Protein FAM13A

Overview
NameProtein FAM13A
Smed IDSMED30025882
Length (bp)2945
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein FAM13A (SMED30025882) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein FAM13A (SMED30025882) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein FAM13A (SMED30025882) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein FAM13A (SMED30025882) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025882

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30025882h1SMcG0009485 SmedASXL_014941SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30025882h1SMcG0009485 dd_Smed_v4_12046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025882h1SMcG0009485 dd_Smed_v4_12046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025882h1SMcG0009485 dd_Smed_v4_12046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30025882h1SMcG0009485 dd_Smed_v4_12046_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30025882h1SMcG0009485 dd_Smed_v6_12046_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025882h1SMcG0009485 dd_Smed_v4_12046_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein FAM13A vs. Ensembl Human
Match: FAM13A (family with sequence similarity 13 member A [Source:HGNC Symbol;Acc:HGNC:19367])

HSP 1 Score: 105.916 bits (263), Expect = 1.098e-22
Identity = 110/412 (26.70%), Postives = 180/412 (43.69%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNN---ILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L+     ++N    I  P+  + +      ++G   S  F    +         +NV     DF    V++   K D + R      Q               I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+ F R+  R V K DR PM  EY+ YK IK++++ LE L 
Sbjct:  326 AQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELVDKAIKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILS-----RANTIPIIGSPSSKRRSPLLQPIIEGETAS--FFKEIKEEEEGSEDDSNV---KPDFM---VTL---KTDFSARC--FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLI 673          
BLAST of Protein FAM13A vs. Ensembl Human
Match: FAM13A (family with sequence similarity 13 member A [Source:HGNC Symbol;Acc:HGNC:19367])

HSP 1 Score: 105.916 bits (263), Expect = 1.149e-22
Identity = 110/412 (26.70%), Postives = 180/412 (43.69%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNN---ILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L+     ++N    I  P+  + +      ++G   S  F    +         +NV     DF    V++   K D + R      Q               I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+ F R+  R V K DR PM  EY+ YK IK++++ LE L 
Sbjct:  312 AQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELVDKAIKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILS-----RANTIPIIGSPSSKRRSPLLQPIIEGETAS--FFKEIKEEEEGSEDDSNV---KPDFM---VTL---KTDFSARC--FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLI 659          
BLAST of Protein FAM13A vs. Ensembl Human
Match: FAM13A (family with sequence similarity 13 member A [Source:HGNC Symbol;Acc:HGNC:19367])

HSP 1 Score: 105.916 bits (263), Expect = 1.233e-22
Identity = 110/412 (26.70%), Postives = 180/412 (43.69%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNN---ILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L+     ++N    I  P+  + +      ++G   S  F    +         +NV     DF    V++   K D + R      Q               I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+ F R+  R V K DR PM  EY+ YK IK++++ LE L 
Sbjct:  340 AQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELVDKAIKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILS-----RANTIPIIGSPSSKRRSPLLQPIIEGETAS--FFKEIKEEEEGSEDDSNV---KPDFM---VTL---KTDFSARC--FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLI 687          
BLAST of Protein FAM13A vs. Ensembl Human
Match: FAM13A (family with sequence similarity 13 member A [Source:HGNC Symbol;Acc:HGNC:19367])

HSP 1 Score: 105.145 bits (261), Expect = 1.248e-22
Identity = 110/412 (26.70%), Postives = 180/412 (43.69%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNIL---KPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L+     ++N I     P+  + +      ++G   S  F    +         +NV     DF    V++   K D + R      Q               I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+ F R+  R V K DR PM  EY+ YK IK++++ LE L 
Sbjct:  252 AQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELVDKAIKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILS-----RANTIPIIGSPSSKRRSPLLQPIIEGETAS--FFKEIKEEEEGSEDDSNV---KPDFM---VTL---KTDFSARC--FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLI 599          
BLAST of Protein FAM13A vs. Ensembl Human
Match: FAM13A (family with sequence similarity 13 member A [Source:HGNC Symbol;Acc:HGNC:19367])

HSP 1 Score: 105.145 bits (261), Expect = 2.636e-22
Identity = 110/412 (26.70%), Postives = 180/412 (43.69%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNN---ILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L+     ++N    I  P+  + +      ++G   S  F    +         +NV     DF    V++   K D + R      Q               I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+ F R+  R V K DR PM  EY+ YK IK++++ LE L 
Sbjct:  666 AQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELVDKAIKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILS-----RANTIPIIGSPSSKRRSPLLQPIIEGETAS--FFKEIKEEEEGSEDDSNV---KPDFM---VTL---KTDFSARC--FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLI 1013          

HSP 2 Score: 91.2781 bits (225), Expect = 5.088e-18
Identity = 56/176 (31.82%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKV 704
            IP +++    ++  +GL  +G+FRV+GN   +++++L +     VE+  + D+ +   L KLFLRE+P  LI  +     I+  +  +       +   + +LP  HY LLK+ C  LT V K    N MN  NL TVFGP  F     +E      + N   + +++NYN LF+V
Sbjct:   58 IPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFHVPPGLEGMKEQDLCNKIMAKILENYNTLFEV 233          
BLAST of Protein FAM13A vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 77.0258 bits (188), Expect = 7.660e-15
Identity = 56/152 (36.84%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQ---KKLVEISFEDIHNITGLYKLFLREVPGGLIP------YSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF 617
            +P  I +    I + GL   GI+RVSGN + + +I+    Q   K LV  S EDIH +TG  KLF RE+   L P      Y+ A+ +  AT   KK E L      L +LP  +   LK     L  V      N M   NL  VFGPT F
Sbjct:  107 VPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALV--SEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEEL------LSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 250          
BLAST of Protein FAM13A vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 78.1814 bits (191), Expect = 2.071e-14
Identity = 56/152 (36.84%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQ---KKLVEISFEDIHNITGLYKLFLREVPGGLIP------YSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF 617
            +P  I +    I + GL   GI+RVSGN + + +I+    Q   K LV  S EDIH +TG  KLF RE+   L P      Y+ A+ +  AT   KK E L      L +LP  +   LK     L  V      N M   NL  VFGPT F
Sbjct:  624 VPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALV--SEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEEL------LSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 767          
BLAST of Protein FAM13A vs. Ensembl Celegans
Match: tag-325 (WW domain-containing protein tag-325 [Source:UniProtKB/Swiss-Prot;Acc:P46941])

HSP 1 Score: 78.1814 bits (191), Expect = 2.128e-14
Identity = 56/152 (36.84%), Postives = 71/152 (46.71%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQ---KKLVEISFEDIHNITGLYKLFLREVPGGLIP------YSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF 617
            +P  I +    I + GL   GI+RVSGN + + +I+    Q   K LV  S EDIH +TG  KLF RE+   L P      Y+ A+ +  AT   KK E L      L +LP  +   LK     L  V      N M   NL  VFGPT F
Sbjct:  626 VPKFIRVITEVIESKGLETDGIYRVSGNLSAVQKIRCQADQDNYKALV--SEEDIHVLTGALKLFFRELTDPLFPISLHKEYTSAMQMPNATTRFKKFEEL------LSRLPNENRETLKMLLRHLNRVASHSSQNRMQQHNLAIVFGPTLF 769          
BLAST of Protein FAM13A vs. Ensembl Celegans
Match: chin-1 (CHImaeriN (Rac-GTPase-activating protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q965N4])

HSP 1 Score: 70.8626 bits (172), Expect = 1.597e-12
Identity = 50/166 (30.12%), Postives = 84/166 (50.60%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEIS-FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKA---TKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS 623
            ++G D+  L  +++  ++P ++ +    + + GL V+GI+RVSG+   M+++K  +   + V+++   DIH + GL KL+ R +P  LIP+S    L+ A   T      E    I   +++L   +   L    A L  V      N M  ENL T+F PT F S
Sbjct:  231 MFGVDITTLC-MAHGADLPPIVPLCIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDSNQYVDLATVCDIHTVCGLLKLYFRLLPQQLIPFSVHKQLLVAYQETNQRSTHERERQIRKVMMELSDANIITLGAVLAHLKKVADHSAKNKMTVENLATIFSPTLFCS 395          
BLAST of Protein FAM13A vs. Ensembl Celegans
Match: pac-1 (GTPase-activating protein pac-1 [Source:UniProtKB/Swiss-Prot;Acc:P34288])

HSP 1 Score: 67.3958 bits (163), Expect = 5.255e-11
Identity = 41/158 (25.95%), Postives = 74/158 (46.84%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIK----------LNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIED 632
            +P ++      I  YG+   GI+R+ GN   ++ +K          ++  + + ++  + D++ ++ L K+FLR++P  L+        I A +I      L  +   L KLP PHY+ L+F    L+ + K    N M   NL  +FGP+     +D
Sbjct:  600 VPMIVQACVCVIETYGMDTVGIYRIPGNTAAVNALKESLSNRGFDSVDLSKVESLDPRWRDVNVVSSLLKMFLRKLPEPLLTDKLYPFFIDANRISTHHNRLHKLRNLLRKLPRPHYDTLRFLIVHLSEITKHSDVNKMECRNLALMFGPSIVRPSDD 757          
BLAST of Protein FAM13A vs. Ensembl Fly
Match: RhoGAP5A (gene:FBgn0029778 transcript:FBtr0070785)

HSP 1 Score: 82.4185 bits (202), Expect = 6.220e-16
Identity = 52/194 (26.80%), Postives = 93/194 (47.94%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKK----LVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELFKVS 707
            V+G DL  ++++    +IP ++      +   G+L +GI+RVSG    ++ +KL   ++     + E ++ +++ I G  KL+LR +P  LI +      + A +  K+ E    +   + +LP  H++ L++    L  V      N MN  NL TVF PT   + +  + LT      S LI +   +F  S
Sbjct:  301 VFGTDLTTMVQLEPHHQIPFVVRRCVEEVEARGMLQEGIYRVSGFADEIEALKLALDREGEKTDMSETAYGNVNVIAGTLKLYLRLLPVPLITFQAYPSFMAAGRTGKQAEQRQLMAEAVRRLPPAHHSCLQYMLEHLKRVASHYAVNKMNEHNLATVFAPTLIATPQHMTNLTEEIFMLSSLITHCKTIFATS 494          
BLAST of Protein FAM13A vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300967)

HSP 1 Score: 73.9442 bits (180), Expect = 6.854e-13
Identity = 48/189 (25.40%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  171 ISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISF----EDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIH--KKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS-------IEDFSLLTIANTTTSILIQNYNELF 698
            ++  ++IP ++     FI NYG+ + GI+R+SG  + +  ++  + ++++ ++      +DIH ++ L K++ RE+P  L  Y    + ++A ++   +  E L  +   +LKLP PHY  LK+    L  V +  G   M  +NL  V+ P    S       +     + +    T  LI+N + +F
Sbjct:  431 LNSGQDIPMVLRSCAEFIENYGV-IDGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of Protein FAM13A vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0300966)

HSP 1 Score: 73.9442 bits (180), Expect = 7.718e-13
Identity = 48/189 (25.40%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  171 ISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISF----EDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIH--KKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS-------IEDFSLLTIANTTTSILIQNYNELF 698
            ++  ++IP ++     FI NYG+ + GI+R+SG  + +  ++  + ++++ ++      +DIH ++ L K++ RE+P  L  Y    + ++A ++   +  E L  +   +LKLP PHY  LK+    L  V +  G   M  +NL  V+ P    S       +     + +    T  LI+N + +F
Sbjct:  431 LNSGQDIPMVLRSCAEFIENYGV-IDGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of Protein FAM13A vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0332179)

HSP 1 Score: 73.9442 bits (180), Expect = 7.719e-13
Identity = 48/189 (25.40%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  171 ISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISF----EDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIH--KKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS-------IEDFSLLTIANTTTSILIQNYNELF 698
            ++  ++IP ++     FI NYG+ + GI+R+SG  + +  ++  + ++++ ++      +DIH ++ L K++ RE+P  L  Y    + ++A ++   +  E L  +   +LKLP PHY  LK+    L  V +  G   M  +NL  V+ P    S       +     + +    T  LI+N + +F
Sbjct:  431 LNSGQDIPMVLRSCAEFIENYGV-IDGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of Protein FAM13A vs. Ensembl Fly
Match: CdGAPr (gene:FBgn0032821 transcript:FBtr0081318)

HSP 1 Score: 73.9442 bits (180), Expect = 7.719e-13
Identity = 48/189 (25.40%), Postives = 93/189 (49.21%), Query Frame = 3
Query:  171 ISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISF----EDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIH--KKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS-------IEDFSLLTIANTTTSILIQNYNELF 698
            ++  ++IP ++     FI NYG+ + GI+R+SG  + +  ++  + ++++ ++      +DIH ++ L K++ RE+P  L  Y    + ++A ++   +  E L  +   +LKLP PHY  LK+    L  V +  G   M  +NL  V+ P    S       +     + +    T  LI+N + +F
Sbjct:  431 LNSGQDIPMVLRSCAEFIENYGV-IDGIYRLSGITSNIQRLRRAFDEERVPDLGNPEMKQDIHAVSSLLKMYFRELPNPLCTYQLYDNFVEAIQVKADEADERLRLMKETVLKLPPPHYRTLKYLAEHLYKVSQHHGRTGMTDKNLAIVWAPNLLRSPALESGGVAALRGVGVQAVVTEYLIRNCHNIF 618          
BLAST of Protein FAM13A vs. Ensembl Zebrafish
Match: fam13a (family with sequence similarity 13 member A [Source:ZFIN;Acc:ZDB-GENE-050208-102])

HSP 1 Score: 98.2117 bits (243), Expect = 6.516e-21
Identity = 106/428 (24.77%), Postives = 188/428 (43.93%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDI-DHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLN---STAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQE---------KKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKN-SLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFENSQS 2822
            ++L K+I +LK ++R++E+ ++     +P    K GN    + + ++  L++D+ DH      K   +E D                       +TP+  +                        RSNTL     + +     E  +P+    ++ TL+ +++ L+E+R    RPED+  MT +Q+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L +            K+ + +L+P +             G+P+  F    +  + S    T   F        +V++ P    +    Q         +++ F      +S   N     L N   + + +L  E Q+  ++KK +++ L++FE+ F ++  R V K DR P+  EY  YK IK++++ LE L     S
Sbjct:  124 AQLSKRIHVLKKKIRRYEEKFEEERKYRPSHGDKAGNPEVLRWMNELTRLRKDLKDH------KLLKSEED-----------------------LTPIPRQ------------------------RSNTLPKSFGSQLEKKTPETKAPKP--PVESTLETVTNKLQEKRKEAGRPEDIKDMTREQIGAEKVAIQKALLYYESIHGRPITKNERQVMKPLYDRYRLVKQILCRASAIPVIGSPSSKRRSPLLQPIIE------------GVPALFFSDTKEEEDGSDDDDTRTQF--------TVTVKPELSMLGLLDQL------DEDADGFISPVDELSPSKNTTDMRLSNLHAATMQELVEELQEAREEKKRIRKNLREFEDQFFKQNGRNVQKEDRSPLAGEYNEYKHIKAKLRLLEVLISKQDS 470          
BLAST of Protein FAM13A vs. Ensembl Zebrafish
Match: fam13b (family with sequence similarity 13 member B [Source:ZFIN;Acc:ZDB-GENE-030131-4913])

