Glyceraldehyde-3-phosphate dehydrogenase

Overview
NameGlyceraldehyde-3-phosphate dehydrogenase
Smed IDSMED30025877
Length (bp)1242
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glyceraldehyde-3-phosphate dehydrogenase (SMED30025877) t-SNE clustered cells

Violin plots show distribution of expression levels for Glyceraldehyde-3-phosphate dehydrogenase (SMED30025877) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glyceraldehyde-3-phosphate dehydrogenase (SMED30025877) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glyceraldehyde-3-phosphate dehydrogenase (SMED30025877) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025877

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30025877SMESG000012145.1 Contig48655newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025877SMESG000012145.1 Contig48655uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30025877SMESG000012145.1 PL06021A2D11ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testis primordiumSMED30025877SMESG000012145.1 Contig6123_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 411.379 bits (1056), Expect = 1.059e-142
Identity = 204/333 (61.26%), Postives = 256/333 (76.88%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M   +VG+NGFGRIGRL+ RAA    ++++VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+ +PI ++  R+P +I W ++ +EY++ES+GVFTT+EKA  HL     K+VIISAPS DAPMFVMGVNH KY   + ++SNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPTANVSV DLTC+L     YD+I K ++ A+  P  +GI+   +  +VS+D   D HS  FD GAGIALND FVKL++WYDNE+GYSNRV+DL+ HM
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 411.379 bits (1056), Expect = 1.059e-142
Identity = 204/333 (61.26%), Postives = 256/333 (76.88%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M   +VG+NGFGRIGRL+ RAA    ++++VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+ +PI ++  R+P +I W ++ +EY++ES+GVFTT+EKA  HL     K+VIISAPS DAPMFVMGVNH KY   + ++SNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPTANVSV DLTC+L     YD+I K ++ A+  P  +GI+   +  +VS+D   D HS  FD GAGIALND FVKL++WYDNE+GYSNRV+DL+ HM
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 411.379 bits (1056), Expect = 1.059e-142
Identity = 204/333 (61.26%), Postives = 256/333 (76.88%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M   +VG+NGFGRIGRL+ RAA    ++++VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+ +PI ++  R+P +I W ++ +EY++ES+GVFTT+EKA  HL     K+VIISAPS DAPMFVMGVNH KY   + ++SNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPTANVSV DLTC+L     YD+I K ++ A+  P  +GI+   +  +VS+D   D HS  FD GAGIALND FVKL++WYDNE+GYSNRV+DL+ HM
Sbjct:    1 MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDHS (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:HGNC Symbol;Acc:HGNC:24864])

HSP 1 Score: 387.882 bits (995), Expect = 1.778e-132
Identity = 201/334 (60.18%), Postives = 253/334 (75.75%), Query Frame = 3
Query:  114 VGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKP-DMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 1112
            VGINGFGRIGRL+LRA    + + VVAVNDPFI  +YM YM KYDSTHG+++ ++  ++  L +D+H I VY  + P++IPW    S Y++ES+GV+ +I+ AS H++ +  ++V+ISAPS DAPMFVMGVN   Y P  MN+VSNASCTTNC+APLAK+I++ FGI E LMTTVH+ TATQKTVD PS K WR GRGA QNIIPASTGAAKAV K+IP L GKL+GMAFRVPT +VSV DLTC+L     Y  I +A++ AA  P   GI+   +D +VSTD  GD HS IFD  AGIALND+FVKL++WYDNE+GYS+RV+DL+ +MF  D 
Sbjct:   78 VGINGFGRIGRLVLRAC-MEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEFRNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHIS-AGAQRVVISAPSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSYTATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVSVVDLTCRLAQPAPYSAIKEAVKAAAKGPM-AGILAYTEDEVVSTDFLGDTHSSIFDAKAGIALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRDK 408          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Match: GAPDH (glyceraldehyde-3-phosphate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:4141])

