVCLRERKKFAMDFEDRDTHRKA----HSCYTDEHSRYQEEAKKRKAAERIKRKNYEIESLKKELRSADRELNDTAIRLQAFESTRNM 656          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Nematostella
Match: EDO28786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5H7])

HSP 1 Score: 67.3958 bits (163), Expect = 5.229e-12
Identity = 62/226 (27.43%), Postives = 114/226 (50.44%), Query Frame = 3
Query: 3570 KKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPAD--EQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQL-GSILEMDSIKGLRHFANLSYEDKEALKLDREEI------CGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPD 4220
            +K  R  +P+  S   +    + +  R+V    E+E  P    E S+K D +++E+ +  L+ +    K + +D+   +         L R L G+   M  + G      LS + K+ L+   E I        LL+ ++++L+ER+ RKE LL GYE+DLV L++++ +A     +   +   +R   EE+  LRE+L+R +D L++E+R N  +++ K +  D
Sbjct:    8 RKESRPPSPRKTSPRPQSPKKEPKQTRSV----ETETSPQSNVEASLKSDVYKLEQLVLLLRREASQAKKEAQDQSDVVQ-------GLRRDLAGASARMSDLAG-----ELSDKQKQKLEEYEERIQLQDKAVELLVSRVKLLQERLDRKENLLGGYEKDLVNLRESQTVAGMKSAEASGLKLDVRTCQEEIAYLRESLSRLRDELDQERRVNVCLRERKKFAMD 217          

HSP 2 Score: 50.0618 bits (118), Expect = 2.356e-6
Identity = 31/82 (37.80%), Postives = 47/82 (57.32%), Query Frame = 3
Query: 2928 IANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKL 3173
            +  LE+ +  LR E    K    +    ++GL  DLAGA AR+SDL GELS+ QK +++  +  I+ L+D+  +L V   KL
Sbjct:   54 VYKLEQLVLLLRREASQAKKEAQDQSDVVQGLRRDLAGASARMSDLAGELSDKQKQKLEEYEERIQ-LQDKAVELLVSRVKL 134          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Medaka
Match: cep170b (centrosomal protein of 170 kDa protein B [Source:NCBI gene;Acc:101174238])

HSP 1 Score: 67.3958 bits (163), Expect = 1.522e-10
Identity = 33/85 (38.82%), Postives = 53/85 (62.35%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGF 581
            FL S+ G     P+  I +GR+ C+  +Q+ +VD Q AVI Y  N +  ++KDL S +G++VND RI + T + L   D+++FG+
Sbjct:    7 FLVSSSGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYSSNTDEHMVKDLGSLNGTFVNDLRIPDQTYITLKLSDVIRFGY 91          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Medaka
Match: ENSORLT00000029382.1 (pep primary_assembly:ASM223467v1:1:29816185:29820022:-1 gene:ENSORLG00000024629.1 transcript:ENSORLT00000029382.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.948e-10
Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPK-ITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQN-ATVRLNDGDILKFGFSV 587
            FL S+ G     P+ +  +GR+ C+  +Q+ +VD Q AVI Y  N +   +KDL S +G++VND RIQ    V L   D L+FG+ +
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEPNTDEHKVKDLGSLNGTFVNDIRIQEQVYVTLKIEDKLRFGYDI 93          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Medaka
Match: si:ch73-212j7.1 (centrosomal protein of 170 kDa protein B [Source:NCBI gene;Acc:101164272])