HSP 1 Score: 95.1301 bits (235), Expect = 2.125e-19
Identity = 108/436 (24.77%), Postives = 188/436 (43.12%), Query Frame = 3
Query: 1569 ENYLSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVS-------VLSETAARVGTNNESARSNTLN---STAINSSIIED---LSPREYEKLKI-TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQL---------AQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            +N   +L KK+  LK +++QF++ ++     KP    K  +    K + D+  +++ +    +   K          S + + +  S   +    +S  P      +SRP++            A    T     RSNTL     + ++ S  ED   +  R +   +  TL+ I   ++ +R  D  PED+  MT +Q+ SEK  +QK LL +E  +GR        +++PLYDRYRLVK+ L         A    K+ N +L+P            ++G   + +FC   +                    +E+V +     DI     ++ S  +    NI        S  +N +      + S++ +L  +  K   +KK+L+R +++FE+ F ++  R V K DRLPM  EY  YK IK++++ LE L 
Sbjct:  557 DNVSQQLTKKLQNLKKKIKQFDEQFEKERNYKPSHADKAADPKVLKWMTDLTKIRKQLKGRHHLLPKG---------SLRHQAVLQS--YRCHSSSSSVPNTPHITLSRPLASRQSPHFYAKHKAESELTPQTRPRSNTLPKSFGSTLDQSAYEDTVEIEARGHRPTREETLELIQQCIQSKRDEDGWPEDVRKMTKEQLASEKTVLQKNLLYYEGLHGRPVTREERLIVKPLYDRYRLVKQMLTRVSITPIIASPSSKRRNQMLQP-----------IIEGE--TAHFCGEIEEEEED----------EGRGQQENVEMQSECSDIIMDPVAQPSSQHPTQENILS------SGKLNLDLRLSSTNASSMPELLEQLWKARAEKKKLRRTIREFEDEFYQQNGRNVQKEDRLPMMDEYKEYKRIKAKLRLLEVLI 952          

HSP 2 Score: 68.1662 bits (165), Expect = 3.905e-11
Identity = 54/213 (25.35%), Postives = 99/213 (46.48%), Query Frame = 3
Query:  186 EIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE---DIHNITGLYKLFLREVPGGLIPY---SQAIDLIKATKIHKK-TENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKC 803
            E+P L+     +I  +G L   +F V+GN  R++ ++  Y     VE++ E   D+ +   L +LFL+E+P  +IP    +Q + L +   I ++   N+ +    L +LP  +Y+LL+F C  L+ V      +  +   L  VFGP  F    D   L    + + IL +      +       +++ +NDY++ ND +  +     +  C
Sbjct:   35 EVPLLVRSIVEYIEEHGGLHLSLFLVNGNAERVEWLRQRY--DSGVEVNLEKEADLASAVSLLRLFLQELPEPIIPAGLQAQIMQLYQDYSIEEELGRNMKYF---LQQLPQVNYSLLRFLCRFLSGVASLQEES-WSLGALAAVFGPDIFHLDTDVEDLKEQESVSRILAELLENQEEFFESEDEDISNTNDYSSINDQITELLEEEKLDAC 241          
BLAST of Protein FAM13A vs. Ensembl Zebrafish
Match: fam13b (family with sequence similarity 13 member B [Source:ZFIN;Acc:ZDB-GENE-030131-4913])

HSP 1 Score: 93.5893 bits (231), Expect = 7.171e-19
Identity = 76/266 (28.57%), Postives = 124/266 (46.62%), Query Frame = 3
Query: 2037 TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQL---------AQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            TL+ I   ++ +R  D  PED+  MT +Q+ SEK  +QK LL +E  +GR        +++PLYDRYRLVK+ L         A    K+ N +L+P            ++G   + +FC   +                    +E+V +     DI     ++ S  +    NI        S  +N +      + S++ +L  +  K   +KK+L+R +++FE+ F ++  R V K DRLPM  EY  YK IK++++ LE L 
Sbjct:  645 TLELIQQCIQSKRDEDGWPEDVRKMTKEQLASEKTVLQKNLLYYEGLHGRPVTREERLIVKPLYDRYRLVKQMLTRVSITPIIASPSSKRRNQMLQP-----------IIEG--ETAHFCGEIEEEEED----------EGRGQQENVEMQSECSDIIMDPVAQPSSQHPTQENILS------SGKLNLDLRLSSTNASSMPELLEQLWKARAEKKKLRRTIREFEDEFYQQNGRNVQKEDRLPMMDEYKEYKRIKAKLRLLEVLI 881          

HSP 2 Score: 69.3218 bits (168), Expect = 2.081e-11
Identity = 54/213 (25.35%), Postives = 99/213 (46.48%), Query Frame = 3
Query:  186 EIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE---DIHNITGLYKLFLREVPGGLIPY---SQAIDLIKATKIHKK-TENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKC 803
            E+P L+     +I  +G L   +F V+GN  R++ ++  Y     VE++ E   D+ +   L +LFL+E+P  +IP    +Q + L +   I ++   N+ +    L +LP  +Y+LL+F C  L+ V      +  +   L  VFGP  F    D   L    + + IL +      +       +++ +NDY++ ND +  +     +  C
Sbjct:   35 EVPLLVRSIVEYIEEHGGLHLSLFLVNGNAERVEWLRQRY--DSGVEVNLEKEADLASAVSLLRLFLQELPEPIIPAGLQAQIMQLYQDYSIEEELGRNMKYF---LQQLPQVNYSLLRFLCRFLSGVASLQEES-WSLGALAAVFGPDIFHLDTDVEDLKEQESVSRILAELLENQEEFFESEDEDISNTNDYSSINDQITELLEEEKLDAC 241          
BLAST of Protein FAM13A vs. Ensembl Zebrafish
Match: arhgap24 (Rho GTPase activating protein 24 [Source:ZFIN;Acc:ZDB-GENE-091118-20])

HSP 1 Score: 91.2781 bits (225), Expect = 2.267e-18
Identity = 65/202 (32.18%), Postives = 107/202 (52.97%), Query Frame = 3
Query:  138 VYGKDLK--LLLEISYS-KEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE---DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTE--NLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFT-SIEDFSLLTIANTTT------SILIQNYNELF 698
            ++G+ L+  +  E  Y  K  P L+     FIRN+GL  +G+FR+ G    + E++  +   +  + SF+   D+H +  L KL+LRE+P  +IP+S+  + +  TK+  K +   +  +  ++  LPV +YNLLK+ C  L  V    G N M+ +NL TVFGP      +ED   +TI   T       ++LI  ++ LF
Sbjct:   46 IFGQKLEETVRYERRYGNKMAPMLVEQCVDFIRNWGLREEGLFRLPGQANLVKELQDAFDCGE--KPSFDCNTDVHTVASLLKLYLRELPEPVIPFSKYEEFLACTKLLSKDQEAGMKELRRQVEALPVVNYNLLKYICKFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVED--PVTIMEGTVLVQQLMAVLIGQHDVLF 243          
BLAST of Protein FAM13A vs. Ensembl Zebrafish
Match: arhgap24 (Rho GTPase activating protein 24 [Source:ZFIN;Acc:ZDB-GENE-091118-20])

HSP 1 Score: 91.2781 bits (225), Expect = 2.570e-18
Identity = 65/202 (32.18%), Postives = 107/202 (52.97%), Query Frame = 3
Query:  138 VYGKDLK--LLLEISYS-KEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE---DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTE--NLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFT-SIEDFSLLTIANTTT------SILIQNYNELF 698
            ++G+ L+  +  E  Y  K  P L+     FIRN+GL  +G+FR+ G    + E++  +   +  + SF+   D+H +  L KL+LRE+P  +IP+S+  + +  TK+  K +   +  +  ++  LPV +YNLLK+ C  L  V    G N M+ +NL TVFGP      +ED   +TI   T       ++LI  ++ LF
Sbjct:   65 IFGQKLEETVRYERRYGNKMAPMLVEQCVDFIRNWGLREEGLFRLPGQANLVKELQDAFDCGE--KPSFDCNTDVHTVASLLKLYLRELPEPVIPFSKYEEFLACTKLLSKDQEAGMKELRRQVEALPVVNYNLLKYICKFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVED--PVTIMEGTVLVQQLMAVLIGQHDVLF 262          
BLAST of Protein FAM13A vs. Ensembl Xenopus
Match: FAM13A (family with sequence similarity 13 member A [Source:NCBI gene;Acc:100488957])

HSP 1 Score: 102.449 bits (254), Expect = 1.824e-21
Identity = 66/196 (33.67%), Postives = 104/196 (53.06%), Query Frame = 3
Query:  138 VYGKDLK-LLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKVSA 710
            V+G  LK L +    ++ IP L++    ++R  G+  +G+FRV+GN   ++++KL Y   +   +  E D+H+   L KLFLRE+P G+I  +     I+  + +  T+    +   L +LP  HY+LLK+ C  LT V + CG N MN  NL TVFGP+ F      E      I N     L+++Y + F+  A
Sbjct:   64 VFGVQLKDLHMNGLVTEGIPTLVWNIVEYLRTIGMDQEGLFRVNGNVKMVEQLKLKYESGEQPILGEEMDVHSAASLLKLFLREMPDGVITTALLPKFIEGYQSND-TQRESSLKDLLKQLPDSHYSLLKYLCHFLTQVVEHCGENRMNVHNLATVFGPSCFHVSPGPECMMQQNICNKIMERLLEDYTKFFECEA 258          

HSP 2 Score: 85.8853 bits (211), Expect = 2.223e-16
Identity = 79/273 (28.94%), Postives = 129/273 (47.25%), Query Frame = 3
Query: 2028 LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQF---------QEKKSNNILKPNL--NQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEE--SVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++ T++ I   L+E+R   NRPED+  MT DQ+ +EKV++QKALL +E  +GR    N  Q+M+PLYDRYRL K+ L++            K+ + +L+P +    +++  ++  +G     N        N    +     F    F E+    + G   P ++    SK+SQ              G+ N  + +   L   L    + K   +K+L+D          FE+ F ++  R V K DR PM  +Y  YK +K++I+ LE L 
Sbjct:  704 MEATMEAIQKKLQEKRNEVNRPEDIKDMTRDQIAAEKVSLQKALLYYESIHGRPVTKNERQVMKPLYDRYRLFKQILSRANTIPVIGSPSSKRRSPLLQPIIEGETASFFKEEEEEGSEDDTN-------GNTDFTVTMKPGFSVRTFLEQLDDDADGFVSP-VDDNIPSKSSQD------------LGLGNLHSASIPELLEQLQEAREEKKRIRKVLRD----------FEDNFLKQNGRNVQKEDRNPMAEDYIEYKHVKAKIRLLEVLI 946          
BLAST of Protein FAM13A vs. Ensembl Xenopus
Match: FAM13A (family with sequence similarity 13 member A [Source:NCBI gene;Acc:100488957])

HSP 1 Score: 99.3673 bits (246), Expect = 9.452e-21
Identity = 90/291 (30.93%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 1953 RSNTL-NSTAINSSIIEDLSPREYEK-----LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            RSNTL  S        E+  P   EK     ++ T++ I   L+E+R   NRPED+  MT DQ+ +EKV++QKALL +E  +GR    N  Q+M+PLYDRYRL K+ L+     ++N I  P + +   + D         N   +++     SV        D++D        G   P ++    SK+SQ              G+ N  +          ++I +L  + Q+  ++KK ++++L+DFE+ F ++  R V K DR PM  +Y  YK +K++I+ LE L 
Sbjct:  419 RSNTLPKSFGSQLDREEEKKPETVEKPAKPSMEATMEAIQKKLQEKRNEVNRPEDIKDMTRDQIAAEKVSLQKALLYYESIHGRPVTKNERQVMKPLYDRYRLFKQILS-----RANTI--PVIEEEEGSEDDTN-----GNTDFTVTMKPGFSVRTFLEQLDDDAD--------GFVSP-VDDNIPSKSSQD------------LGLGNLHS----------ASIPELLEQLQEAREEKKRIRKVLRDFEDNFLKQNGRNVQKEDRNPMAEDYIEYKHVKAKIRLLEVLI 666          
BLAST of Protein FAM13A vs. Ensembl Xenopus
Match: FAM13A (family with sequence similarity 13 member A [Source:NCBI gene;Acc:100488957])

HSP 1 Score: 99.3673 bits (246), Expect = 1.020e-20
Identity = 90/291 (30.93%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 1953 RSNTL-NSTAINSSIIEDLSPREYEK-----LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            RSNTL  S        E+  P   EK     ++ T++ I   L+E+R   NRPED+  MT DQ+ +EKV++QKALL +E  +GR    N  Q+M+PLYDRYRL K+ L+     ++N I  P + +   + D         N   +++     SV        D++D        G   P ++    SK+SQ              G+ N  +          ++I +L  + Q+  ++KK ++++L+DFE+ F ++  R V K DR PM  +Y  YK +K++I+ LE L 
Sbjct:  369 RSNTLPKSFGSQLDREEEKKPETVEKPAKPSMEATMEAIQKKLQEKRNEVNRPEDIKDMTRDQIAAEKVSLQKALLYYESIHGRPVTKNERQVMKPLYDRYRLFKQILS-----RANTI--PVIEEEEGSEDDTN-----GNTDFTVTMKPGFSVRTFLEQLDDDAD--------GFVSP-VDDNIPSKSSQD------------LGLGNLHS----------ASIPELLEQLQEAREEKKRIRKVLRDFEDNFLKQNGRNVQKEDRNPMAEDYIEYKHVKAKIRLLEVLI 616          
BLAST of Protein FAM13A vs. Ensembl Xenopus
Match: FAM13A (family with sequence similarity 13 member A [Source:NCBI gene;Acc:100488957])

HSP 1 Score: 99.3673 bits (246), Expect = 1.025e-20
Identity = 110/413 (26.63%), Postives = 184/413 (44.55%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGN----EWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L +KI  LK ++R+FED ++ +   +P    K  N    +W  +  K  K LK+          K K +E D V   +            Q+ N++           P S  S+         E  +  T+   A  S             ++ T++ I   L+E+R   NRPED+  MT DQ+ +EKV++QKALL +E  +GR    N  Q+M+PLYDRYRL K+ L+     ++N I  P + +   + D         N   +++     SV        D++D       + P    ++    SK+SQ              G+ N  +          ++I +L  + Q+  ++KK ++++L+DFE+ F ++  R V K DR PM  +Y  YK +K++I+ LE L 
Sbjct:  338 AQLTRKIQSLKKKIRKFEDKFEEDRKYRPSHRDKATNPEVLKWMNELAKFRKQLKET---------KIKLSEDDLVPQMR------------QRSNTL-----------PKSFGSQL-----DREEEKKPETVEKPAKPS-------------MEATMEAIQKKLQEKRNEVNRPEDIKDMTRDQIAAEKVSLQKALLYYESIHGRPVTKNERQVMKPLYDRYRLFKQILS-----RANTI--PVIEEEEGSEDDTN-----GNTDFTVTMKPGFSVRTFLEQLDDDADGF-----VSP----VDDNIPSKSSQD------------LGLGNLHS----------ASIPELLEQLQEAREEKKRIRKVLRDFEDNFLKQNGRNVQKEDRNPMAEDYIEYKHVKAKIRLLEVLI 657          
BLAST of Protein FAM13A vs. Ensembl Xenopus
Match: FAM13A (family with sequence similarity 13 member A [Source:NCBI gene;Acc:100488957])