HSP 1 Score: 360.147 bits (923), Expect = 3.001e-123
Identity = 181/291 (62.20%), Postives = 223/291 (76.63%), Query Frame = 3
Query:  225 MAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M YM +YDSTHG+F   +  ++  L I+ +PI ++  R+P +I W ++ +EY++ES+GVFTT+EKA  HL     K+VIISAPS DAPMFVMGVNH KY   + ++SNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPTANVSV DLTC+L     YD+I K ++ A+  P  +GI+   +  +VS+D   D HS  FD GAGIALND FVKL++WYDNE+GYSNRV+DL+ HM
Sbjct:    1 MVYMFQYDSTHGKFHGTVKAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHL-QGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYDNEFGYSNRVVDLMAHM 289          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-3 (Glyceraldehyde-3-phosphate dehydrogenase 3 [Source:UniProtKB/Swiss-Prot;Acc:P17330])

HSP 1 Score: 401.749 bits (1031), Expect = 2.644e-139
Identity = 212/339 (62.54%), Postives = 259/339 (76.40%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFI-----DSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKY-KPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M+ P VGINGFGRIGRL+LRAA     +NVVAVNDPFI IDYM Y+ +YDSTHG+F+  ++ + + L +       H I+VYN R+P EI W  S ++Y++ES+GVFTTIEKA+ HL   + KKVIISAPS DAPMFV+GVNH KY   + +++SNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT +VSV DLT +L    + D+I K ++ AA  P  +GI+   +D +VSTD   D +S IFD GA I+LN  FVKLV+WYDNE+GYSNRV+DLI ++
Sbjct:    1 MTKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGA-KKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPM-KGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-3 (Glyceraldehyde-3-phosphate dehydrogenase 3 [Source:UniProtKB/Swiss-Prot;Acc:P17330])

HSP 1 Score: 401.749 bits (1031), Expect = 2.644e-139
Identity = 212/339 (62.54%), Postives = 259/339 (76.40%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFI-----DSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKY-KPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M+ P VGINGFGRIGRL+LRAA     +NVVAVNDPFI IDYM Y+ +YDSTHG+F+  ++ + + L +       H I+VYN R+P EI W  S ++Y++ES+GVFTTIEKA+ HL   + KKVIISAPS DAPMFV+GVNH KY   + +++SNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT +VSV DLT +L    + D+I K ++ AA  P  +GI+   +D +VSTD   D +S IFD GA I+LN  FVKLV+WYDNE+GYSNRV+DLI ++
Sbjct:    1 MTKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGA-KKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPM-KGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-2 (Glyceraldehyde-3-phosphate dehydrogenase 2 [Source:UniProtKB/Swiss-Prot;Acc:P17329])

HSP 1 Score: 399.823 bits (1026), Expect = 1.373e-138
Identity = 212/339 (62.54%), Postives = 258/339 (76.11%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFI-----DSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKY-KPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M  P VGINGFGRIGRL+LRAA     +NVVAVNDPFI IDYM Y+ +YDSTHG+F+  ++ + + L +       H I+VYN R+P EI W  S ++Y++ES+GVFTTIEKA+ HL   + KKVIISAPS DAPMFV+GVNH KY   + +++SNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT +VSV DLT +L    + D+I K ++ AA  P  +GI+   +D +VSTD   D +S IFD GA I+LN  FVKLV+WYDNE+GYSNRV+DLI ++
Sbjct:    1 MPKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGA-KKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPM-KGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-2 (Glyceraldehyde-3-phosphate dehydrogenase 2 [Source:UniProtKB/Swiss-Prot;Acc:P17329])

HSP 1 Score: 399.823 bits (1026), Expect = 1.373e-138
Identity = 212/339 (62.54%), Postives = 258/339 (76.11%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFI-----DSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKY-KPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M  P VGINGFGRIGRL+LRAA     +NVVAVNDPFI IDYM Y+ +YDSTHG+F+  ++ + + L +       H I+VYN R+P EI W  S ++Y++ES+GVFTTIEKA+ HL   + KKVIISAPS DAPMFV+GVNH KY   + +++SNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT +VSV DLT +L    + D+I K ++ AA  P  +GI+   +D +VSTD   D +S IFD GA I+LN  FVKLV+WYDNE+GYSNRV+DLI ++
Sbjct:    1 MPKPSVGINGFGRIGRLVLRAAVEKDSVNVVAVNDPFISIDYMVYLFQYDSTHGRFKGTVAHEGDYLLVAKEGKSQHKIKVYNSRDPAEIQWGASGADYVVESTGVFTTIEKANAHLKGGA-KKVIISAPSADAPMFVVGVNHEKYDHANDHIISNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTARLEKPASLDDIKKVIKAAADGPM-KGILAYTEDQVVSTDFVSDTNSSIFDAGASISLNPHFVKLVSWYDNEFGYSNRVVDLISYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Match: gpd-1 (Glyceraldehyde-3-phosphate dehydrogenase 1 [Source:UniProtKB/Swiss-Prot;Acc:P04970])