HSP 1 Score: 65.4698 bits (158), Expect = 4.752e-10
Identity = 33/85 (38.82%), Postives = 52/85 (61.18%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPKITI-IGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGF 581
            FL S+ G     P+  I +GRE C+  +Q+ +VD Q AV+ Y    +  ++KDL S +G++VND RI + T + L   DI++FG+
Sbjct:    7 FLVSSSGTRHRLPREMIFVGREDCELMLQSRSVDKQHAVLNYNPATDEHLVKDLGSLNGTFVNDLRIPDQTYITLKQSDIIRFGY 91          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Medaka
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:101159217])

HSP 1 Score: 53.9138 bits (128), Expect = 1.827e-6
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPK-ITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSVGQY 596
            FL S+ G     P+ +  +GR+ C+  +Q+ +VD Q AVI Y    +   +KDL S +G++VND RIQ    + L   D L+FG+    +
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEAGTDEHKVKDLGSLNGTFVNDVRIQEQMYITLKLEDKLRFGYDTNLF 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Medaka
Match: cep170aa (centrosomal protein 170 [Source:NCBI gene;Acc:101159217])

HSP 1 Score: 53.9138 bits (128), Expect = 1.909e-6
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 3
Query:  333 FLRSNEGVFTLSPK-ITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNAT-VRLNDGDILKFGFSVGQY 596
            FL S+ G     P+ +  +GR+ C+  +Q+ +VD Q AVI Y    +   +KDL S +G++VND RIQ    + L   D L+FG+    +
Sbjct:    7 FLVSSGGTRHRLPREMIFVGRDDCELMLQSRSVDKQHAVINYEAGTDEHKVKDLGSLNGTFVNDVRIQEQMYITLKLEDKLRFGYDTNLF 96          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Planmine SMEST
Match: SMESG000071072.1 (SMESG000071072.1)

HSP 1 Score: 2486.83 bits (6444), Expect = 0.000e+0
Identity = 1370/1382 (99.13%), Postives = 1372/1382 (99.28%), Query Frame = 3
Query:  318 MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQQLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTINLKWKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPVS 4463
            MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAPSSLRSARPLSASSQNRRQLTPSAPPLVPPNPVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAENSNRHNSNSSNNESSTNQISQQLEVTRKDLRISNGLVTTLQKDLSN DETI KLTRDNQRLTEELSEKNISISVLTNKLSRLKDIQEEETEKQDREREVVGLRHKLTAAESKVLEFSETIETLNTN EKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVL ELAKSK+EHDRRICDKQKLIDEANKKY QFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLR KMDELQEEKDSILQNLTREFENKIIEYEENIENLKETL EKDKTFQVQIDSLTNQLKT EDLKKRIDELEKELEKVTEEKLVLEQSLCEQFDTINLKWK EIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSD KKVKVNEVVIKNEGEEKEKIQENEKAINYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHL+EANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPVS
Sbjct:    1 MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAPSSLRSARPLSASSQNRRQLTPSAPPLVPPNPVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAENSNRHNSNSSNNESSTNQISQQLEVTRKDLRISNGLVTTLQKDLSNRDETINKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIQEEETEKQDREREVVGLRHKLTAAESKVLEFSETIETLNTNFEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLNELAKSKVEHDRRICDKQKLIDEANKKYRQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRTKMDELQEEKDSILQNLTREFENKIIEYEENIENLKETLKEKDKTFQVQIDSLTNQLKTCEDLKKRIDELEKELEKVTEEKLVLEQSLCEQFDTINLKWKTEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDAKKVKVNEVVIKNEGEEKEKIQENEKAINYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLIEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPVS 1382          
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Planmine SMEST
Match: SMESG000071072.1 (SMESG000071072.1)

HSP 1 Score: 2407.1 bits (6237), Expect = 0.000e+0
Identity = 1351/1441 (93.75%), Postives = 1359/1441 (94.31%), Query Frame = 3
Query:  318 MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAXXXXXXXXXXXXXXQNRRQLTXXXXXXXXXXXVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAEXXXXXXXXXXXXXXXXXXXXQQLEVTRKDLRISNGLVTTLQKDLSNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIXXXXXXXXXXXXXVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDELQEEKDSILQNLTRXXXXXXXXXXXXXXXXXXTLNEKDKTFQVQIDSLTNQLKTSEDLKKRIDXXXXXXXXXXXXXXXXXQSLCEQFDTINLKWKAEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGER--------------------------------------------HQQ--IIESQKSALIEMRKKMKNMEITNVS-------------NSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPVS 4463
            MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAPSSLRSARPLSASSQNRRQLTPSAPPLVPPNPVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAENSNRHNSNSSNNESSTNQISQQLEVTRKDLRISNGLVTTLQKDLSN DETI KLTRDNQRLTEELSEKNISISVLTNKLSRLKDIQEEETEKQDREREVVGLRHKLTAAESKVLEFSETIETLNTN EKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVL ELAKSK+EHDRRICDKQKLIDEANKKY QFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLR KMDELQEEKDSILQNLTREFENKIIEYEENIENLKETL EKDKTFQVQIDSLTNQLKT EDLKKRIDELEKELEKVTEEKLVLEQSLCEQFDTINLKWK EIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSD KKVKVNEVVIKNEGEEKEKIQENEKAINYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHL+EANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGER                                            HQ   IIE  + A  +++   K    T+V+             NSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPVS
Sbjct:    1 MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENEEYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENVEIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINYSQPQAFQHRHTVNDPGMVSWTHLPKAPSSLRSARPLSASSQNRRQLTPSAPPLVPPNPVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPLENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSLLGKLAENSNRHNSNSSNNESSTNQISQQLEVTRKDLRISNGLVTTLQKDLSNRDETINKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIQEEETEKQDREREVVGLRHKLTAAESKVLEFSETIETLNTNFEKYQQTDKINSDALRDLNKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFKSSDHALKEDEVIDVLNELAKSKVEHDRRICDKQKLIDEANKKYRQFIEDLDKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQNLRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAEDRLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRTKMDELQEEKDSILQNLTREFENKIIEYEENIENLKETLKEKDKTFQVQIDSLTNQLKTCEDLKKRIDELEKELEKVTEEKLVLEQSLCEQFDTINLKWKTEIDLYKEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDAKKVKVNEVVIKNEGEEKEKIQENEKAINYATIANLEKCIAALRHENVCLKNRVNEYEGAMKGLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLAKLSGIVDRLKQELDDKKRENDNLNQHLIEANQLIQEKDSKINDVEIQMKNEQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRKKMKNMEITNVSKELGGMFHKTPFTMQTHQSMPIIEDWEVAPPKVQHSAKPTFSTDVTLTDYTQIFPKVLKNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLSEVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDMEKSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEALKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKTQGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVPDKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKSELYRKEKELTQATNRLYTLETSMGIKSEEPVS 1441          
The following BLAST results are available for this feature:
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FHAD12.491e-2323.41forkhead associated phosphopeptide binding domain ... [more]
FHAD12.491e-2323.41forkhead associated phosphopeptide binding domain ... [more]
FHAD12.177e-2127.70forkhead associated phosphopeptide binding domain ... [more]
FHAD13.759e-2126.35forkhead associated phosphopeptide binding domain ... [more]
FHAD15.197e-2126.31forkhead associated phosphopeptide binding domain ... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fhad15.013e-2543.70forkhead-associated (FHA) phosphopeptide binding d... [more]
fhad15.275e-2542.62forkhead-associated (FHA) phosphopeptide binding d... [more]
fhad14.562e-2442.62forkhead-associated (FHA) phosphopeptide binding d... [more]
fhad14.562e-2442.62forkhead-associated (FHA) phosphopeptide binding d... [more]
fhad14.582e-2443.70forkhead-associated (FHA) phosphopeptide binding d... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
colec101.234e-832.46collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
CEP1701.251e-835.63centrosomal protein 170kDa [Source:NCBI gene;Acc:7... [more]
CEP1701.308e-835.63centrosomal protein 170kDa [Source:NCBI gene;Acc:7... [more]
colec101.361e-837.08collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
colec101.361e-837.08collectin subfamily member 10 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fhad12.758e-2526.52forkhead-associated (FHA) phosphopeptide binding d... [more]
Fhad12.758e-2526.52forkhead-associated (FHA) phosphopeptide binding d... [more]
Fhad12.758e-2526.52forkhead-associated (FHA) phosphopeptide binding d... [more]