HSP 1 Score: 98.9821 bits (245), Expect = 1.316e-20
Identity = 90/291 (30.93%), Postives = 143/291 (49.14%), Query Frame = 3
Query: 1953 RSNTL-NSTAINSSIIEDLSPREYEK-----LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            RSNTL  S        E+  P   EK     ++ T++ I   L+E+R   NRPED+  MT DQ+ +EKV++QKALL +E  +GR    N  Q+M+PLYDRYRL K+ L+     ++N I  P + +   + D         N   +++     SV        D++D        G   P ++    SK+SQ              G+ N  +          ++I +L  + Q+  ++KK ++++L+DFE+ F ++  R V K DR PM  +Y  YK +K++I+ LE L 
Sbjct:  406 RSNTLPKSFGSQLDREEEKKPETVEKPAKPSMEATMEAIQKKLQEKRNEVNRPEDIKDMTRDQIAAEKVSLQKALLYYESIHGRPVTKNERQVMKPLYDRYRLFKQILS-----RANTI--PVIEEEEGSEDDTN-----GNTDFTVTMKPGFSVRTFLEQLDDDAD--------GFVSP-VDDNIPSKSSQD------------LGLGNLHS----------ASIPELLEQLQEAREEKKRIRKVLRDFEDNFLKQNGRNVQKEDRNPMAEDYIEYKHVKAKIRLLEVLI 653          
BLAST of Protein FAM13A vs. Ensembl Mouse
Match: Fam13a (family with sequence similarity 13, member A [Source:MGI Symbol;Acc:MGI:1889842])

HSP 1 Score: 103.219 bits (256), Expect = 4.932e-22
Identity = 112/415 (26.99%), Postives = 178/415 (42.89%), Query Frame = 3
Query: 1584 ELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQF-------QEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            +L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R+  +RPED+  MT DQ+ +EKV +QKALL +E  +GR       Q+M+PLYDRYRLVK+ L++        QE+ S        + S+   D AV      +  C + Q  +           D   F      I P    ++ +  SK SQ +            G+SN  +          ++I +L    Q++ ++KK +++ L DFE+ F R+  R V K DR PM  EY  YK IK++++ LE L 
Sbjct:  337 QLTRRIQTLKKKIRKFEDRFEEERKYRPSHSDKAANPEVLKWTNDLAKFRKQLKE-----SKLKISEED-----------------------LTPRTRQRSNTLPKSFGSQL------EKEDEKKQELLDKAIRPSV------------EATLEGILRKLQEKRVESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKTERQIMKPLYDRYRLVKQILSRASTVPIIEQEEGSE-------DDSSTKPDFAVTLKTDCSAHCFLDQLED-----------DADGF------ISP----MDDKMPSKCSQDS------------GLSNLHS----------ASIPELLEYLQEMREEKKMIRKKLHDFEDNFFRQNGRNVQKEDRTPMAEEYNEYKHIKAKLRLLEVLI 655          
BLAST of Protein FAM13A vs. Ensembl Mouse
Match: Chn2 (chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243])

HSP 1 Score: 91.2781 bits (225), Expect = 1.174e-19
Identity = 65/196 (33.16%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEIS---FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT-----TTSILIQNYNELF 698
            VY  DL  L++ +++ + P ++ +    I   GL  +G++RVSG    ++++K+ +    +  +IS   + DI+ ITG  KL+ R++P  +I Y      I+A KI    E L+ +   L+ LP  HY  L++    L  V      NLMN+ENLG VFGPT     ED +L T+ +         ILI+N + LF
Sbjct:   83 VYCCDLTTLVK-AHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF 277          
BLAST of Protein FAM13A vs. Ensembl Mouse
Match: Chn2 (chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243])

HSP 1 Score: 91.2781 bits (225), Expect = 1.539e-19
Identity = 65/196 (33.16%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEIS---FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT-----TTSILIQNYNELF 698
            VY  DL  L++ +++ + P ++ +    I   GL  +G++RVSG    ++++K+ +    +  +IS   + DI+ ITG  KL+ R++P  +I Y      I+A KI    E L+ +   L+ LP  HY  L++    L  V      NLMN+ENLG VFGPT     ED +L T+ +         ILI+N + LF
Sbjct:   88 VYCCDLTTLVK-AHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF 282          
BLAST of Protein FAM13A vs. Ensembl Mouse
Match: Chn2 (chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243])

HSP 1 Score: 90.8929 bits (224), Expect = 1.605e-19
Identity = 61/177 (34.46%), Postives = 93/177 (52.54%), Query Frame = 3
Query:  204 YMFGYF---IRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEIS---FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT-----TTSILIQNYNELF 698
            +M+G     +R  GL  +G++RVSG    ++++K+ +    +  +IS   + DI+ ITG  KL+ R++P  +I Y      I+A KI    E L+ +   L+ LP  HY  L++    L  V      NLMN+ENLG VFGPT     ED +L T+ +         ILI+N + LF
Sbjct:   98 FMWGLIAQGVRCSGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF 274          
BLAST of Protein FAM13A vs. Ensembl Mouse
Match: Chn2 (chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243])

HSP 1 Score: 90.1225 bits (222), Expect = 6.390e-19
Identity = 65/196 (33.16%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEIS---FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT-----TTSILIQNYNELF 698
            VY  DL  L++ +++ + P ++ +    I   GL  +G++RVSG    ++++K+ +    +  +IS   + DI+ ITG  KL+ R++P  +I Y      I+A KI    E L+ +   L+ LP  HY  L++    L  V      NLMN+ENLG VFGPT     ED +L T+ +         ILI+N + LF
Sbjct:  138 VYCCDLTTLVK-AHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF 332          
BLAST of Protein FAM13A vs. UniProt/SwissProt
Match: sp|O94988|FA13A_HUMAN (Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 1.266e-21
Identity = 110/412 (26.70%), Postives = 180/412 (43.69%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNN---ILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   AI  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR    N  Q+M+PLYDRYRLVK+ L+     ++N    I  P+  + +      ++G   S  F    +         +NV     DF    V++   K D + R      Q               I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+ F R+  R V K DR PM  EY+ YK IK++++ LE L 
Sbjct:  666 AQLTRRIQSLKKKIRKFEDRFEEEKKYRPSHSDKAANPEVLKWTNDLAKFRRQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELVDKAIKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVTKNERQVMKPLYDRYRLVKQILS-----RANTIPIIGSPSSKRRSPLLQPIIEGETAS--FFKEIKEEEEGSEDDSNV---KPDFM---VTL---KTDFSARC--FLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDNFFRQNGRNVQKEDRTPMAEEYSEYKHIKAKLRLLEVLI 1013          

HSP 2 Score: 91.2781 bits (225), Expect = 2.443e-17
Identity = 56/176 (31.82%), Postives = 91/176 (51.70%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKV 704
            IP +++    ++  +GL  +G+FRV+GN   +++++L +     VE+  + D+ +   L KLFLRE+P  LI  +     I+  +  +       +   + +LP  HY LLK+ C  LT V K    N MN  NL TVFGP  F     +E      + N   + +++NYN LF+V
Sbjct:   58 IPAVVWNIVEYLTQHGLTQEGLFRVNGNVKVVEQLRLKFESGVPVELGKDGDVCSAASLLKLFLRELPDSLITSALQPRFIQLFQDGRNDVQESSLRDLIKELPDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFHVPPGLEGMKEQDLCNKIMAKILENYNTLFEV 233          
BLAST of Protein FAM13A vs. UniProt/SwissProt
Match: sp|Q03070|CHIO_RAT (Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1)

HSP 1 Score: 91.6633 bits (226), Expect = 7.925e-19
Identity = 65/196 (33.16%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEIS---FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT-----TTSILIQNYNELF 698
            VY  DL  L++ +++ + P ++ +    I   GL  +G++RVSG    ++++K+ +    +  +IS   + DI+ ITG  KL+ R++P  +I Y      I+A KI    E L+ +   L+ LP  HY  L++    L  V      NLMN+ENLG VFGPT     ED +L T+ +         ILI+N + LF
Sbjct:  101 VYCCDLTTLVK-AHNTQRPMVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYTKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQILIENEDVLF 295          
BLAST of Protein FAM13A vs. UniProt/SwissProt
Match: sp|Q5ZMM3|RHG15_CHICK (Rho GTPase-activating protein 15 OS=Gallus gallus OX=9031 GN=ARHGAP15 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 1.287e-18
Identity = 56/194 (28.87%), Postives = 97/194 (50.00%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKK---LVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI----ANTTTSILIQNYNELF 698
            ++G  L L+ E   S  +P  +      +   GL V GI+RVSGN   + +++    Q++   L +  +EDIH +TG  K+F RE+P  L PY      ++A KI      +  + T + KLP P+Y+ +K     L  +      NLM++++LG VFGPT     ++   + +     N    +++  Y+++F
Sbjct:  278 IFGSHLHLVCEHENST-VPQFVRQCIKAVERRGLEVDGIYRVSGNLATIQKLRFVVNQEEKLNLDDSQWEDIHVVTGALKMFFRELPEPLFPYCFFEQFVEAIKIQDNATRIKAVKTLVKKLPRPNYDTMKVLFEHLKKIAAKESVNLMSTQSLGIVFGPTLLRPEKETGNMAVHMLYQNQIVELMLSEYSKIF 470          
BLAST of Protein FAM13A vs. UniProt/SwissProt
Match: sp|Q8HYW0|FA13A_BOVIN (Protein FAM13A OS=Bos taurus OX=9913 GN=FAM13A PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 2.150e-18
Identity = 85/274 (31.02%), Postives = 138/274 (50.36%), Query Frame = 3
Query: 2028 LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQF---------QEKKSNNILKPNL---NQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCE--ESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++ TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR  + N  Q+M+PLYDRYRLVK+ L++            K+ + +L+P +     S +   K  + G   +N+       +  V + T+  F    F +  E  + G   P ++ +  SK SQ              G+S   N +   +   L ++ +++ E +++ K        L+DFE+ F R+  R V K DR PM  EY  YK IK++++ LE L 
Sbjct:  443 VEATLESIQRKLQEKRAETSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVSKNERQVMKPLYDRYRLVKQILSRASTIPIIGSPSSKRRSPLLQPIIEGETASFFKEIKEEEEGSEDDNYTK----PDFMVTLKTD--FSARCFLDQFEDDADGFISP-MDDKIPSKCSQDT------------GLS---NLHAASIPELLEHLQEMREEKKRIRKK-------LRDFEDNFFRQNGRNVQKEDRTPMAEEYNEYKHIKAKLRLLEVLI 687          
BLAST of Protein FAM13A vs. UniProt/SwissProt
Match: sp|Q8N264|RHG24_HUMAN (Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 3.199e-18
Identity = 71/234 (30.34%), Postives = 112/234 (47.86%), Query Frame = 3
Query:  138 VYGKDLK--LLLEISYSKEI-PDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDF--ITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFT-SIEDFSLLTIANTTT------SILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSK 800
            ++G+ L+  +  E  Y   + P L+     FIR  GL  +G+FR+ G    + E++  +   +K    S  D+H +  L KL+LRE+P  +IPY++  D +   K+  K E      +  ++  LPV +YNLLK+ C  L  V    G N M+ +NL TVFGP      +ED   LTI   T       S++I  ++ LF   A + +             P   +S+NN + K
Sbjct:  132 IFGQKLEDTVRYEKRYGNRLAPMLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAFDCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKLLSKEEEAGVKELAKQVKSLPVVNYNLLKYICRFLDEVQSYSGVNKMSVQNLATVFGPNILRPKVED--PLTIMEGTVVVQQLMSVMISKHDCLFPKDAELQSK------------PQDGVSNNNEIQK 351          
BLAST of Protein FAM13A vs. TrEMBL
Match: A0A2T7Q126 (Rho-GAP domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_01998 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 7.586e-23
Identity = 88/262 (33.59%), Postives = 140/262 (53.44%), Query Frame = 3
Query: 2025 KLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLS--NIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDL 2804
            K++ TL  I   L+E+R   +RPED+ LM+ DQV+ EK+ +QKALL+FE  +GR  +     LMRPLYDRYRL+K+ LA+    + N++  P + +     D  ++    S        A   ++++PT    +   F  E+V    ++   + R            S   + RKK   NDV+      ++ L   NI  L  E ++   +KK+L+  L++FE +F+ +  RKV K DR PM+  Y+RYK +K+R++ LE L
Sbjct:  618 KVEETLKVILVALKEKRQDASRPEDITLMSRDQVQEEKLAIQKALLHFEGLHGRPTSKEDKDLMRPLYDRYRLIKRLLAKPMSPR-NSLDLPTVPE-----DGLIEIPTGSAMAAIAGTAFKKTILIPT-AELEEERF--ETVDFAITRDLSDFRFTGFHEVPTHVGSVFPKVRKK---NDVDTGQESSESFLHELNIYQLHEELEQSKAEKKQLRHHLREFEKSFQEKHGRKVQKEDRSPMQESYSRYKQVKARLRLLEAL 867          
BLAST of Protein FAM13A vs. TrEMBL
Match: A0A3M6V5T3 (Rho-GAP domain-containing protein OS=Pocillopora damicornis OX=46731 GN=pdam_00007356 PE=4 SV=1)

HSP 1 Score: 117.087 bits (292), Expect = 8.983e-23
Identity = 74/232 (31.90%), Postives = 117/232 (50.43%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEIS-FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKK-TENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSIL---IQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKCSNDQN 818
             +G  +  LL+ S   EIP +I     +++ +GL  +GIFR+SGN   ++ +K  Y +     +    D+  + GL KLFLRE+P  LIP     D IK  + HK     L  +   L KLP  +Y+LLK+ C  L +V     +N M+S  L  VFGP FF   +    L     T +I+   I+ ++ LF+VS    T++ +  +  T + P   +  N ++ K  N++N
Sbjct:   79 TFGVSIDELLKRSEGCEIPPIITSIVEYLKEHGLNQEGIFRISGNHKVVESLKATYDRDGEANLEQVGDVMAVAGLLKLFLRELPEPLIPQDMTADFIKVYQAHKDDGGGLSDMKALLEKLPASNYHLLKYLCTFLVTVSMSEENNKMSSTALAIVFGPNFFRCGDGLEGLREQGRTNAIVGRFIEEFDTLFEVSPYATTDIFRVQETKTNDHPTLRV-PNKSLQKIVNEKN 309          

HSP 2 Score: 70.8626 bits (172), Expect = 1.735e-8
Identity = 32/75 (42.67%), Postives = 52/75 (69.33%), Query Frame = 3
Query: 2037 TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLA 2261
            +L+ +   L+E+R    RPE+++ M+ DQ++ EK+ +QKALL  E  +GR  + N   +MRPLYDRYR +K++L+
Sbjct:  862 SLESLLKKLQEKRKDTGRPEEVEQMSRDQLQDEKLAVQKALLQHESVFGRPNSKNDKDVMRPLYDRYRTIKRKLS 936          
BLAST of Protein FAM13A vs. TrEMBL
Match: A0A4S2LLE0 (Rho-GAP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006380 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 1.470e-22
Identity = 88/342 (25.73%), Postives = 155/342 (45.32%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIY-MFGYFIRNYGLLVQGIFRVSGN-------KTRMDEIKLNYLQKKLVEISFE-----DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELL--KLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQ------------SNDYNTKNDPLYTISSNNNVSKCSNDQNVTIKFGESYLTINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFISSTP------QFSNSLAAALTMCVNNHLFDSLNYNNQYSDC 1055
             +G+ L+ +++   S +IP ++  +F + + N+GL  QGIFRV+GN       +  MDE    +    L  I++E     D+ ++  L KL+LRE+P  L+P       ++A + ++  ++  F   E L  +LPVP+Y LL+  C  L+ V  C   N M+ E+LG VFGP+ F      ED     + N   ++LI+N +  F+++A    N+ Q            +N   +  +P   I   N             +   S      +  +  L +  +P   P    ++ +T + I  +P        S  LAAA+ +C+  H+F  +  ++    C
Sbjct:   32 TFGQPLRDIVQRDKS-DIPLVVQDIFDFLLTNHGLEAQGIFRVNGNSRTVEMLRNLMDETGAQWRVSDLSMIAYESERSMDVFSVASLLKLYLRELPDSLVPAKMTPLFLEAYRNNRNDKSACFSQLEQLITQLPVPNYTLLQHLCHFLSKVWNCRAENKMSGESLGIVFGPSVFHIGQDCEDIHEHNVVNRIMTLLIENASHFFRMNASSCANVTQPSFPTELFASDKANARRSTEEPTRPILEANGA-----------QSNSSGSDSLSNSTTLGLPKSSQPKIHPTASTDNDITGTSILQSPTTWQTEDLSAGLAAAIRVCIEEHVFGPMKSSSSIQPC 361          