HSP 1 Score: 399.053 bits (1024), Expect = 3.470e-138
Identity = 213/339 (62.83%), Postives = 257/339 (75.81%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFID-----SHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKP-DMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            MS   VGINGFGRIGRL+LRAA     + VVAVNDPFI IDYM Y+ KYDSTHGQF+  ++   + L +      SH I+V+N ++P  I W + K+++++ES+GVFTT EKAS HL     KKVIISAPS DAPM+V+GVNH KY   + +VVSNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT +VSV DLT +L    + D+I K ++ AA  P  +GI+   +D +VSTD   DPHS IFD GA I+LN +FVKLV+WYDNE+GYSNRV+DLI ++
Sbjct:    1 MSKANVGINGFGRIGRLVLRAAVEKDTVQVVAVNDPFITIDYMVYLFKYDSTHGQFKGTVTYDGDFLIVQKDGKSSHKIKVFNSKDPAAIAWGSVKADFVVESTGVFTTKEKASAHL-QGGAKKVIISAPSADAPMYVVGVNHEKYDASNDHVVSNASCTTNCLAPLAKVINDNFGIIEGLMTTVHAVTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLEKPASMDDIKKVVKAAADGPM-KGILAYTEDQVVSTDFVSDPHSSIFDAGACISLNPNFVKLVSWYDNEYGYSNRVVDLIGYI 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh2 (gene:FBgn0001092 transcript:FBtr0074112)

HSP 1 Score: 403.675 bits (1036), Expect = 3.881e-140
Identity = 212/335 (63.28%), Postives = 258/335 (77.01%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            + ++GINGFGRIGRL+LRAA   +  NVVAVNDPFI ++YM Y+ K+DSTHG+F+  ++ +   L ++   I V++ R+P  I W+++ +EYI+ES+GVFTTI+KAS HL   + KKVIISAPS DAPMFV GVN   YKPDM VVSNASCTTNC+APLAK+INDNF I E LMTTVHATTATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP+L GKL+GMAFRVPT NVSV DLT +L    +YD I   ++ AA  P  +GI+   D+ +VSTD   D HS +FD  AGI+LND FVKL++WYDNE+GYSNRVIDLI +M   D
Sbjct:    1 MSKIGINGFGRIGRLVLRAA-IDKGANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGA-KKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGP-LKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh2 (gene:FBgn0001092 transcript:FBtr0332618)

HSP 1 Score: 403.675 bits (1036), Expect = 3.881e-140
Identity = 212/335 (63.28%), Postives = 258/335 (77.01%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            + ++GINGFGRIGRL+LRAA   +  NVVAVNDPFI ++YM Y+ K+DSTHG+F+  ++ +   L ++   I V++ R+P  I W+++ +EYI+ES+GVFTTI+KAS HL   + KKVIISAPS DAPMFV GVN   YKPDM VVSNASCTTNC+APLAK+INDNF I E LMTTVHATTATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP+L GKL+GMAFRVPT NVSV DLT +L    +YD I   ++ AA  P  +GI+   D+ +VSTD   D HS +FD  AGI+LND FVKL++WYDNE+GYSNRVIDLI +M   D
Sbjct:    1 MSKIGINGFGRIGRLVLRAA-IDKGANVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYIVESTGVFTTIDKASTHLKGGA-KKVIISAPSADAPMFVCGVNLDAYKPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGASYDEIKAKVQEAANGP-LKGILGYTDEEVVSTDFLSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh1 (gene:FBgn0001091 transcript:FBtr0100479)