Fhad12.758e-2526.52forkhead-associated (FHA) phosphopeptide binding d... [more]
Cep170b1.116e-935.87centrosomal protein 170B [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A6PWD2|FHAD1_MOUSE1.929e-2426.52Forkhead-associated domain-containing protein 1 OS... [more]
sp|B1AJZ9|FHAD1_HUMAN1.196e-2223.41Forkhead-associated domain-containing protein 1 OS... [more]
sp|A0JM08|C170B_XENTR1.567e-836.96Centrosomal protein of 170 kDa protein B OS=Xenopu... [more]
sp|Q498L0|C170B_XENLA1.659e-835.87Centrosomal protein of 170 kDa protein B OS=Xenopu... [more]
sp|Q5SW79|CE170_HUMAN7.295e-838.82Centrosomal protein of 170 kDa OS=Homo sapiens OX=... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JI592.659e-17531.49forkhead-associated domain-containing protein 1 OS... [more]
K1QJE32.431e-15630.84Forkhead-associated domain-containing protein 1 OS... [more]
A0A433UB869.410e-13929.33FHA domain-containing protein OS=Elysia chlorotica... [more]
V4B3034.325e-11927.85FHA domain-containing protein OS=Lottia gigantea O... [more]
A0A210PX514.184e-11831.82Forkhead-associated domain-containing protein 1 OS... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-212j7.11.359e-1040.70centrosomal protein 170B [Source:HGNC Symbol;Acc:H... [more]
cep170b8.878e-1038.82centrosomal protein 170B [Source:NCBI gene;Acc:103... [more]
cep170b1.006e-938.82centrosomal protein 170B [Source:NCBI gene;Acc:103... [more]
cep170aa9.706e-736.73centrosomal protein 170 [Source:NCBI gene;Acc:1030... [more]
cep170aa1.264e-635.56centrosomal protein 170 [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
fhad18.850e-1437.23forkhead-associated (FHA) phosphopeptide binding d... [more]
cep170aa8.072e-734.18centrosomal protein 170Aa [Source:NCBI gene;Acc:55... [more]
cep170aa8.177e-734.18centrosomal protein 170Aa [Source:NCBI gene;Acc:55... [more]
cep170aa1.025e-634.18centrosomal protein 170Aa [Source:NCBI gene;Acc:55... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO423774.450e-6029.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO287865.229e-1227.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep170b1.522e-1038.82centrosomal protein of 170 kDa protein B [Source:N... [more]
ENSORLT00000029382.11.948e-1039.08pep primary_assembly:ASM223467v1:1:29816185:298200... [more]
si:ch73-212j7.14.752e-1038.82centrosomal protein of 170 kDa protein B [Source:N... [more]
cep170aa1.827e-635.56centrosomal protein 170 [Source:NCBI gene;Acc:1011... [more]
cep170aa1.909e-635.56centrosomal protein 170 [Source:NCBI gene;Acc:1011... [more]
back to top
BLAST of Forkhead associated phosphopeptide binding domain 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000071072.10.000e+099.13SMESG000071072.1[more]