HSP 2 Score: 77.7962 bits (190), Expect = 1.239e-10
Identity = 70/272 (25.74%), Postives = 127/272 (46.69%), Query Frame = 3
Query: 1572 NYLSELHKKISILKTQLRQFEDSYQSNNGVKPD---------------------KNVKLGNEWYQKNVKDIK-----LLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVI-SRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDL--SP------------REYEK-LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLA 2261
            + L +L +++ ++K+Q+R +E ++++  G KP+                       +K       + V+D +      ++ D+ H+         T+   +  +  +VI  SG  K ++ N  + ++   V  S  ++ L   ++    N+ S+  N   +T +++  +  L  +P            R  E  L  T + +   L E+R+  NRPEDL LM   Q+ESEK+ +QKALL FE  +GR +      +MRP+YDRYR VK+ L+
Sbjct:  437 DALLQLTQRLHLIKSQVRDYERNFEAICGRKPNFMEKRAESRVRKLLDELTEIRTQIKQARIVMAETVEDPQSPAHDAVEHDVGHLCPILSTHNPTDETPIPRSDVQVIHDSGK-KHRQLNGTSQMNEGPVQGSATLTSLQGASSDWDPNHWSSGYNA-TTTGMSAHTLPSLNNAPSVTHSHKASNPARSSEASLTETYELLIHRLAEKRVSANRPEDLTLMNPKQIESEKLAIQKALLYFESLHGRPRTREERLIMRPIYDRYRAVKRLLS 706          

HSP 3 Score: 64.3142 bits (155), Expect = 1.574e-6
Identity = 31/81 (38.27%), Postives = 52/81 (64.20%), Query Frame = 3
Query: 2571 NNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFEN 2813
            + N  + + S   +  L+ E Q +   K+ LQ++LKDFE+ F + T  KV+++DRL M  EYA+YK++K+R+ +LE   E+
Sbjct:  969 SQNAGYGEFSRWTLTQLQDELQSVQDSKRHLQKVLKDFEHEFLQATGHKVERNDRLCMRAEYAQYKVLKTRLHQLETELES 1049          
BLAST of Protein FAM13A vs. TrEMBL
Match: H2KQ10 (Protein FAM13A OS=Clonorchis sinensis OX=79923 GN=CLF_103014 PE=4 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.101e-21
Identity = 89/333 (26.73%), Postives = 161/333 (48.35%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIY-MFGYFIRNYGLLVQGIFRVSGN-------KTRMDEIKLNYLQKKLVEISFE-----DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELL--KLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTK---NDPLYTISSNNNVSKCSNDQNVTIKFGESYLTINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFISSTP------QFSNSLAAALTMCVNNHLFDSLNYNNQYSDC 1055
             +G+ L+ +++   S +IP ++  +F + + N+GL  QGIFRV+GN       +  MDE   ++    L  I++E     D+ ++  L KL+LRE+P  L+P       ++A + ++  ++  F   E L  +LPVP+Y LL+  C  L+ V  C   N M+ E+LG VFGP+ F      ED     + N   ++LI+N +  F+++A    N+ Q + + T+   +D   T   +   ++   + N T +   S      +  +  L +  +P   P    ++ +T + I  +P        S  LAAA+ +C+  H+F  +   +    C
Sbjct:   32 TFGQPLRDIVQRDKS-DIPLVVQDIFDFLLTNHGLEAQGIFRVNGNSRTVEMLRNLMDETGAHWRVSDLSMIAYESERSMDVFSVASLLKLYLRELPDSLVPAKMTSLFLEAYRNNRNDKSTCFSQLEQLITQLPVPNYTLLQHLCHFLSKVWNCRAENKMSGESLGIVFGPSVFHIGQDSEDIYEHNVVNRIMTLLIENASHFFRMNASSCANVTQPS-FPTELFASDKANTRRGSEGPTRPILEANGT-QSNSSGSESLSNSTTLGLPKSSQPKLHPTGSTDNDITGTSILQSPTTWQTEDLSAGLAAAIRVCIEEHVFGPMEPFSNIQAC 361          

HSP 2 Score: 74.7146 bits (182), Expect = 9.888e-10
Identity = 40/94 (42.55%), Postives = 56/94 (59.57%), Query Frame = 3
Query: 2061 LREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQL-AQFQEKKSNNILKPNLNQSAWTSDKAV 2339
            L E+R    RPEDL LM   Q+ESEK+ +QKALL FE  +GR +      +MRP+YDRYR VK+ L A  Q+++ +    P   Q + +  +A 
Sbjct:  640 LAEKRASAKRPEDLTLMNPKQIESEKLAIQKALLYFESLHGRPRTREERLIMRPIYDRYRAVKRLLSATTQDERPSTANPPTEGQISGSDTRAT 733          

HSP 3 Score: 63.5438 bits (153), Expect = 2.555e-6
Identity = 32/76 (42.11%), Postives = 51/76 (67.11%), Query Frame = 3
Query: 2586 FLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFEN 2813
            F + +L+ + D   E Q + + K+ LQ+ILKDFE+ F + T  KV+++DRL M  EYA+YK++K R+ +LE   E+
Sbjct:  978 FSRWTLTQLQD---ELQSVQESKRHLQKILKDFEHEFLQATGHKVERNDRLCMRAEYAQYKVLKIRLHQLETELES 1050          
BLAST of Protein FAM13A vs. TrEMBL
Match: M3XST2 (Family with sequence similarity 13 member A OS=Mustela putorius furo OX=9669 GN=FAM13A PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 9.041e-21
Identity = 112/426 (26.29%), Postives = 189/426 (44.37%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQF---------QEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKG--------ISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            ++L ++I  LK ++R+FED ++     +P  + K  N    K   D+   ++ +        K K +E D                       +TP   +   + P S  S+         E  +   L   A+  S+            + TL+ I   L+E+R   +RPED+  MT DQ+ +EKV +QKALL +E  +GR  + N  Q+M+PLYDRYRLVK+ L++            K+ + +L+P +             G  ++ F  I + +  S         D+S+          +KPD       KT  S +   + F+    G        I +  + +T       ++I +L    Q++ ++KK +++ L+DFE+TF R+  R V K DR+PM  EY+ YK IK++++ LE L 
Sbjct:  706 AQLTRRIQSLKKKIRKFEDRFEEERKYRPSHSDKAANPEVLKWTNDLAKFRKQLKE-----SKLKISEED-----------------------LTPRMRQRSNTLPKSFGSQL------EKEDEKKQELIDKAVKPSV------------EATLESIQRKLQEKRAESSRPEDIKDMTKDQIANEKVALQKALLYYESIHGRPVSKNERQVMKPLYDRYRLVKQILSRANTIPIIGSPSSKRRSPLLQPIIE------------GETASFFKEIKEEDEGSE--------DDSN----------TKPDFTVTL--KTDFSARCFLDQFEDDADGFISPMDDKIPSKCSQDTGLSNLHAASIPELLEHLQEMREEKKRIRKKLRDFEDTFFRQNGRNVQKEDRIPMAEEYSEYKHIKAKLRLLEVLI 1053          

HSP 2 Score: 92.0485 bits (227), Expect = 4.877e-15
Identity = 57/179 (31.84%), Postives = 93/179 (51.96%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIP---YSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKV 704
            +P ++     ++  +GL  +G+FRV+GN   +++++  +     VE+  + D+ +   L KLFLRE+PG ++    + + + L +  +   +  +L  +  EL   P  HY LLK+ C  LT V K    N MN  NL TVFGP  F     +E      I N   + L++NYN LF+V
Sbjct:   84 VPAIVGTIVEYLVKHGLTQEGLFRVNGNVKVVEQLRWKFESGAPVELGKDGDVCSAASLLKLFLRELPGSVVTAALHPRFVQLFQDDRNDAQESSLRDLIKEL---PDTHYCLLKYLCQFLTKVAKHHVQNRMNVHNLATVFGPNCFHVPPGLEGMKEQDICNKIMAKLLENYNTLFEV 259          
BLAST of Protein FAM13A vs. Ensembl Cavefish
Match: ENSAMXT00000037296.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14520146:14538633:1 gene:ENSAMXG00000039779.1 transcript:ENSAMXT00000037296.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.2041 bits (230), Expect = 6.621e-19
Identity = 70/260 (26.92%), Postives = 119/260 (45.77%), Query Frame = 3
Query: 2028 LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            L+ T+  ++ HL+E+R+  N PE L  M+ DQ+  EK+T+QK+LL +E  +GR ++     +MR LYDRY LVK+  A +   +  N +         + DK +   L     CS          +PT     N  F                               I Q  +  ++    NNT+ +     N  ++  + ++   +K+  ++ILK+FE T   +T +   + DR+PM  EY RY+ +K+R+K L+ + 
Sbjct:  715 LEDTVKTLTQHLKEKRLELNLPERLQDMSLDQLALEKMTLQKSLLYYESLHGRPRSKEERSVMRDLYDRYHLVKQ--AFYSSNRQTNTM---------SGDKGL-AKLIQQTLCS---------TLPTQE-ASNPAF-------------------------------ISQLEEIKLTTAQTNNTHSI-----NRAEILMQLKETRVEKRRQRKILKEFEETVLLKTGKSAQREDRVPMAAEYDRYETLKARLKLLKRML 916          
BLAST of Protein FAM13A vs. Ensembl Cavefish
Match: fam13b (family with sequence similarity 13 member B [Source:NCBI gene;Acc:103045034])

HSP 1 Score: 93.2041 bits (230), Expect = 8.026e-19
Identity = 100/425 (23.53%), Postives = 186/425 (43.76%), Query Frame = 3
Query: 1584 ELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSET--------AARVGTNNESARSNTLN---STAINSSIIEDLSPREYEKLKI------TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            +L KK+  LK +++QFE+ ++ +    P    K  N    K + D+  +++ +    +   K        ++S+++              +S  P      +SRP++   +         A    T     RSNTL     + +     E  + +E E   +      TL+ I   ++ +R  D  PED+  MT +Q+  EK  +QK LL +E  +GR        +++PLYDRYRLVK+ L +     +  I  P+  +   T    ++G   + +FC          I       ++    +E   +     D+          S+++  +I + + +  S  +  +     ++ S++ +L  +  K   +KK+L+R +++FE+ F ++  R V K DRLPM  EY  YK IK++++ LE L 
Sbjct:  564 QLTKKLQNLKKKIKQFEEQFEKDRNYMPSHADKAANPKVLKWMTDLTKIRKQLKGRQHLLPKGSLRHQAVLQSHRR--------------HSSAPNTPHLTLSRPLNASRQAPYFYAKHKAESELTPQTRPRSNTLPKSFGSTLEHPTSEGHAEKEAEPRGLRPTREETLELIQLRIQTKREEDCWPEDIRKMTKEQLACEKTMLQKNLLYYEGLHGRPVTREERLIVKPLYDRYRLVKQMLTRV--SITPIIASPSSKRRNQTLQPIIEGE--TAHFC--------DEIKEEEEEEEDGGVDQEIRGLQCDGSDVIIALDPAAQPSSQQLESILRPKMEESSGKLTLDLRLSSSNASSMPELLEQLWKARAEKKKLRRTIREFEDEFYQQNGRNVQKEDRLPMMDEYKEYKRIKAKLRLLEVLI 962          

HSP 2 Score: 71.633 bits (174), Expect = 2.937e-12
Identity = 58/238 (24.37%), Postives = 115/238 (48.32%), Query Frame = 3
Query:  117 NSIDEFDVYGKDLKLLLEISY-SKEIPDLIYMFGYFIRNYGLL-VQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDF-ITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKCSN 809
            +S++   V+G  L+ + +     +E+P L+     +I  +G L ++G+F V+GN  R++ ++  Y   + V +  E D+ +   L +LFL+E+P  +IP      ++   + +   E L   +   L +LP  +Y+LL+F C  L++V      +  +   L  VFGP  F   T +ED       +   + L++N  + F        +++ +NDY++ ND +  +     +  C +
Sbjct:   11 DSLNTVRVFGIPLEEVQQSGQPGQEVPLLVRTIVEYIEEHGGLDLEGLFLVNGNAERVEWMRQRYDSGEEVNLEKEADLASAVSLLRLFLQELPEPVIPTDLQTRILHLYQEYSSEEELARNMKYFLQQLPQVNYSLLRFLCRFLSNVASLQEES-WSIGALAAVFGPDIFHLDTDVEDLKEQESVSRILAELLENQEDFFDTE---EDDISTNNDYSSINDQITELLEEEKLEACED 244          
BLAST of Protein FAM13A vs. Ensembl Cavefish
Match: ENSAMXT00000036612.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:14520146:14538633:1 gene:ENSAMXG00000039779.1 transcript:ENSAMXT00000036612.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 8.619e-19
Identity = 70/260 (26.92%), Postives = 119/260 (45.77%), Query Frame = 3
Query: 2028 LKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            L+ T+  ++ HL+E+R+  N PE L  M+ DQ+  EK+T+QK+LL +E  +GR ++     +MR LYDRY LVK+  A +   +  N +         + DK +   L     CS          +PT     N  F                               I Q  +  ++    NNT+ +     N  ++  + ++   +K+  ++ILK+FE T   +T +   + DR+PM  EY RY+ +K+R+K L+ + 
Sbjct:  715 LEDTVKTLTQHLKEKRLELNLPERLQDMSLDQLALEKMTLQKSLLYYESLHGRPRSKEERSVMRDLYDRYHLVKQ--AFYSSNRQTNTM---------SGDKGL-AKLIQQTLCS---------TLPTQE-ASNPAF-------------------------------ISQLEEIKLTTAQTNNTHSI-----NRAEILMQLKETRVEKRRQRKILKEFEETVLLKTGKSAQREDRVPMAAEYDRYETLKARLKLLKRML 916          
BLAST of Protein FAM13A vs. Ensembl Cavefish
Match: fam13b (family with sequence similarity 13 member B [Source:NCBI gene;Acc:103045034])