HSP 1 Score: 397.127 bits (1019), Expect = 1.637e-137
Identity = 208/335 (62.09%), Postives = 256/335 (76.42%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            + ++GINGFGRIGRL+LRAA   +  +VVAVNDPFI ++YM Y+ K+DSTHG+F+  ++ +   L ++   I V++ R+P  I W+++ +EY++ES+GVFTTI+KAS HL   + KKVIISAPS DAPMFV GVN   Y PDM VVSNASCTTNC+APLAK+INDNF I E LMTTVHATTATQKTVD PS K WR GRGA QNIIPA+TGAAKAVGK+IP+L GKL+GMAFRVPT NVSV DLT +L    TYD I   +  A+  P  +GI+   D+ +VSTD   D HS +FD  AGI+LND FVKL++WYDNE+GYSNRVIDLI +M   D
Sbjct:    1 MSKIGINGFGRIGRLVLRAA-IDKGASVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGGA-KKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGATYDEIKAKVEEASKGP-LKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: Gapdh1 (gene:FBgn0001091 transcript:FBtr0088903)

HSP 1 Score: 397.127 bits (1019), Expect = 1.637e-137
Identity = 208/335 (62.09%), Postives = 256/335 (76.42%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            + ++GINGFGRIGRL+LRAA   +  +VVAVNDPFI ++YM Y+ K+DSTHG+F+  ++ +   L ++   I V++ R+P  I W+++ +EY++ES+GVFTTI+KAS HL   + KKVIISAPS DAPMFV GVN   Y PDM VVSNASCTTNC+APLAK+INDNF I E LMTTVHATTATQKTVD PS K WR GRGA QNIIPA+TGAAKAVGK+IP+L GKL+GMAFRVPT NVSV DLT +L    TYD I   +  A+  P  +GI+   D+ +VSTD   D HS +FD  AGI+LND FVKL++WYDNE+GYSNRVIDLI +M   D
Sbjct:    1 MSKIGINGFGRIGRLVLRAA-IDKGASVVAVNDPFIDVNYMVYLFKFDSTHGRFKGTVAAEGGFLVVNGQKITVFSERDPANINWASAGAEYVVESTGVFTTIDKASTHLKGGA-KKVIISAPSADAPMFVCGVNLDAYSPDMKVVSNASCTTNCLAPLAKVINDNFEIVEGLMTTVHATTATQKTVDGPSGKLWRDGRGAAQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPTPNVSVVDLTVRLGKGATYDEIKAKVEEASKGP-LKGILGYTDEEVVSTDFFSDTHSSVFDAKAGISLNDKFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Match: CG9010 (gene:FBgn0034173 transcript:FBtr0087067)