SMESG000071072.10.000e+093.75SMESG000071072.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025883 ID=SMED30025883|Name=Forkhead associated phosphopeptide binding domain 1|organism=Schmidtea mediterranea sexual|type=transcript|length=4623bp
ATATTGGTCAATCTCTTCAGTGGTCAAGATTTTGGTTACCAATTGATAAA
CACAATCCAACCGGAGTTTGAGATTTATTAATAAACACAATGTGTGCATT
ACACGAATTATAATTAACTAGATGCCTTAATAGGAGGTAAATTAAACCTT
TAACCTTTGCCATTATCAACTGTCAGTAAAAATTTTTCAACAATGCAATG
TTATGAGATTTTTTTCTTCGTATGATTTTTGATTTCAAAATAATAATTTA
ATTTATTTAAATAAATCAATTTTTTTTTATATAATCCATTTAAATTTCTT
ATTTATAAAAATTTTAAATGATTAAGCGAGGATTTTTACGATCAAATGAA
GGAGTATTTACCTTATCACCTAAAATTACAATCATTGGTCGTGAATCTTG
TGATTTTACAATACAAAATTTAACTGTAGATAATCAACAAGCAGTTATTG
AATATGTTGAAAATGAAGAGTATTTTGTTTTAAAAGATTTAAATTCAACA
CATGGTAGCTATGTAAACGATTGTCGAATTCAAAACGCCACTGTAAGACT
CAATGATGGTGATATTCTTAAGTTTGGATTCAGTGTTGGCCAATATGAAT
TTCATACTGAAAATGTTGAAATCATTGATTCAGAAAATAATATTCCATTG
ACATCTCCATATATGACTACACAGCCTATTCAAAAATCAGGTTGGCAAAT
AAACCCGAAATCCTTTCCTCAACAAAGCTCTAGTAATCAAATTACATCAT
TTCCAACTATCAATTATTCACAACCCCAAGCCTTTCAACATCGACACACG
GTTAATGATCCTGGAATGGTTAGTTGGACTCATTTACCGAAAGCGCCTTC
TTCTCTTCGATCAGCCAGACCATTAAGTGCTAGTTCACAAAATCGCCGAC
AATTGACACCCAGTGCTCCTCCTTTAGTTCCACCGAATCCAGTTTTTCAC
AGAAGAGGATCTATATCCGGTCCGTCTAAGCAGTTTTTACCTGATAACAA
ATATCAGCAAAATGACGATCAGAAGCTTATCCAACTACAAATGGAAATAG
ATAGATTGAGACCTTTAGAAAATGATATTATTGAAAAATCGTATGAAATT
GAAAGTCTCATTCAACAGATCAATGATCCCAACAATGCAAACTTACATCA
TCAAATTAGAAACCTTTCTGATGAATTGTCTAATAAAACAAATGAAATTG
AAAAGCTGCACAGTCTCCTTGGGAAATTGGCAGAAAATTCGAACCGACAC
AATTCTAATTCATCAAATAACGAGTCGAGCACCAATCAGATCTCTCAACA
GCTGGAAGTCACTCGGAAAGATCTGAGAATTAGTAATGGACTAGTGACGA
CACTGCAGAAAGATTTGAGTAATCATGACGAAACCATCAAAAAGCTCACG
AGAGATAATCAGAGATTGACTGAAGAATTATCAGAAAAAAATATTTCCAT
TTCAGTTTTAACAAATAAACTATCTCGTTTGAAAGACATTCAAGAAGAAG
AAACAGAAAAACAAGATAGAGAAAGAGAAGTTGTTGGCTTGCGACACAAA
CTGACAGCTGCCGAATCAAAAGTACTCGAATTTTCGGAAACGATTGAAAC
TTTAAATACGAATTTGGAAAAATATCAACAGACTGACAAAATTAATTCAG
ATGCTCTTCGAGATTTAAATAAGCAGTTCGATGAAGCTAAAGCTTTAATT
ACTGATCTTCAGAGGTCAGAAAGTTTATTACGCGTCGATGCGCAAGAGTC
TGAGAAAAAATATGACAGATTTTGGACAAGAGTTTTACAAATAGTTCTTT
CAACTCCCGGATTCAAATCTTCTGATCATGCTTTGAAAGAAGACGAAGTG
ATTGATGTATTGAAAGAATTAGCAAAAAGCAAAATTGAACATGATCGAAG
AATTTGTGATAAACAAAAGTTAATTGACGAAGCCAACAAAAAGTATTGGC
AATTTATTGAAGATCTCGATAAATTCAAGACCAAATTAAAAGAATATTTT
GATATGTTAAGTTCTGGTGAGAGAACATCCAATAGAGTCAATGAAATATT
AGCCTTGTCCATTTTGATCAAAGTTCCTGACGAAATTGTTCCACTAAAAG
ATGTTATAAATCAAAATTTGAGGAGTGAAATTGAATTTCTTTCTGGTTTA
GAATTGTGTATTTCTGGTGTTGGTTCTGAATTAGCAAGTTTAAGTCTTTC
TGATTGCTTCAAAAAAATTATCCAACGATCTATAGATGCTGTGGAAAGTA
AAGTCTTAGCTGAAGATAGATTATCTCAAACTGTTGAAAGTTATGAAGAA
AAGATGAAGCGAGTAAAACAAGCATTAAAGGATGATTTAGAATTCCACAA
TAAACAAGCATTAGATAAGGAAAGAACGGAGTTTGATATAAAACTCCGGG
CGAAAATGGATGAATTACAAGAAGAAAAGGACAGTATTCTCCAGAATTTG
ACTAGAGAATTCGAAAATAAAATTATTGAATACGAAGAAAATATTGAGAA
TTTAAAAGAAACTTTAAACGAAAAAGATAAAACATTCCAAGTTCAAATTG
ATAGTCTAACCAATCAATTGAAAACTTCTGAAGATCTAAAGAAGCGAATT
GATGAATTAGAAAAGGAATTAGAAAAAGTTACTGAAGAGAAATTGGTCCT