HSP 1 Score: 92.4337 bits (228), Expect = 1.353e-18
Identity = 100/425 (23.53%), Postives = 186/425 (43.76%), Query Frame = 3
Query: 1584 ELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSET--------AARVGTNNESARSNTLN---STAINSSIIEDLSPREYEKLKI------TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            +L KK+  LK +++QFE+ ++ +    P    K  N    K + D+  +++ +    +   K        ++S+++              +S  P      +SRP++   +         A    T     RSNTL     + +     E  + +E E   +      TL+ I   ++ +R  D  PED+  MT +Q+  EK  +QK LL +E  +GR        +++PLYDRYRLVK+ L +     +  I  P+  +   T    ++G   + +FC          I       ++    +E   +     D+          S+++  +I + + +  S  +  +     ++ S++ +L  +  K   +KK+L+R +++FE+ F ++  R V K DRLPM  EY  YK IK++++ LE L 
Sbjct:  542 QLTKKLQNLKKKIKQFEEQFEKDRNYMPSHADKAANPKVLKWMTDLTKIRKQLKGRQHLLPKGSLRHQAVLQSHRR--------------HSSAPNTPHLTLSRPLNASRQAPYFYAKHKAESELTPQTRPRSNTLPKSFGSTLEHPTSEGHAEKEAEPRGLRPTREETLELIQLRIQTKREEDCWPEDIRKMTKEQLACEKTMLQKNLLYYEGLHGRPVTREERLIVKPLYDRYRLVKQMLTRV--SITPIIASPSSKRRNQTLQPIIEGE--TAHFC--------DEIKEEEEEEEDGGVDQEIRGLQCDGSDVIIALDPAAQPSSQQLESILRPKMEESSGKLTLDLRLSSSNASSMPELLEQLWKARAEKKKLRRTIREFEDEFYQQNGRNVQKEDRLPMMDEYKEYKRIKAKLRLLEVLI 940          

HSP 2 Score: 72.0182 bits (175), Expect = 2.431e-12
Identity = 58/238 (24.37%), Postives = 115/238 (48.32%), Query Frame = 3
Query:  117 NSIDEFDVYGKDLKLLLEISY-SKEIPDLIYMFGYFIRNYGLL-VQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDF-ITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKCSN 809
            +S++   V+G  L+ + +     +E+P L+     +I  +G L ++G+F V+GN  R++ ++  Y   + V +  E D+ +   L +LFL+E+P  +IP      ++   + +   E L   +   L +LP  +Y+LL+F C  L++V      +  +   L  VFGP  F   T +ED       +   + L++N  + F        +++ +NDY++ ND +  +     +  C +
Sbjct:   11 DSLNTVRVFGIPLEEVQQSGQPGQEVPLLVRTIVEYIEEHGGLDLEGLFLVNGNAERVEWMRQRYDSGEEVNLEKEADLASAVSLLRLFLQELPEPVIPTDLQTRILHLYQEYSSEEELARNMKYFLQQLPQVNYSLLRFLCRFLSNVASLQEES-WSIGALAAVFGPDIFHLDTDVEDLKEQESVSRILAELLENQEDFFDTE---EDDISTNNDYSSINDQITELLEEEKLEACED 244          
BLAST of Protein FAM13A vs. Ensembl Cavefish
Match: fam13a (family with sequence similarity 13 member A [Source:NCBI gene;Acc:103039322])

HSP 1 Score: 90.5077 bits (223), Expect = 4.750e-18
Identity = 61/196 (31.12%), Postives = 103/196 (52.55%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKE-IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTE---LLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFK 701
            V+G  L  + E+   K+ +P ++     ++R +GL  +G+FRVSG+   +D +K      + +++  + ++  +  L KL+LRE+P GL+  S    LI+   +H ++    F       LL+LP  HY++L++ C  LT V +    N M + NL TVFGP  F   T  +     +I N   + LIQNY  +F+
Sbjct:   58 VFGVSLLEMRELGLVKDGVPVVVRKMVEYLRQHGLQQEGLFRVSGSVRAVDSLKQKLDSGEDLDLQKDAEVCTVASLLKLYLRELPEGLVHSSIHRSLIQ---LHNESSEDGFCKDARELLLRLPDIHYSVLRYLCHFLTQVEEHQQHNRMTALNLATVFGPNVFHVSTGFDGIQEQSICNKIMAKLIQNYTSIFE 250          

HSP 2 Score: 77.0258 bits (188), Expect = 7.501e-14
Identity = 45/107 (42.06%), Postives = 65/107 (60.75%), Query Frame = 3
Query: 1953 RSNTLN---STAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQ 2264
            RSNTL     + +     E  +P+    ++ TL+ + S L+E+R    RPED+  MT +Q+ SEKV +QKALL +E  +GR       Q+M+PLYDRYRLVK+ L +
Sbjct:  798 RSNTLPKSFGSQLEKKAPEAKAPKP--PVETTLESVMSKLQEKRSEVGRPEDIKDMTREQIASEKVALQKALLYYESIHGRPVTKTERQIMKPLYDRYRLVKQILCR 902          
BLAST of Protein FAM13A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000409.1 (pep scaffold:Pmarinus_7.0:GL476366:632694:661978:1 gene:ENSPMAG00000000361.1 transcript:ENSPMAT00000000409.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 95.5153 bits (236), Expect = 2.675e-20
Identity = 76/289 (26.30%), Postives = 128/289 (44.29%), Query Frame = 3
Query:  234 GLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEI--SFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTE-----LLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF---TSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHT-----------NLNQSNDYNTKNDPLYTISSNNNVSKCSNDQNVTIKFGESYL----TINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFISSTPQFSNSLAAALTMCVNNHLFDS 1025
            GL  +G+FRVSG+   ++ ++  + +  + E      D+ ++ GL KLFLRE+P G++P S     ++A   H+ +   +    E     L +LP  ++ LL++ C+ L  V +    NLM+ +NLGTVFGP FF     +E  +   + N  T+  I ++  +F+  +P H            NLN     +  N  L+TI+      +      V  +     L     + +S V+  L Q   P+ L     N    N+ +  T          +   V  HLFD+
Sbjct:    1 GLESEGLFRVSGSVRAVERLRQAW-EADVPEAWRGQADVSSVAGLLKLFLRELPDGVVPASLLPSFLQA---HRDSAGDEMRLAESLRLLLAQLPGENHALLRYLCSFLVRVAQHQEVNLMSPQNLGTVFGPNFFRVSPGMEGIAEQQVVNRVTARFITDFLSIFQEDSPRHAHIILVQVNKIINLNSCCGLSRSNIQLFTIACKRMTDRTPRASAVLFRRVGCGLQNKDAVAISVVTPLLPQTSFPYIL-----NITYLNTLLEQT----------IASTVEQHLFDT 270          

HSP 2 Score: 71.633 bits (174), Expect = 5.796e-13
Identity = 64/229 (27.95%), Postives = 108/229 (47.16%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSV-ISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQ 2264
            S+L K+I  LK ++R+FE+ +Q  +  +P  + K+ N    K + D+            S  + +DTE   +K ++++ ++G      Q+ N++     RS   SRP  +   TA       E  R+                   E   ++ T++ I   L+E+R +  RP+    MT +Q+ +EKV +QK+LL FE  +GR         ++PLYDRYR VK  L +
Sbjct:  545 SQLSKRIQSLKKKIRRFEERFQEEHRYRPSHSDKVTNPEVLKWMNDL----------ARSRKQLRDTEL-RLKQSQEETLSGRDALTRQRSNTL----PRSFGSSRPCELSLPTA-------EKPRA-------------------ERPTVEQTMEAIELRLKEKRQQAARPDSPKEMTREQIAAEKVAIQKSLLYFESIHGRPTTRQEKHKVKPLYDRYRSVKTLLVR 732          
BLAST of Protein FAM13A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004676.1 (pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-1 gene:ENSPMAG00000004196.1 transcript:ENSPMAT00000004676.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 3.361e-20
Identity = 55/172 (31.98%), Postives = 91/172 (52.91%), Query Frame = 3
Query:  111 RDNSIDEFDVYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIK--LNYLQK-KLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFF 617
            RD  + +  V+G  L +L E   +  +P  + +    +   GL + GI+RVSGN   + +++  +++ +K  L E  +EDIH ITG  K+F RE+P  L P++Q    I A K+    E L  I  ++ KLP P+ + ++     L  V  C  +N M ++++  VFGPT  
Sbjct:  410 RDKGLIKEQVFGCPLAMLCE-RENTTVPKFVQLSIETVDKRGLCIDGIYRVSGNLATIQKLRFLVDHEEKVSLDESHWEDIHVITGALKMFFRELPEPLFPFNQFDPFISAIKLQDSREKLTKIKEQVQKLPKPNKDTMRALFEHLKKVIACGDANRMTTQSVAIVFGPTLL 580          
BLAST of Protein FAM13A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000404.1 (pep scaffold:Pmarinus_7.0:GL476366:629540:661972:1 gene:ENSPMAG00000000361.1 transcript:ENSPMAT00000000404.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.8189 bits (229), Expect = 1.779e-19
Identity = 58/212 (27.36%), Postives = 108/212 (50.94%), Query Frame = 3
Query:  138 VYGKDLKLLLE-ISYSKEIPDLIYMFGYFIRNY-----GLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-DIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTE-----LLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFT---SIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNL 728
             +G +L  LL  +   + +P ++     F+  +     GL  +G+FRVSG+   ++ ++  +      +   + D+ ++ GL KLFLRE+P G++P S     ++A   H+ +   +    E     L +LP  ++ LL++ C+ L  V +    NLM+ +NLGTVFGP FF     +E  +   + N  T+  I ++  +F+  +P H ++
Sbjct:    2 TFGVELATLLAGVPPGRTVPLVVETMVQFLEEHVSVHTGLESEGLFRVSGSVRAVERLRQAWEADVTSDGRGQADVSSVAGLLKLFLRELPDGVVPASLLPSFLQA---HRDSAGDEMRLAESLRLLLAQLPGENHALLRYLCSFLVRVAQHQEVNLMSPQNLGTVFGPNFFRVSPGMEGIAEQQVVNRVTARFITDFLSIFQEDSPRHAHI 210          

HSP 2 Score: 60.4622 bits (145), Expect = 1.535e-9
Identity = 55/228 (24.12%), Postives = 97/228 (42.54%), Query Frame = 3
Query: 1581 SELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQ 2264
            S+L K+I  LK ++R+FE+ +Q  +  +P  + K+ N    K + D   L +    +  +  K     +D++   +        +T  + + S  P + R    +P +                                     E   ++ T++ I   L+E+R +  RP+    MT +Q+ +EKV +QK+LL FE  +GR         ++PLYDRYR VK  L +
Sbjct:  496 SQLSKRIQSLKKKIRRFEERFQEEHRYRPSHSDKVTNPEVLKWMND---LARSRKQLRAALLKRSLYRADALTRQRS-------NTLPRSFGSSRPCELRPTAEKPRA-------------------------------------ERPTVEQTMEAIELRLKEKRQQAARPDSPKEMTREQIAAEKVAIQKSLLYFESIHGRPTTRQEKHKVKPLYDRYRSVKTLLVR 676          

HSP 3 Score: 48.9062 bits (115), Expect = 6.243e-6
Identity = 22/53 (41.51%), Postives = 35/53 (66.04%), Query Frame = 3
Query: 2649 DKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            DK+ L+++L+DFE++F R T R V K DR  +  +Y  YK  K++++ LE L 
Sbjct:  767 DKRRLRKLLRDFEDSFYRHTGRNVAKEDRSTLAEQYTEYKHAKAKLRLLEALI 819          
BLAST of Protein FAM13A vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 86.6557 bits (213), Expect = 2.509e-19
Identity = 58/175 (33.14%), Postives = 93/175 (53.14%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY----LQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI 650
            VY  DL  L++ +++++ P ++ M    I   GL  +G++RVSG    ++++K+ +     +  +   S++DI+ ITG  KL+ R++P  LI Y      I+A+K+    E L+ I   L  LP  HY  L++  A L  V      NLM++ENL  VFGPT     E   L T+
Sbjct:   29 VYSCDLTTLVK-AHNRKRPMVVDMCIKEIEMRGLRSEGLYRVSGFSEHIEDVKMAFDRDGEKADISANSYDDINIITGALKLYFRDLPIPLITYDAYPKFIEASKLMDADERLEGIHEALRLLPPAHYESLRYLMAHLKRVTLYSKENLMSAENLAIVFGPTLMRPPEQDVLATL 202          
BLAST of Protein FAM13A vs. Ensembl Sea Lamprey
Match: chn2 (chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5])

HSP 1 Score: 86.2705 bits (212), Expect = 1.439e-18
Identity = 63/198 (31.82%), Postives = 100/198 (50.51%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNY-LQKKLVEIS---FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALL--TSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI-----ANTTTSILIQNYNELF 698
            V+G DL  L++ ++   +P ++ M    I   GL  +G++RVSG    ++E++  +  + +  +IS   +ED++ ITG  KL+ RE+P  L+ Y      ++A K+    E L+ +   L  LP  HY+ L    A L    V +    NLM+SENL  VFGPT     E   L T+           +LI++  ELF
Sbjct:  109 VFGCDLTALVK-AHRGRLPMVVEMCIGEIEARGLKSEGLYRVSGVSDLVEEVRTAFDKEGEKADISAKAYEDVNVITGALKLYFRELPTPLVTYQAYPHFVEAAKVSDPAERLEQLRRALQTLPPAHYDTLHCLMAHLHRRRVSQQEKHNLMSSENLSIVFGPTLMRPHEQDVLATLNGMRHQRLLVELLIRHVQELF 305          
BLAST of Protein FAM13A vs. Ensembl Yeast
Match: RGA2 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; regulated by Pho85p and Cdc28p; RGA2 has a paralog, RGA1, that arose from the whole genome duplication [Source:SGD;Acc:S000002787])

HSP 1 Score: 67.3958 bits (163), Expect = 9.466e-12
Identity = 51/192 (26.56%), Postives = 90/192 (46.88%), Query Frame = 3
Query:  228 NYGLLVQGIFRVSGNKTRMDEIKLNYLQ----------KKLVEISFEDIHNITGLYKLFLREVPGGLIPYS---QAIDLIKATKI--------------HKKTENLDFITTELLK----LPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTF---FTSIEDFSLLTIANTTTSILIQNYNELFK 701
            + GL ++G++R SG++T ++EI+  + Q           KL  +  +DIH +  + K +LR++P  ++ +S     IDL++  ++               +K    + +   LL+    LPV H  +LK   A +  V +C   NLMN  NL  VF P+    F   +D   +   N     ++ NY ++FK
Sbjct:  816 DIGLNMEGLYRKSGSQTLVEEIENEFAQNNSLHSDTLSPKLNALLNQDIHAVASVLKRYLRKLPDPVLSFSIYDALIDLVRNNQLIERLPLNNDKFLDSPQKVTIYEMVLKSLLEIFKILPVEHQEVLKVLAAHIGKVRRCSERNLMNLHNLSLVFAPSLIHDFDGEKDIVDMKERNYIVEFILGNYRDIFK 1007          
BLAST of Protein FAM13A vs. Ensembl Yeast
Match: RGA1 (GTPase-activating protein for polarity-establishment protein Cdc42p; implicated in control of septin organization, pheromone response, and haploid invasive growth; relocalizes from bud neck to cytoplasm upon DNA replication stress; RGA1 has a paralog, RGA2, that arose from the whole genome duplication [Source:SGD;Acc:S000005653])