HSP 1 Score: 345.125 bits (884), Expect = 6.808e-117
Identity = 179/333 (53.75%), Postives = 234/333 (70.27%), Query Frame = 3
Query:  114 VGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 1112
            +GINGFGRIGR+  R A   + + +VA+NDP +   Y+AYML+YDSTHGQF   +S+  N L ++   I++    + ++I W +     ++E SG FTT++    HL DS  KKV+ISAPS DAPMFV GVN   YKP   ++SNASCTTNC+APLAK+++DNF I E LMTTVHA TATQK +D PS+K WR GR    NIIPASTGAAKAVGK+IP L GKL+GMAFRVP  NVSV DLTC+L      D+I K ++ A+ C + +GI+  V++ +VSTD  G   + +FD  A IALND+FVKL++WYDNE GYS R++DL+ +   +D 
Sbjct:    4 IGINGFGRIGRMFARQALVRKDVKIVAINDPSLDPKYLAYMLRYDSTHGQFNQKISVDGNNLVVNGKKIQLLKESDVKKIKWCDLGVHTVVECSGRFTTLKACQGHL-DSGAKKVVISAPSADAPMFVCGVNLEAYKPGTAIISNASCTTNCLAPLAKVVHDNFEICEGLMTTVHAATATQKIIDGPSSKLWRDGRSGMTNIIPASTGAAKAVGKVIPDLNGKLTGMAFRVPVPNVSVVDLTCRLSKPAKMDDIKKCIKAASKC-EMKGILGYVEEEVVSTDFNGSRFASVFDAKACIALNDNFVKLISWYDNETGYSCRLLDLVLYAQLVDQ 334          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 407.527 bits (1046), Expect = 1.977e-141
Identity = 210/331 (63.44%), Postives = 251/331 (75.83%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VGINGFGRIGRL+ RAA   +++ +VA+NDPFI +DYM YM +YDSTHG+++  +  +   L ID H I VY+ R+P  I W ++ + Y++ES+GVFTTIEKAS H+   + K+VIISAPS DAPMFVMGVNH KY   + VVSNASCTTNC+APLAK+INDNF I E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLT +L     YD I K ++ AA  P  +GI+   +  +VSTD  GD  S IFD GAGIALND FVKLV WYDNE+GYSNRV DL+ HM
Sbjct:    1 MVKVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDEIKKVVKAAADGPM-KGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 407.527 bits (1046), Expect = 1.977e-141
Identity = 210/331 (63.44%), Postives = 251/331 (75.83%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VGINGFGRIGRL+ RAA   +++ +VA+NDPFI +DYM YM +YDSTHG+++  +  +   L ID H I VY+ R+P  I W ++ + Y++ES+GVFTTIEKAS H+   + K+VIISAPS DAPMFVMGVNH KY   + VVSNASCTTNC+APLAK+INDNF I E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLT +L     YD I K ++ AA  P  +GI+   +  +VSTD  GD  S IFD GAGIALND FVKLV WYDNE+GYSNRV DL+ HM
Sbjct:    1 MVKVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDEIKKVVKAAADGPM-KGILGYTEHQVVSTDFNGDCRSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:NCBI gene;Acc:406367])

HSP 1 Score: 395.971 bits (1016), Expect = 6.876e-137
Identity = 205/334 (61.38%), Postives = 256/334 (76.65%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            MS   VGINGFGRIGRL+LRA    + I V A+NDPFI + YM YM KYDSTHG+++  + ++D  L +D   I V+    P EIPW ++ + Y++ES+GVF +I+KAS H+     K+V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVP A+VSV DLTC+L    +Y NI ++++ AA  P  +GI+   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS+RV DL+ +M
Sbjct:    1 MSELCVGINGFGRIGRLVLRAC-LQKGIKVTAINDPFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVDGQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIDKASAHI-QGGAKRVVVSAPSPDAPMFVMGVNQDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTRPASYANIKESVKKAAHGPM-KGILGYTEDSVVSSDFVGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLMYM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase, spermatogenic [Source:NCBI gene;Acc:406367])