CGAACAGAGTCTTTGTGAACAGTTTGATACAATCAACCTGAAATGGAAAG
CCGAAATCGATTTGTATAAAGAGGAAACTGTCCAGCACGCAATTACAATT
GATTCGTTAAACAATCGAATGACAAAGTTAAATAAAGAAAATACCGATTT
AAAAAATAAACTTGCAAAATCAAAGAGTGATACAAAAAAAGTAAAAGTGA
ATGAAGTAGTAATTAAAAATGAAGGTGAAGAAAAAGAAAAAATCCAAGAA
AATGAGAAAGCCATTAATTACGCTACAATTGCTAATTTGGAAAAATGTAT
TGCAGCCTTACGGCATGAAAATGTGTGCTTAAAAAACCGTGTTAATGAAT
ATGAAGGAGCAATGAAGGGTTTGAACATGGATCTGGCCGGTGCTGAAGCT
CGTTTATCTGATTTGAAAGGCGAGCTGAGTGAAAGTCAGAAAAATGAAAT
TGATAACCTCAAAATTGAAATAAAAAATCTGGAAGACGAAACAACGGATC
TTCGAGTTCAGTTGGCTAAATTGTCAGGAATCGTAGATCGACTTAAACAA
GAATTAGACGATAAAAAAAGGGAAAATGATAATTTAAATCAGCATTTAAT
GGAAGCTAACCAGTTGATTCAAGAGAAAGATTCAAAAATCAACGATGTAG
AGATCCAAATGAAAAATGAACAAGATAAACTCATTCAAAATCTCAATAAA
ATTGAACAGGAAGGACGAATTGTTAATGAGCTAGCAGTTATAGGGGCTCA
ATGTAGAGGGGAAAGGCATCAACAGATTATTGAATCACAAAAATCAGCAC
TAATAGAAATGAGGAAAAAAATGAAAAATATGGAAATAACAAATGTTTCA
AATAGTAATGTGCCGGAAATTTCACAGCAGATGCTGGAAATGAAAAGAGA
ACTGGCTATGCTGAGATCAAAAAAGGCGATGCGGGACAGTGCTCCTCAAG
GAATGAGCAGTCTGTCAGAAGTGATAGCAAATAAAGAAAGAACTAAAAGA
GCTGTGCTTGCATTACCAGAAAGTGAAAAGAAACCAGCGGATGAACAGTC
TATGAAATTAGATTTCCATGAAATGGAAAAGACAATCGAACAGTTGCAAT
TTGACCTCGATATGGAGAAATCAAAAGTAGAAGATAAACAGCAAAGTCTT
GATTATTCTGAGAAAACCTACCTAAGTTTGCTTCGACAATTGGGCTCAAT
TTTGGAAATGGATAGCATCAAAGGTCTTCGTCATTTCGCAAATCTTTCAT
ATGAAGACAAAGAAGCCTTGAAATTAGATAGAGAAGAAATTTGCGGATTG
TTATTACAAAAAATTAGAATTCTTAAAGAACGAATTCAAAGAAAAGAAGA
ATTACTTCTAGGTTATGAGCAAGACCTTGTAAAATTGAAACAAGCTGAGG
ATCTTGCTGTAAAGACTCAGGGTCAATTAGAGAACATTTTCCAGCAAATG
CGGTACAAAGGTGAGGAAGTGGAATTGCTGCGAGAAACTCTCAATCGAAC
CAAAGATTTACTCAATGAAGAAAAGAGAACAAATACGGCAATTAAAAAGC
ATAAACATTATGTCCCAGACAAATCATTAGCGGAATCTCATGCCTCTCCA
ACAACTCCGAAATACCATTGTCCACCAGAAGATATTCTAATAAAGGAAAA
AATTATGGAGAAAAATAAATTAGATAAAACCAAACGGAAAGATTATGAAA
TAAAAAGTTTGAAATCGGAACTCTATAGAAAAGAAAAAGAATTGACTCAG
GCTACAAATCGTCTCTACACTTTGGAAACATCAATGGGTATCAAAAGCGA
AGAACCAGTTTCATAAATTTACTGCATTATAACTTCAGTAAAAGTGCTAT
TTTAGTCGATTGTGATTATTATTATTACTAATATATTCTTACTTTTATAT
TCATCTTTTTCACAATTATTAAAAAAATATGCTGTTACATGTCGATTATT
ATTTAAAAAATAGTAAATACTTC
back to top

protein sequence of SMED30025883-orf-1

>SMED30025883-orf-1 ID=SMED30025883-orf-1|Name=SMED30025883-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1383bp
MIKRGFLRSNEGVFTLSPKITIIGRESCDFTIQNLTVDNQQAVIEYVENE
EYFVLKDLNSTHGSYVNDCRIQNATVRLNDGDILKFGFSVGQYEFHTENV
EIIDSENNIPLTSPYMTTQPIQKSGWQINPKSFPQQSSSNQITSFPTINY
SQPQAFQHRHTVNDPGMVSWTHLPKAPSSLRSARPLSASSQNRRQLTPSA
PPLVPPNPVFHRRGSISGPSKQFLPDNKYQQNDDQKLIQLQMEIDRLRPL
ENDIIEKSYEIESLIQQINDPNNANLHHQIRNLSDELSNKTNEIEKLHSL
LGKLAENSNRHNSNSSNNESSTNQISQQLEVTRKDLRISNGLVTTLQKDL
SNHDETIKKLTRDNQRLTEELSEKNISISVLTNKLSRLKDIQEEETEKQD
REREVVGLRHKLTAAESKVLEFSETIETLNTNLEKYQQTDKINSDALRDL
NKQFDEAKALITDLQRSESLLRVDAQESEKKYDRFWTRVLQIVLSTPGFK
SSDHALKEDEVIDVLKELAKSKIEHDRRICDKQKLIDEANKKYWQFIEDL
DKFKTKLKEYFDMLSSGERTSNRVNEILALSILIKVPDEIVPLKDVINQN