HSP 1 Score: 53.1434 bits (126), Expect = 1.953e-7
Identity = 52/203 (25.62%), Postives = 92/203 (45.32%), Query Frame = 3
Query:  123 IDEFDVYGKDLKLLLEISYSK-EIPDLIYMFGYFIRN--YGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVE-------ISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTEL----------------LK-----LPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFS 638
            +D  ++YG  L  +   +Y   EIP ++ +   FI +    +  +GI+R SG++  ++EI+  +   K+ +       ++ +D++ +TG+ K +LR++P  +  +     L++  K  K  ENL F+  +L                LK     LP  HY +L+     +  V +    N M   NL  VF P     I DFS
Sbjct:  783 LDGSNLYGSSL--VARCNYENNEIPMILSVCIDFIESDEENMRSEGIYRKSGSQLVIEEIEKQFSAWKVQQNTETPNILTEQDLNVVTGVLKRYLRKLPNPIFTFQIYEPLMRLVKSKKMMENLPFVGGKLSLEAKNSDTYMSSKSALKNILEDLPREHYRVLRVLSEHIEKVTRYSHWNRMTLYNLALVFAPGL---IRDFS 980          
BLAST of Protein FAM13A vs. Ensembl Yeast
Match: BEM2 (Rho GTPase activating protein (RhoGAP); involved in the control of cytoskeleton organization and cellular morphogenesis; required for bud emergence; potential GAP for Rho4p [Source:SGD;Acc:S000000957])

HSP 1 Score: 53.1434 bits (126), Expect = 2.114e-7
Identity = 52/188 (27.66%), Postives = 83/188 (44.15%), Query Frame = 3
Query:  189 IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-------DIHNITGLYKLFLREVPGGLIPYSQA---IDLIKATKIHKKT-ENLDFITTELL-KLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDF-----SLLTIANTTTSILIQNYNELFK 701
            IP ++      I   GL   G++R+ G+   ++ +K  + ++   + SF        +++ I G +K++LRE+P  L  ++      DL    K H    E    +  ELL KLP  +Y  LK     L  V +   +N M++ NL  VF  +F    ED      S L    T     I+N N+ FK
Sbjct: 1980 IPTIVVKLLEEIELRGLDEVGLYRIPGSIGSINALKNAFDEEGATDNSFTLEDDRWFEVNAIAGCFKMYLRELPDSLFSHAMVNDFTDLAIKYKAHAMVNEEYKRMMNELLQKLPTCYYQTLKRIVFHLNKVHQHVVNNKMDASNLAIVFSMSFINQ-EDLANSMGSRLGAVQTILQDFIKNPNDYFK 2166          
BLAST of Protein FAM13A vs. Ensembl Yeast
Match: BAG7 (Rho GTPase activating protein (RhoGAP); stimulates the intrinsic GTPase activity of Rho1p, which plays a bud growth by regulating actin cytoskeleton organization and cell wall biosynthesis, resulting in the downregulation of Rho1p; structurally and functionally related to Sac7p; BAG7 has a paralog, SAC7, that arose from the whole genome duplication [Source:SGD;Acc:S000005660])

HSP 1 Score: 50.447 bits (119), Expect = 8.014e-7
Identity = 46/193 (23.83%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  126 DEFD--VYGKDLKLLLEISYSK-----------EIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE-----DIHNITGLYKLFLREVPGGLIPYSQ----AIDLIKATKIHKKTENL--DFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIED 632
            +EFD  V+G  L+  L+++  +            IP +I   G +++   L   GIFR++G+  R+ E++  + +       FE     ++H+I  L K +L  +   L+P +        +++  KI++  E +  D+    +L LP  + +L+ +  ALL    +    NLM++ NL  +  P+  +  +D
Sbjct:   41 NEFDGKVFGVSLEESLKVAQEEVIIQKSTNEIGSIPVVIAKSGKYLKENALDTTGIFRIAGSNKRVRELQAVFSKPPDYGRKFEGWCDFNVHDIATLLKRYLNSLSEPLVPLALYDIFRNPILENPKINEHKEQIIKDYEDIYML-LPQQNRHLILYLAALLNLFARNEKKNLMSASNLAAIVQPSLLSHPKD 232          
BLAST of Protein FAM13A vs. Ensembl Yeast
Match: RGD1 (GTPase-activating protein (RhoGAP) for Rho3p and Rho4p; possibly involved in control of actin cytoskeleton organization [Source:SGD;Acc:S000000464])

HSP 1 Score: 50.447 bits (119), Expect = 1.046e-6
Identity = 43/176 (24.43%), Postives = 73/176 (41.48%), Query Frame = 3
Query:  132 FDVYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISF---------EDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIED 632
            F  +G  L+ L+E      +P ++    Y I  +GL  +GI+R S N   + ++K   + K    IS           DI+ +  L K F   +P  ++P + + ++    +I   T   +F+   +  LP   Y  L+     L  V      N MN   L  ++GPT   +  D
Sbjct:  467 FKTFGVPLESLIEFEQDM-VPAIVRQCIYVIDKFGLDQEGIYRKSANVLDVSKLK-EEIDKDPANISMILPSKPHSDSDIYLVGSLLKTFFASLPDSVLPKALSSEIKVCLQIEDPTTRKNFMHGLIYNLPDAQYWTLRALVFHLKRVLAHEAQNRMNLRALCIIWGPTIAPANPD 640          
BLAST of Protein FAM13A vs. Ensembl Nematostella
Match: EDO47842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKY9])

HSP 1 Score: 93.5893 bits (231), Expect = 1.655e-19
Identity = 61/188 (32.45%), Postives = 98/188 (52.13%), Query Frame = 3
Query:  162 LLEISYSKE---IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKK--TENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSIL---IQNYNELFK 701
            L E++ S++   IP ++    +++   GL  +GIFRVSGN   ++ +K  + +    ++   D+  + GL KLFLRE+P   +P +   D IK  +++     + LD +   L KLP  +Y LLKF C  L  V     +N M++  L  VFGP FF   +    L     T SI+   ++ Y++LFK
Sbjct:  107 LEEVTKSRDGSPIPWVLAKIVHYLSQCGLKHEGIFRVSGNHKVVESLKATFDRDGDADLEECDVMAVAGLLKLFLRELPEPPVPQALTTDFIKVHEVYGDDNPDCLDELRALLDKLPYLNYELLKFLCHFLVEVSMNEENNKMSTMALAIVFGPNFFRCKDGLDGLREQGHTNSIVCMFLKEYDQLFK 294          
BLAST of Protein FAM13A vs. Ensembl Nematostella
Match: EDO42176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S254])

HSP 1 Score: 78.9518 bits (193), Expect = 2.870e-15
Identity = 59/204 (28.92%), Postives = 100/204 (49.02%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIK-----------LNYLQKKLVEIS-FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT-----TTSILIQNYNELF 698
             +G DL  L+++  +K  P ++ +    +   GL  +G++RVSG    ++ +K           +NY   + V +S ++DI+ ITG+ KL+ R++P  LI +      I A K   K   ++ ++  L +LP  HY  +KF    L  V +    N+M  ENL  VFGPT   + E  SL ++ +         +LI + + LF
Sbjct:  252 AFGVDLTTLVKLHNTKR-PFVVDICINEVEKRGLDSEGLYRVSGFADDIEALKNSFDKGNTHTTVNYSDGESVNLSTYDDINTITGVCKLYFRQLPLPLITFETYSKFIAAAKTQDKHLRIEELSKALGELPQAHYETMKFLMGHLHRVSQRRSKNMMTEENLSIVFGPTLMRAPEGDSLDSLVDMKFQRLAVELLISHQHVLF 454          
BLAST of Protein FAM13A vs. Ensembl Nematostella
Match: EDO46865 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNI7])

HSP 1 Score: 77.0258 bits (188), Expect = 2.058e-14
Identity = 49/185 (26.49%), Postives = 93/185 (50.27%), Query Frame = 3
Query:  180 SKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEIS---------FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI---ANTTTSILIQNYNELF 698
             +EIP+++     FI+ +GL   GIFR+SG+ T ++++K      +L E           ++DI+ + GL +++ RE+   L P S     I+A++     + +  +T  + +LP     ++K+    L  V +    N M++ NL  VFGPT      +  ++T     N    ++I+NY+++F
Sbjct:  438 GREIPEVVESCVRFIKRFGLDHPGIFRLSGSSTDINDMK------QLFECGRDPLAGLNHWKDINAVAGLLRVYFRELEDPLFPSSHYQQFIEASRFPTNEDVIRQVTCVINELPDSVNRVMKYLFKFLKQVSEHSEQNKMDAHNLAVVFGPTLLRIPSEQDMITYQSHVNGMMEVIIKNYDQVF 616          
BLAST of Protein FAM13A vs. Ensembl Nematostella
Match: EDO34021 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL1])

HSP 1 Score: 70.8626 bits (172), Expect = 1.528e-12
Identity = 49/171 (28.65%), Postives = 81/171 (47.37%), Query Frame = 3
Query:  186 EIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELF 698
            E+P L      ++   GL V+GI+RVSG K+++D +K  Y Q K V++   +   +  + K +LRE+P  ++    A    +   I  K E L+     L +LP P+  LL +T   +  V      N M+ +N+  V  PT          ++I++    I + N  ELF
Sbjct:  117 ELPRLFREGIMYVEENGLNVEGIYRVSGVKSKVDALKELYDQGKQVDLKEYEPEVVASIVKQYLRELPESVLTMMLAPRFNELIGIQDKKEQLEKTKQLLAELPSPNRTLLAWTMVHMGHVIDKASENKMSLQNISIVLNPT----------MSISHGVLFIFLSNLAELF 277          
BLAST of Protein FAM13A vs. Ensembl Nematostella
Match: EDO44981 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUA5])

HSP 1 Score: 71.2478 bits (173), Expect = 1.745e-12
Identity = 52/175 (29.71%), Postives = 90/175 (51.43%), Query Frame = 3
Query:  141 YGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFED--IHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANT 659
            +G+ L+ L +    K +P  +     F+   G+ ++GI+R SG    +  I+ ++ +K+  + S  +  +H +TG  K FL+ +P  LIP +   +++ AT I    E L  +   +++LP  ++ +LK+    L  V +    NLM S NL TV  PT   + E  SL T+A T
Sbjct: 1523 FGRSLQELCD--QGKLVPLFVEKCIDFVEAEGMQIEGIYRKSGKIEDIRTIQNSFDEKRDADFSALEMNVHAVTGALKKFLKLLPEPLIPNNLQNNILDATVIMDADERLAVLRGLVMQLPKVNFAVLKYLMCHLNRVTEYSKENLMESRNLATVIFPTILRT-EFESLQTMART 1694          
BLAST of Protein FAM13A vs. Ensembl Medaka
Match: ARHGAP9 (Rho GTPase activating protein 9 [Source:NCBI gene;Acc:101162752])

HSP 1 Score: 104.76 bits (260), Expect = 1.659e-22
Identity = 59/198 (29.80%), Postives = 103/198 (52.02%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIK--LNYLQK-KLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI----ANTTTSILIQNYNELFKVSA 710
            V+G  L++L E      +P  + +    +   GL   GI+RVSGN   + +++  +N+ +K  L E  +EDIH ITG  KLF RE+P  ++P+    D+++  K+    E +D +   +L +P P+++ L+F C  L  V     +N MN++N+G VFGPT      D   + +     N    +++  ++ +F   A
Sbjct:  672 VFGCSLEMLCERERCT-VPRFVRLCTEAVERRGLDTDGIYRVSGNLAVIQKLRFLVNHEEKLNLDESEWEDIHVITGALKLFFRELPEPVVPFGFFTDIVETLKMPDYVEKVDRMKCLVLNMPPPNHDTLQFMCQHLRRVLGHSDTNRMNTQNIGIVFGPTLMRPERDTGNMAVNMVFQNQAVELILTEFDHIFGTRA 868          
BLAST of Protein FAM13A vs. Ensembl Medaka
Match: fam13a (family with sequence similarity 13 member A [Source:NCBI gene;Acc:101172635])

HSP 1 Score: 102.449 bits (254), Expect = 1.076e-21
Identity = 87/266 (32.71%), Postives = 135/266 (50.75%), Query Frame = 3
Query: 2037 TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSK-TSQSNKRNSNIFQYRKKGIS------NDVNNNTNFLKNSL--SNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            TL+ I   L+E+R   NRPED+  MT DQ+  EKV +QKALL +E  +GR    +  Q+M+PLYDRYRLVK+ L      ++  I  P +             G PS    S  +   L  I+         D  EE      S+ D +TR Q K T +S+    +I  +  + +       +D+   T+   ++L  + + +L  + Q+  ++KK +++ LK+FE+ F R+  R V K DR P+  EY  YK IK++++ LE L 
Sbjct:  793 TLESIEKKLQEKRAEVNRPEDIKDMTRDQIGLEKVALQKALLYYESIHGRPVTKSERQIMKPLYDRYRLVKQILC-----RATTI--PVI-------------GSPS----SKRRGPLLQPIIEGETALFFDDIKEEEDG---SEDDGDTRTQFKMTVESDLSMLSILDHMDEEVDGFVSPVDDLEKTTDMRLSNLHSATMQELVEQLQEAKEEKKRIRKNLKEFEDQFFRQNGRTVQKEDRSPLAVEYHEYKHIKAKLRLLEVLI 1031          

HSP 2 Score: 73.559 bits (179), Expect = 8.382e-13
Identity = 54/193 (27.98%), Postives = 95/193 (49.22%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKE-IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEI-SFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLT---IANTTTSILIQNYNELFK 701
            ++G  L  L E    +E +P ++      +  + L  +G+FR++GN   ++ +KL       V++ S  D   +  L K +LR++PGGL+  +    LI+  + + +  +   ++  L +LP   + LL++ C  LT V      NLM ++NL TVFGP  F     F  +      N   + LIQ+Y  +F+
Sbjct:   42 LFGASLLELREQGLEEEGVPFVVKRMVEHLAKHALHQEGLFRINGNVRAVETLKLRLESGDDVDLLSESDSSTVASLLKKYLRDLPGGLVDSAVQQALIQNYRENGENGSCSDLSVFLQQLPDVQHKLLRYLCHFLTLVEGNHKHNLMTADNLATVFGPNVFQVAPGFESMKDQYTCNKIMAKLIQDYRCIFE 234          
BLAST of Protein FAM13A vs. Ensembl Medaka
Match: fam13a (family with sequence similarity 13 member A [Source:NCBI gene;Acc:101172635])

HSP 1 Score: 102.449 bits (254), Expect = 1.215e-21
Identity = 87/266 (32.71%), Postives = 135/266 (50.75%), Query Frame = 3
Query: 2037 TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSK-TSQSNKRNSNIFQYRKKGIS------NDVNNNTNFLKNSL--SNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            TL+ I   L+E+R   NRPED+  MT DQ+  EKV +QKALL +E  +GR    +  Q+M+PLYDRYRLVK+ L      ++  I  P +             G PS    S  +   L  I+         D  EE      S+ D +TR Q K T +S+    +I  +  + +       +D+   T+   ++L  + + +L  + Q+  ++KK +++ LK+FE+ F R+  R V K DR P+  EY  YK IK++++ LE L 
Sbjct:  822 TLESIEKKLQEKRAEVNRPEDIKDMTRDQIGLEKVALQKALLYYESIHGRPVTKSERQIMKPLYDRYRLVKQILC-----RATTI--PVI-------------GSPS----SKRRGPLLQPIIEGETALFFDDIKEEEDG---SEDDGDTRTQFKMTVESDLSMLSILDHMDEEVDGFVSPVDDLEKTTDMRLSNLHSATMQELVEQLQEAKEEKKRIRKNLKEFEDQFFRQNGRTVQKEDRSPLAVEYHEYKHIKAKLRLLEVLI 1060          