HSP 1 Score: 395.971 bits (1016), Expect = 6.876e-137
Identity = 205/334 (61.38%), Postives = 256/334 (76.65%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            MS   VGINGFGRIGRL+LRA    + I V A+NDPFI + YM YM KYDSTHG+++  + ++D  L +D   I V+    P EIPW ++ + Y++ES+GVF +I+KAS H+     K+V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVP A+VSV DLTC+L    +Y NI ++++ AA  P  +GI+   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS+RV DL+ +M
Sbjct:    1 MSELCVGINGFGRIGRLVLRAC-LQKGIKVTAINDPFIDLQYMVYMFKYDSTHGRYKGEVHMEDGKLIVDGQAISVFQCMKPAEIPWGDAGALYVVESTGVFLSIDKASAHI-QGGAKRVVVSAPSPDAPMFVMGVNQDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTRPASYANIKESVKKAAHGPM-KGILGYTEDSVVSSDFVGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLMYM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 308.531 bits (789), Expect = 5.348e-104
Identity = 158/240 (65.83%), Postives = 190/240 (79.17%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVS 824
            + +VGINGFGRIGRL+ RAA   +++ +VA+NDPFI +DYM YM +YDSTHG+++  +  +   L ID H I VY+ R+P  I W ++ + Y++ES+GVFTTIEKAS H+   + K+VIISAPS DAPMFVMGVNH KY   + VVSNASCTTNC+APLAK+INDNF I E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVS
Sbjct:    1 MVKVGINGFGRIGRLVTRAAFLTKKVEIVAINDPFIDLDYMVYMFQYDSTHGKYKGEVKAEGGKLVIDGHAITVYSERDPANIKWGDAGATYVVESTGVFTTIEKASAHIKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVINDNFVIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVS 239          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 416.387 bits (1069), Expect = 9.464e-145
Identity = 214/329 (65.05%), Postives = 258/329 (78.42%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            ++GINGFGRIGRL+ RAA    +  VVA+NDPFI +DYMAYM KYDSTHG+F+  + +++  L I+   + V+  R+P  I W ++ + Y++ES+GVFTT EKA LHL   + K+VIISAPS DAPMFV+GVNH KY   ++VVSNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I  A++TAA  P  +GI+   +D +VSTD  GD HS IFD GAGIALND+FVKLV+WYDNE GYS+RV+DL+CHM
Sbjct:    4 KIGINGFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGA-KRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPM-KGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 407.142 bits (1045), Expect = 1.249e-140
Identity = 210/323 (65.02%), Postives = 252/323 (78.02%), Query Frame = 3
Query:  129 FGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            FGRIGRL+ RAA    +  VVA+NDPFI +DYMAYM KYDSTHG+F+  + +++  L I+   + V+  R+P  I W ++ + Y++ES+GVFTT EKA LHL   + K+VIISAPS DAPMFV+GVNH KY   ++VVSNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I  A++TAA  P  +GI+   +D +VSTD  GD HS IFD GAGIALND+FVKLV+WYDNE GYS+RV+DL+CHM
Sbjct:   40 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGA-KRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPM-KGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 360          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 405.601 bits (1041), Expect = 1.523e-140
Identity = 210/323 (65.02%), Postives = 252/323 (78.02%), Query Frame = 3
Query:  129 FGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            FGRIGRL+ RAA    +  VVA+NDPFI +DYMAYM KYDSTHG+F+  + +++  L I+   + V+  R+P  I W ++ + Y++ES+GVFTT EKA LHL   + K+VIISAPS DAPMFV+GVNH KY   ++VVSNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I  A++TAA  P  +GI+   +D +VSTD  GD HS IFD GAGIALND+FVKLV+WYDNE GYS+RV+DL+CHM
Sbjct:    7 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGA-KRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPM-KGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 327          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 405.986 bits (1042), Expect = 1.598e-140
Identity = 211/325 (64.92%), Postives = 253/325 (77.85%), Query Frame = 3
Query:  123 NGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            N FGRIGRL+ RAA    +  VVA+NDPFI +DYMAYM KYDSTHG+F+  + +++  L I+   + V+  R+P  I W ++ + Y++ES+GVFTT EKA LHL   + K+VIISAPS DAPMFV+GVNH KY   ++VVSNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I  A++TAA  P  +GI+   +D +VSTD  GD HS IFD GAGIALND+FVKLV+WYDNE GYS+RV+DL+CHM
Sbjct:   18 NQFGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGA-KRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPM-KGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 340          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Match: mbd3 (methyl-CpG binding domain protein 3 [Source:Xenbase;Acc:XB-GENE-491553])

HSP 1 Score: 405.601 bits (1041), Expect = 2.133e-140
Identity = 210/323 (65.02%), Postives = 252/323 (78.02%), Query Frame = 3
Query:  129 FGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            FGRIGRL+ RAA    +  VVA+NDPFI +DYMAYM KYDSTHG+F+  + +++  L I+   + V+  R+P  I W ++ + Y++ES+GVFTT EKA LHL   + K+VIISAPS DAPMFV+GVNH KY   ++VVSNASCTTNC+APLAK+INDNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I  A++TAA  P  +GI+   +D +VSTD  GD HS IFD GAGIALND+FVKLV+WYDNE GYS+RV+DL+CHM
Sbjct:   17 FGRIGRLVTRAAVLSGKCEVVAINDPFIDLDYMAYMFKYDSTHGRFKGTVCVENGKLVINGKAVTVFQERDPSNIKWGDAGAVYVVESTGVFTTKEKAGLHLKGGA-KRVIISAPSADAPMFVVGVNHDKYDNSLHVVSNASCTTNCLAPLAKVINDNFGILEGLMTTVHAFTATQKTVDGPSGKLWRDGRGAGQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLSKPAKYDDIKAAIKTAAHGPM-KGILEYTEDQVVSTDFNGDTHSSIFDAGAGIALNDNFVKLVSWYDNECGYSHRVVDLMCHM 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gm10358 (predicted gene 10358 [Source:MGI Symbol;Acc:MGI:3708786])