LRSEIEFLSGLELCISGVGSELASLSLSDCFKKIIQRSIDAVESKVLAED
RLSQTVESYEEKMKRVKQALKDDLEFHNKQALDKERTEFDIKLRAKMDEL
QEEKDSILQNLTREFENKIIEYEENIENLKETLNEKDKTFQVQIDSLTNQ
LKTSEDLKKRIDELEKELEKVTEEKLVLEQSLCEQFDTINLKWKAEIDLY
KEETVQHAITIDSLNNRMTKLNKENTDLKNKLAKSKSDTKKVKVNEVVIK
NEGEEKEKIQENEKAINYATIANLEKCIAALRHENVCLKNRVNEYEGAMK
GLNMDLAGAEARLSDLKGELSESQKNEIDNLKIEIKNLEDETTDLRVQLA
KLSGIVDRLKQELDDKKRENDNLNQHLMEANQLIQEKDSKINDVEIQMKN
EQDKLIQNLNKIEQEGRIVNELAVIGAQCRGERHQQIIESQKSALIEMRK
KMKNMEITNVSNSNVPEISQQMLEMKRELAMLRSKKAMRDSAPQGMSSLS
EVIANKERTKRAVLALPESEKKPADEQSMKLDFHEMEKTIEQLQFDLDME
KSKVEDKQQSLDYSEKTYLSLLRQLGSILEMDSIKGLRHFANLSYEDKEA
LKLDREEICGLLLQKIRILKERIQRKEELLLGYEQDLVKLKQAEDLAVKT
QGQLENIFQQMRYKGEEVELLRETLNRTKDLLNEEKRTNTAIKKHKHYVP
DKSLAESHASPTTPKYHCPPEDILIKEKIMEKNKLDKTKRKDYEIKSLKS
ELYRKEKELTQATNRLYTLETSMGIKSEEPVS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002063non-ciliated epidermis
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000253FHA_dom
IPR008984SMAD_FHA_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 871..1015
NoneNo IPR availableCOILSCoilCoilcoord: 350..384
NoneNo IPR availableCOILSCoilCoilcoord: 697..739
NoneNo IPR availableCOILSCoilCoilcoord: 536..556
NoneNo IPR availableCOILSCoilCoilcoord: 1268..1288
NoneNo IPR availableCOILSCoilCoilcoord: 649..687
NoneNo IPR availableCOILSCoilCoilcoord: 1345..1365
NoneNo IPR availableCOILSCoilCoilcoord: 391..411
NoneNo IPR availableCOILSCoilCoilcoord: 447..467
NoneNo IPR availableCOILSCoilCoilcoord: 744..781
NoneNo IPR availableCOILSCoilCoilcoord: 273..300
NoneNo IPR availableCOILSCoilCoilcoord: 1038..1058
NoneNo IPR availableCOILSCoilCoilcoord: 1216..1260
NoneNo IPR availableCOILSCoilCoilcoord: 811..838
NoneNo IPR availableGENE3DG3DSA:2.60.200.20coord: 6..110
e-value: 7.5E-20
score: 72.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 182..198
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 178..205
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 306..325
NoneNo IPR availablePANTHERPTHR18853:SF7FORKHEAD-ASSOCIATED DOMAIN-CONTAINING PROTEIN 1coord: 4..739
NoneNo IPR availablePANTHERPTHR18853FORKHEAD-ASSOCIATED DOMAIN-CONTAINING PROTEIN 1-RELATEDcoord: 4..739
NoneNo IPR availablePANTHERPTHR18853:SF7FORKHEAD-ASSOCIATED DOMAIN-CONTAINING PROTEIN 1coord: 751..1339
NoneNo IPR availablePANTHERPTHR18853FORKHEAD-ASSOCIATED DOMAIN-CONTAINING PROTEIN 1-RELATEDcoord: 751..1339
IPR000253Forkhead-associated (FHA) domainSMARTSM00240FHA_2coord: 20..71
e-value: 7.2E-5
score: 32.2
IPR000253Forkhead-associated (FHA) domainPFAMPF00498FHAcoord: 22..87
e-value: 2.0E-14
score: 53.7
IPR000253Forkhead-associated (FHA) domainPROSITEPS50006FHA_DOMAINcoord: 21..71
score: 9.748
IPR000253Forkhead-associated (FHA) domainCDDcd00060FHAcoord: 13..87
e-value: 7.03617E-15
score: 69.7226
IPR008984SMAD/FHA domain superfamilySUPERFAMILYSSF49879SMAD/FHA domaincoord: 13..105