HSP 2 Score: 73.559 bits (179), Expect = 7.851e-13
Identity = 54/193 (27.98%), Postives = 95/193 (49.22%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKE-IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEI-SFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLT---IANTTTSILIQNYNELFK 701
            ++G  L  L E    +E +P ++      +  + L  +G+FR++GN   ++ +KL       V++ S  D   +  L K +LR++PGGL+  +    LI+  + + +  +   ++  L +LP   + LL++ C  LT V      NLM ++NL TVFGP  F     F  +      N   + LIQ+Y  +F+
Sbjct:   42 LFGASLLELREQGLEEEGVPFVVKRMVEHLAKHALHQEGLFRINGNVRAVETLKLRLESGDDVDLLSESDSSTVASLLKKYLRDLPGGLVDSAVQQALIQNYRENGENGSCSDLSVFLQQLPDVQHKLLRYLCHFLTLVEGNHKHNLMTADNLATVFGPNVFQVAPGFESMKDQYTCNKIMAKLIQDYRCIFE 234          
BLAST of Protein FAM13A vs. Ensembl Medaka
Match: fam13a (family with sequence similarity 13 member A [Source:NCBI gene;Acc:101172635])

HSP 1 Score: 102.449 bits (254), Expect = 1.292e-21
Identity = 89/266 (33.46%), Postives = 134/266 (50.38%), Query Frame = 3
Query: 2037 TLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSK-TSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNS---LSNI-----DDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLF 2807
            TL+ I   L+E+R   NRPED+  MT DQ+  EKV +QKALL +E  +GR    +  Q+M+PLYDRYRLVK+ L      ++  I  P +             G PS    S  +   L  I+         D  EE      S+ D +TR Q K T +S+    +I  +  + +   V+   +  K +   LSN+      +L  + Q+  ++KK +++ LK+FE+ F R+  R V K DR P+  EY  YK IK++++ LE L 
Sbjct:  851 TLESIEKKLQEKRAEVNRPEDIKDMTRDQIGLEKVALQKALLYYESIHGRPVTKSERQIMKPLYDRYRLVKQILC-----RATTI--PVI-------------GSPS----SKRRGPLLQPIIEGETALFFDDIKEEEDG---SEDDGDTRTQFKMTVESDLSMLSILDHMDEEVDGFVSPVDDLEKTTDMRLSNLHSATMQELVEQLQEAKEEKKRIRKNLKEFEDQFFRQNGRTVQKEDRSPLAVEYHEYKHIKAKLRLLEVLI 1089          

HSP 2 Score: 73.9442 bits (180), Expect = 6.252e-13
Identity = 54/193 (27.98%), Postives = 95/193 (49.22%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKE-IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEI-SFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLT---IANTTTSILIQNYNELFK 701
            ++G  L  L E    +E +P ++      +  + L  +G+FR++GN   ++ +KL       V++ S  D   +  L K +LR++PGGL+  +    LI+  + + +  +   ++  L +LP   + LL++ C  LT V      NLM ++NL TVFGP  F     F  +      N   + LIQ+Y  +F+
Sbjct:   42 LFGASLLELREQGLEEEGVPFVVKRMVEHLAKHALHQEGLFRINGNVRAVETLKLRLESGDDVDLLSESDSSTVASLLKKYLRDLPGGLVDSAVQQALIQNYRENGENGSCSDLSVFLQQLPDVQHKLLRYLCHFLTLVEGNHKHNLMTADNLATVFGPNVFQVAPGFESMKDQYTCNKIMAKLIQDYRCIFE 234          
BLAST of Protein FAM13A vs. Ensembl Medaka
Match: ARHGAP9 (Rho GTPase activating protein 9 [Source:NCBI gene;Acc:101162752])

HSP 1 Score: 97.8265 bits (242), Expect = 2.450e-20
Identity = 58/216 (26.85%), Postives = 103/216 (47.69%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKL------------------NYLQKK---LVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI----ANTTTSILIQNYNELFKVSA 710
            V+G  L++L E      +P  + +    +   GL   GI+RVSGN   + +++                    ++Q++   L E  +EDIH ITG  KLF RE+P  ++P+    D+++  K+    E +D +   +L +P P+++ L+F C  L  V     +N MN++N+G VFGPT      D   + +     N    +++  ++ +F   A
Sbjct:  672 VFGCSLEMLCERERCT-VPRFVRLCTEAVERRGLDTDGIYRVSGNLAVIQKLRFLVNHERAVTTDGRYMFPTEFVQEEKLNLDESEWEDIHVITGALKLFFRELPEPVVPFGFFTDIVETLKMPDYVEKVDRMKCLVLNMPPPNHDTLQFMCQHLRRVLGHSDTNRMNTQNIGIVFGPTLMRPERDTGNMAVNMVFQNQAVELILTEFDHIFGTRA 886          
BLAST of Protein FAM13A vs. Planmine SMEST
Match: SMESG000052108.1 (SMESG000052108.1)

HSP 1 Score: 1840.85 bits (4767), Expect = 0.000e+0
Identity = 920/923 (99.67%), Postives = 921/923 (99.78%), Query Frame = 3
Query:   54 MKFXXXXXXXXXXXXXXXXRDNSIDEFDVYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKCSNDQNVTIKFGESYLTINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFISSTPQFSNSLAAALTMCVNNHLFDSLNYNNQYSDCDYLHSSHLISDLMFNGNNQLYHQPYIDQSNTPLYYSSNNRNIVSAVERKRLLDDNSKYSLPRHFNQSNNSQFYLNNFDNSPKGGLDVVNKSDTFSSFTRNHNHADTINERPMSQVPQLDLSSLTEQTEPENNKPQARISSGESCKPTVVNNRQIKSVTNHPTIHENQLYQPENYLSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFENSQS 2822
            MKFSQKSPNSNLSLKSSKKRDNSIDEFDVYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKCSNDQNVTIKFGESYLTINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFISSTPQFSNSLAAALTMCVNNHLFDSLNYNNQYSDCDYLHSSHLISDLMFNGNNQLYHQPYI+QSNTPLYYSSNNRNIVSAVERKRLLDDNSKYSLPRHFNQSNNSQFYLNNFDNSPKGGLDVVNKSDTFSSFTRNHNHADTINERPMSQVPQLDLSSLTEQTEPE NKPQARISSGES KPTVVNNRQIKSVTNHPTIHENQLYQPENYLSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFENSQS
Sbjct:    1 MKFSQKSPNSNLSLKSSKKRDNSIDEFDVYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTIANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSKCSNDQNVTIKFGESYLTINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFISSTPQFSNSLAAALTMCVNNHLFDSLNYNNQYSDCDYLHSSHLISDLMFNGNNQLYHQPYINQSNTPLYYSSNNRNIVSAVERKRLLDDNSKYSLPRHFNQSNNSQFYLNNFDNSPKGGLDVVNKSDTFSSFTRNHNHADTINERPMSQVPQLDLSSLTEQTEPETNKPQARISSGESLKPTVVNNRQIKSVTNHPTIHENQLYQPENYLSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKPNLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEESVSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFENSQS 923          
BLAST of Protein FAM13A vs. Planmine SMEST
Match: SMESG000008305.1 (SMESG000008305.1)

HSP 1 Score: 102.834 bits (255), Expect = 5.566e-22
Identity = 64/196 (32.65%), Postives = 104/196 (53.06%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEIS-FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTE----LLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS---IEDFSLLTIANTTTSILIQNYNELFK 701
             +G  LK L+E     ++P ++     F+   GL  +GIFRV+GN   ++ IKL + +   +++S + D++ +  + KLF+RE+P GL+P   A+  ++  K  K   N++    E    L  LP  ++NLLK+ C  LT + +    N MN  NLG VFGP  F     +E   L +  N   +  I ++N+LFK
Sbjct:   17 TFGISLKKLIEKEEFAKVPRIVTNICEFLLINGLETEGIFRVNGNNKAVESIKLLFEENYSLDMSSYTDVYAVASVLKLFIRELPDGLVPEKIALQFVEIFK--KYLNNIENCIEEFKHLLSLLPQENFNLLKYICQFLTKIVEKETVNKMNGINLGIVFGPNIFRCSHDMEGLKLQSGMNNIMTCFIIHFNQLFK 210          

HSP 2 Score: 98.2117 bits (243), Expect = 1.480e-20
Identity = 68/226 (30.09%), Postives = 116/226 (51.33%), Query Frame = 3
Query: 1578 LSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTL-NSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKK 2252
             +E+ ++I  L+  L++FE+S++  +G +P    K GN   Q+ + ++  L++ +++  +  +  +    DSV      V+  S     Q  N    + S + +    S  S  + +VG  N+    +TL N  A N S+++              D +++ +  +R R NRPE    MT +Q+E EK+ +QK LL+FE  YGR +  N  Q M+PLYDRYRLVK+
Sbjct:  462 FNEVKERIKCLRKMLKEFEESFERQHGCRPPNIEKTGNSQVQEWLTELVYLREKLNNWQSDNNNPEGVSGDSV------VVRSSHKLNSQDIN----IKSNTQLQSFASTYSGVSEQVGMGNKLKVMSTLENINAQNMSVVQ------------YFDYLTNAIENQRKRTNRPESFLEMTKEQLEDEKMDLQKCLLHFEKIYGRPRENNVKQTMKPLYDRYRLVKR 665          

HSP 3 Score: 64.6994 bits (156), Expect = 3.518e-10
Identity = 35/74 (47.30%), Postives = 51/74 (68.92%), Query Frame = 3
Query: 2589 LKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFE 2810
            L N++S I+ ++ E + LL +K+ LQ++LKDFE+  E+ T RK++KSDR  M  EY RYK IK R++ LE   E
Sbjct:  847 LCNTMSKIE-IEAEKEILLIEKRRLQKLLKDFEHGLEKITGRKIEKSDRDNMRTEYDRYKTIKCRLRVLEKELE 919          
BLAST of Protein FAM13A vs. Planmine SMEST
Match: SMESG000008305.1 (SMESG000008305.1)

HSP 1 Score: 102.834 bits (255), Expect = 5.588e-22
Identity = 64/196 (32.65%), Postives = 104/196 (53.06%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEIS-FEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTE----LLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTS---IEDFSLLTIANTTTSILIQNYNELFK 701
             +G  LK L+E     ++P ++     F+   GL  +GIFRV+GN   ++ IKL + +   +++S + D++ +  + KLF+RE+P GL+P   A+  ++  K  K   N++    E    L  LP  ++NLLK+ C  LT + +    N MN  NLG VFGP  F     +E   L +  N   +  I ++N+LFK
Sbjct:   30 TFGISLKKLIEKEEFAKVPRIVTNICEFLLINGLETEGIFRVNGNNKAVESIKLLFEENYSLDMSSYTDVYAVASVLKLFIRELPDGLVPEKIALQFVEIFK--KYLNNIENCIEEFKHLLSLLPQENFNLLKYICQFLTKIVEKETVNKMNGINLGIVFGPNIFRCSHDMEGLKLQSGMNNIMTCFIIHFNQLFK 223          

HSP 2 Score: 98.2117 bits (243), Expect = 1.510e-20
Identity = 68/226 (30.09%), Postives = 116/226 (51.33%), Query Frame = 3
Query: 1578 LSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWYQKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQKYNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTL-NSTAINSSIIEDLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQKALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKK 2252
             +E+ ++I  L+  L++FE+S++  +G +P    K GN   Q+ + ++  L++ +++  +  +  +    DSV      V+  S     Q  N    + S + +    S  S  + +VG  N+    +TL N  A N S+++              D +++ +  +R R NRPE    MT +Q+E EK+ +QK LL+FE  YGR +  N  Q M+PLYDRYRLVK+
Sbjct:  475 FNEVKERIKCLRKMLKEFEESFERQHGCRPPNIEKTGNSQVQEWLTELVYLREKLNNWQSDNNNPEGVSGDSV------VVRSSHKLNSQDIN----IKSNTQLQSFASTYSGVSEQVGMGNKLKVMSTLENINAQNMSVVQ------------YFDYLTNAIENQRKRTNRPESFLEMTKEQLEDEKMDLQKCLLHFEKIYGRPRENNVKQTMKPLYDRYRLVKR 678          

HSP 3 Score: 64.6994 bits (156), Expect = 3.448e-10
Identity = 35/74 (47.30%), Postives = 51/74 (68.92%), Query Frame = 3
Query: 2589 LKNSLSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMEREYARYKLIKSRIKELEDLFE 2810
            L N++S I+ ++ E + LL +K+ LQ++LKDFE+  E+ T RK++KSDR  M  EY RYK IK R++ LE   E
Sbjct:  860 LCNTMSKIE-IEAEKEILLIEKRRLQKLLKDFEHGLEKITGRKIEKSDRDNMRTEYDRYKTIKCRLRVLEKELE 932          
BLAST of Protein FAM13A vs. Planmine SMEST
Match: SMESG000036427.1 (SMESG000036427.1)

HSP 1 Score: 87.4261 bits (215), Expect = 1.473e-17
Identity = 61/198 (30.81%), Postives = 103/198 (52.02%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKE----IPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHNITGLYKLFLREVPGGLIPYSQAIDLIKATKIH-KKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIE-----DFSLLTIANTTTSILIQNYNELFK 701
            ++G  L+L+L   + KE    +P +I+    +IR YGL  +GIFR +G  + + +++   + +   E    D+H +  L KL+LRE+P  LIP+S   D +KA        ENLD +  +L  LPVP++ LLK+ C  LT V      N M   +L  +F P      +     + S  ++   T +  I+++++LF+
Sbjct:  130 LFGTPLRLVL--PHLKEEYNYVPRIIHECCQYIREYGLKEEGIFRKNGQLSLVMQMR-ELVDRANYEWDNPDVHTVCSLLKLYLRELPEPLIPFSN-YDSLKAVGYRIDANENLDLVKEKLRLLPVPNHQLLKYLCTFLTEVAS-HSENRMEISSLAKIFSPNILRDQDTDPYVEESTNSVITVTVAAFIKSHDDLFE 322          
BLAST of Protein FAM13A vs. Planmine SMEST
Match: SMESG000066507.1 (SMESG000066507.1)

HSP 1 Score: 80.8777 bits (198), Expect = 2.706e-15
Identity = 56/170 (32.94%), Postives = 88/170 (51.76%), Query Frame = 3
Query:  138 VYGKDLKLLLEISYSKEIPDLIYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFE------DIHNITGLYKLFLREVPGGLIPY---SQAIDLIKATKIHKKTENLDFITTELLKLPVPHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFT 620
            V+G +L  L ++   + +P +I      +   G+ ++GI+RVSGN   +DE+K + L K +  I  E      +IHNI+ L KLF R++P  L+     S  +D+IK  +  K    L+  T  LL+LP+ HY  LK+  A L  +      N M  ENL  +F P+  +
Sbjct:  422 VFGIELTSLGKVE-KRGVPMIIMRLVEEVEARGMEIEGIYRVSGNSELIDEVKAD-LDKDIDSIDMEKDGRLCEIHNISSLIKLFFRQLPIPLVTLEVSSMLMDIIKTQENQKV--RLEQFTDCLLRLPLVHYATLKYLMAHLYKLSSFSEINKMTVENLAIIFAPSLIS 587          
The following BLAST results are available for this feature:
BLAST of Protein FAM13A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM13A1.098e-2226.70family with sequence similarity 13 member A [Sourc... [more]
FAM13A1.149e-2226.70family with sequence similarity 13 member A [Sourc... [more]
FAM13A1.233e-2226.70family with sequence similarity 13 member A [Sourc... [more]
FAM13A1.248e-2226.70family with sequence similarity 13 member A [Sourc... [more]
FAM13A2.636e-2226.70family with sequence similarity 13 member A [Sourc... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tag-3257.660e-1536.84WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3252.071e-1436.84WW domain-containing protein tag-325 [Source:UniP... [more]
tag-3252.128e-1436.84WW domain-containing protein tag-325 [Source:UniP... [more]
chin-11.597e-1230.12CHImaeriN (Rac-GTPase-activating protein) homolog ... [more]
pac-15.255e-1125.95GTPase-activating protein pac-1 [Source:UniProtKB... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RhoGAP5A6.220e-1626.80gene:FBgn0029778 transcript:FBtr0070785[more]
CdGAPr6.854e-1325.40gene:FBgn0032821 transcript:FBtr0300967[more]
CdGAPr7.718e-1325.40gene:FBgn0032821 transcript:FBtr0300966[more]
CdGAPr7.719e-1325.40gene:FBgn0032821 transcript:FBtr0332179[more]
CdGAPr7.719e-1325.40gene:FBgn0032821 transcript:FBtr0081318[more]
back to top
BLAST of Protein FAM13A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam13a6.516e-2124.77family with sequence similarity 13 member A [Sourc... [more]
fam13b2.125e-1924.77family with sequence similarity 13 member B [Sourc... [more]
fam13b7.171e-1928.57family with sequence similarity 13 member B [Sourc... [more]
arhgap242.267e-1832.18Rho GTPase activating protein 24 [Source:ZFIN;Acc:... [more]
arhgap242.570e-1832.18Rho GTPase activating protein 24 [Source:ZFIN;Acc:... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAM13A1.824e-2133.67family with sequence similarity 13 member A [Sourc... [more]
FAM13A9.452e-2130.93family with sequence similarity 13 member A [Sourc... [more]
FAM13A1.020e-2030.93family with sequence similarity 13 member A [Sourc... [more]
FAM13A1.025e-2026.63family with sequence similarity 13 member A [Sourc... [more]
FAM13A1.316e-2030.93family with sequence similarity 13 member A [Sourc... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fam13a4.932e-2226.99family with sequence similarity 13, member A [Sour... [more]
Chn21.174e-1933.16chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243][more]
Chn21.539e-1933.16chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243][more]
Chn21.605e-1934.46chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243][more]
Chn26.390e-1933.16chimerin 2 [Source:MGI Symbol;Acc:MGI:1917243][more]
back to top
BLAST of Protein FAM13A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O94988|FA13A_HUMAN1.266e-2126.70Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A P... [more]
sp|Q03070|CHIO_RAT7.925e-1933.16Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Ch... [more]
sp|Q5ZMM3|RHG15_CHICK1.287e-1828.87Rho GTPase-activating protein 15 OS=Gallus gallus ... [more]
sp|Q8HYW0|FA13A_BOVIN2.150e-1831.02Protein FAM13A OS=Bos taurus OX=9913 GN=FAM13A PE=... [more]
sp|Q8N264|RHG24_HUMAN3.199e-1830.34Rho GTPase-activating protein 24 OS=Homo sapiens O... [more]
back to top
BLAST of Protein FAM13A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7Q1267.586e-2333.59Rho-GAP domain-containing protein OS=Pomacea canal... [more]
A0A3M6V5T38.983e-2331.90Rho-GAP domain-containing protein OS=Pocillopora d... [more]
A0A4S2LLE01.470e-2225.73Rho-GAP domain-containing protein OS=Opisthorchis ... [more]
H2KQ101.101e-2126.73Protein FAM13A OS=Clonorchis sinensis OX=79923 GN=... [more]
M3XST29.041e-2126.29Family with sequence similarity 13 member A OS=Mus... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000037296.16.621e-1926.92pep primary_assembly:Astyanax_mexicanus-2.0:9:1452... [more]
fam13b8.026e-1923.53family with sequence similarity 13 member B [Sourc... [more]
ENSAMXT00000036612.18.619e-1926.92pep primary_assembly:Astyanax_mexicanus-2.0:9:1452... [more]
fam13b1.353e-1823.53family with sequence similarity 13 member B [Sourc... [more]
fam13a4.750e-1831.12family with sequence similarity 13 member A [Sourc... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000409.12.675e-2026.30pep scaffold:Pmarinus_7.0:GL476366:632694:661978:1... [more]
ENSPMAT00000004676.13.361e-2031.98pep scaffold:Pmarinus_7.0:GL476377:189826:224778:-... [more]
ENSPMAT00000000404.11.779e-1927.36pep scaffold:Pmarinus_7.0:GL476366:629540:661972:1... [more]
chn22.509e-1933.14chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
chn21.439e-1831.82chimerin 2 [Source:ZFIN;Acc:ZDB-GENE-091020-5][more]
back to top
BLAST of Protein FAM13A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RGA29.466e-1226.56GTPase-activating protein for polarity-establishme... [more]
RGA11.953e-725.62GTPase-activating protein for polarity-establishme... [more]
BEM22.114e-727.66Rho GTPase activating protein (RhoGAP); involved i... [more]
BAG78.014e-723.83Rho GTPase activating protein (RhoGAP); stimulates... [more]
RGD11.046e-624.43GTPase-activating protein (RhoGAP) for Rho3p and R... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO478421.655e-1932.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421762.870e-1528.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468652.058e-1426.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340211.528e-1228.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449811.745e-1229.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein FAM13A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGAP91.659e-2229.80Rho GTPase activating protein 9 [Source:NCBI gene;... [more]
fam13a1.076e-2132.71family with sequence similarity 13 member A [Sourc... [more]
fam13a1.215e-2132.71family with sequence similarity 13 member A [Sourc... [more]
fam13a1.292e-2133.46family with sequence similarity 13 member A [Sourc... [more]
ARHGAP92.450e-2026.85Rho GTPase activating protein 9 [Source:NCBI gene;... [more]
back to top
BLAST of Protein FAM13A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000052108.10.000e+099.67SMESG000052108.1[more]
SMESG000008305.15.566e-2232.65SMESG000008305.1[more]
SMESG000008305.15.588e-2232.65SMESG000008305.1[more]
SMESG000036427.11.473e-1730.81SMESG000036427.1[more]
SMESG000066507.12.706e-1532.94SMESG000066507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025882 ID=SMED30025882|Name=Protein FAM13A|organism=Schmidtea mediterranea sexual|type=transcript|length=2945bp
TCTATATAAATCTTATATGATTGATTGTAAATAATATTCATCTATGAAAA
ATGATGAAATTTAGTCAAAAATCACCAAATTCTAATTTAAGTTTAAAATC
TTCCAAGAAAAGAGACAATTCAATTGATGAATTCGATGTCTATGGAAAAG
ATTTAAAGCTTTTATTGGAAATTTCATATAGCAAAGAAATACCAGATTTG
ATTTATATGTTTGGATATTTTATTAGAAATTATGGATTATTAGTTCAAGG
GATCTTTCGAGTTTCTGGTAATAAAACTCGAATGGATGAAATAAAATTAA
ATTATCTACAAAAAAAACTTGTTGAAATCAGTTTTGAGGATATTCACAAC
ATAACTGGATTATATAAATTATTTTTACGTGAAGTTCCCGGTGGTTTAAT
ACCTTATTCACAAGCAATAGATTTAATTAAAGCAACAAAAATTCACAAAA
AAACTGAAAATCTTGATTTTATAACGACGGAATTATTGAAACTGCCAGTG
CCCCATTACAATTTATTGAAATTCACATGTGCCCTATTAACGAGTGTTTG
CAAATGTTGTGGTAGTAATCTAATGAATTCAGAAAATCTCGGTACAGTAT
TTGGACCGACATTTTTTACCTCCATTGAAGATTTTTCACTATTAACAATT
GCAAATACAACCACTTCAATTTTGATTCAGAACTATAACGAACTCTTCAA
AGTTTCAGCTCCTGTCCATACCAACTTAAATCAAAGTAATGATTACAATA
CAAAAAATGACCCTTTGTATACGATCTCGTCAAATAATAACGTGTCTAAA
TGCTCAAACGATCAAAATGTAACTATTAAATTCGGAGAGAGTTATTTAAC
AATAAACATGTCAGGTGTTTCTGAAAATTTATATCAAGAAGAGGAACCGT
TTCAGTTGCCGGATAAACTAGATAATTCTGGTTTAACAAATTCTTTCATT
AGTTCGACCCCTCAGTTTTCTAATTCTTTAGCCGCTGCCTTAACAATGTG
TGTGAATAATCACCTGTTTGACAGTCTCAACTACAATAACCAATACTCAG
ATTGTGACTATCTCCACTCATCTCACCTGATAAGTGACCTAATGTTCAAT
GGAAATAATCAACTCTACCATCAACCTTACATTGACCAGTCAAATACTCC
GCTATATTATAGCTCAAATAATCGTAATATAGTTTCCGCGGTGGAAAGAA
AAAGACTATTGGATGATAATTCAAAATACTCTTTGCCACGCCATTTTAAC
CAATCGAACAATTCTCAATTTTATTTGAACAATTTCGACAATAGCCCTAA
AGGGGGTCTAGATGTAGTTAATAAATCAGATACATTTTCTTCATTTACCC
GTAATCACAATCATGCTGACACCATTAATGAAAGACCAATGAGCCAAGTT
CCACAATTAGATTTATCCTCATTGACAGAGCAAACAGAACCAGAAAACAA
TAAGCCACAAGCTAGAATCAGTAGTGGAGAAAGTTGCAAGCCAACAGTTG
TAAATAATAGGCAAATAAAATCAGTAACCAATCATCCAACAATTCACGAG
AATCAACTATATCAGCCAGAAAACTATCTCAGTGAGTTACACAAAAAAAT
ATCCATATTAAAGACTCAATTGCGACAATTCGAGGACTCCTATCAATCAA
ATAACGGAGTTAAACCAGATAAAAATGTCAAGTTGGGCAATGAATGGTAT
CAAAAAAATGTCAAAGATATAAAGCTACTGAAACAGGATATCGATCATAT
TGTTAATTCATTTGATAAAACGAAGGACACAGAATCTGATTCAGTAAAAA
GTAATAAGAAAAAAGTGATTACCGGTTCTGGAGATACAAAAGATCAAAAA
TATAATTCAATAACTCCATTGGATAGTAGATCGGTCATCTCTAGGCCTGT
TAGTGTATTGTCTGAAACTGCAGCCCGAGTTGGTACTAATAATGAATCCG
CCAGAAGTAACACCCTTAACAGCACAGCAATTAATAGTTCAATTATTGAA
GATCTTAGTCCTAGGGAATATGAAAAATTAAAAATCACTCTCGATCAGAT
CTCAAGTCATTTACGAGAGGAAAGGATACGGGATAATCGGCCAGAAGATC
TTGATTTAATGACTTATGATCAGGTTGAATCAGAGAAAGTAACAATGCAG
AAAGCACTTCTAAATTTCGAATGTAAATACGGTCGGAAAAAAAATCCAAA
CGCAATTCAATTGATGAGGCCTTTATATGACCGTTACAGACTTGTAAAAA
AACAATTGGCTCAGTTTCAGGAAAAAAAGTCTAACAATATTCTTAAACCA
AACTTAAATCAATCTGCTTGGACATCTGATAAAGCTGTCCAGGGTGGTTT
GCCATCCAACAATTTTTGTAGCATATCTCAAGCAAATAATCTCTCTGTCA
TTATGCCGACAAATGTCCCATTTGATAATAGTGACTTTTGTGAAGAGTCT
GTTAGTATAGGTCCGAGTAAACCTGATATAAATACTAGAGCTCAGTCAAA
AACATCTCAATCAAATAAAAGGAATTCTAACATTTTTCAATATCGTAAAA
AGGGAATTTCAAATGACGTTAATAACAATACCAACTTTTTAAAAAATTCT
TTAAGTAATATTGACGACTTGAAATTCGAATATCAAAAATTGCTGAAGGA
TAAAAAAGAATTACAAAGAATATTGAAAGACTTTGAAAACACTTTCGAAA
GAGAAACGAAGAGAAAAGTCGATAAATCTGACAGGTTGCCCATGGAAAGA
GAATATGCTCGTTACAAACTGATAAAAAGTCGTATTAAAGAATTGGAAGA
TTTATTTGAAAATTCACAATCTTGAATGGAAATAATAAATATTGTGATAA
TAAATATCTCATCTGTATTTTTATTCATCCAAGATTTTCTGCTCATAATT
GGATTTGTATAATCGATAAGATGCAATCTATAAATGTGTACCGGC
back to top

protein sequence of SMED30025882-orf-1

>SMED30025882-orf-1 ID=SMED30025882-orf-1|Name=SMED30025882-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=925bp
MMKFSQKSPNSNLSLKSSKKRDNSIDEFDVYGKDLKLLLEISYSKEIPDL
IYMFGYFIRNYGLLVQGIFRVSGNKTRMDEIKLNYLQKKLVEISFEDIHN
ITGLYKLFLREVPGGLIPYSQAIDLIKATKIHKKTENLDFITTELLKLPV
PHYNLLKFTCALLTSVCKCCGSNLMNSENLGTVFGPTFFTSIEDFSLLTI
ANTTTSILIQNYNELFKVSAPVHTNLNQSNDYNTKNDPLYTISSNNNVSK
CSNDQNVTIKFGESYLTINMSGVSENLYQEEEPFQLPDKLDNSGLTNSFI
SSTPQFSNSLAAALTMCVNNHLFDSLNYNNQYSDCDYLHSSHLISDLMFN
GNNQLYHQPYIDQSNTPLYYSSNNRNIVSAVERKRLLDDNSKYSLPRHFN
QSNNSQFYLNNFDNSPKGGLDVVNKSDTFSSFTRNHNHADTINERPMSQV
PQLDLSSLTEQTEPENNKPQARISSGESCKPTVVNNRQIKSVTNHPTIHE
NQLYQPENYLSELHKKISILKTQLRQFEDSYQSNNGVKPDKNVKLGNEWY
QKNVKDIKLLKQDIDHIVNSFDKTKDTESDSVKSNKKKVITGSGDTKDQK
YNSITPLDSRSVISRPVSVLSETAARVGTNNESARSNTLNSTAINSSIIE
DLSPREYEKLKITLDQISSHLREERIRDNRPEDLDLMTYDQVESEKVTMQ
KALLNFECKYGRKKNPNAIQLMRPLYDRYRLVKKQLAQFQEKKSNNILKP
NLNQSAWTSDKAVQGGLPSNNFCSISQANNLSVIMPTNVPFDNSDFCEES
VSIGPSKPDINTRAQSKTSQSNKRNSNIFQYRKKGISNDVNNNTNFLKNS
LSNIDDLKFEYQKLLKDKKELQRILKDFENTFERETKRKVDKSDRLPMER
EYARYKLIKSRIKELEDLFENSQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039102FAM13
IPR000198RhoGAP_dom
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 898..924
NoneNo IPR availableCOILSCoilCoilcoord: 510..530
NoneNo IPR availableCOILSCoilCoilcoord: 854..888
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 458..480
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 807..826
NoneNo IPR availableCDDcd00159RhoGAPcoord: 48..211
e-value: 1.76108E-38
score: 138.974
IPR000198Rho GTPase-activating protein domainSMARTSM00324RhoGAP_3coord: 45..213
e-value: 3.2E-36
score: 136.3
IPR000198Rho GTPase-activating protein domainPFAMPF00620RhoGAPcoord: 50..191
e-value: 2.2E-32
score: 112.0
IPR000198Rho GTPase-activating protein domainPROSITEPS50238RHOGAPcoord: 33..216
score: 32.127
IPR008936Rho GTPase activation proteinGENE3DG3DSA:1.10.555.10coord: 1..227
e-value: 1.5E-42
score: 147.5
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 45..218
IPR039102Protein FAM13PANTHERPTHR15904FAM13coord: 18..922