HSP 1 Score: 403.29 bits (1035), Expect = 9.514e-140
Identity = 201/331 (60.73%), Postives = 254/331 (76.74%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VG+NGFGRIGRL+ RAA+   ++ +VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+  PI ++  R+P  I W  + +EY++ES+GVFTT+EKA  HL   + K+VIISAPS DAPMFVMGVNH KY   + +VSNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVS+ DLTC+L     YD+I K ++ A+  P  +GI+   +D +VS D   + HS  FD GAGIALND+FVKL++WYDNE+GYSNRV+DL+ +M
Sbjct:    1 MVKVGVNGFGRIGRLVTRAATCSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSIVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 402.134 bits (1032), Expect = 3.091e-139
Identity = 202/329 (61.40%), Postives = 252/329 (76.60%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            +VG+NGFGRIGRL+ RAA    ++ +VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+  PI ++  R+P  I W  + +EY++ES+GVFTT+EKA  HL   + K+VIISAPS DAPMFVMGVNH KY   + +VSNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I K ++ A+  P  +GI+   +D +VS D   + HS  FD GAGIALND+FVKL++WYDNE+GYSNRV+DL+ +M
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 402.134 bits (1032), Expect = 3.091e-139
Identity = 202/329 (61.40%), Postives = 252/329 (76.60%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            +VG+NGFGRIGRL+ RAA    ++ +VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+  PI ++  R+P  I W  + +EY++ES+GVFTT+EKA  HL   + K+VIISAPS DAPMFVMGVNH KY   + +VSNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I K ++ A+  P  +GI+   +D +VS D   + HS  FD GAGIALND+FVKL++WYDNE+GYSNRV+DL+ +M
Sbjct:    3 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gm3839 (predicted pseudogene 3839 [Source:MGI Symbol;Acc:MGI:3782011])

HSP 1 Score: 400.208 bits (1027), Expect = 1.349e-138
Identity = 201/331 (60.73%), Postives = 253/331 (76.44%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VG+NGFGRIGRL+ RAA    ++ +VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+  PI ++  R+P  I W  + +EY++ES+GVFTT+EKA  HL   + K+VIISAPS DAPMFVMGVNH KY   + +VSNASCTTNC++PLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I K ++ A+  P  +GI+   +D +VS D   + HS  FD GAGIALND+FVKL++WYDNE+GYSNRV+DL+ +M
Sbjct:    1 MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLSPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLENPAKYDDIKKVVKQASEGP-LKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Match: Gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:MGI Symbol;Acc:MGI:95640])

HSP 1 Score: 400.979 bits (1029), Expect = 1.613e-138
Identity = 202/329 (61.40%), Postives = 252/329 (76.60%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            +VG+NGFGRIGRL+ RAA    ++ +VA+NDPFI ++YM YM +YDSTHG+F   +  ++  L I+  PI ++  R+P  I W  + +EY++ES+GVFTT+EKA  HL   + K+VIISAPS DAPMFVMGVNH KY   + +VSNASCTTNC+APLAK+I+DNFGI E LMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLTC+L     YD+I K ++ A+  P  +GI+   +D +VS D   + HS  FD GAGIALND+FVKL++WYDNE+GYSNRV+DL+ +M
Sbjct:   29 KVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKAENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTCRLEKPAKYDDIKKVVKQASEGP-LKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIALNDNFVKLISWYDNEYGYSNRVVDLMAYM 355          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q00640|G3P_BLUGH (Glyceraldehyde-3-phosphate dehydrogenase OS=Blumeria graminis f. sp. hordei OX=62688 GN=GPD PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 6.764e-148
Identity = 217/339 (64.01%), Postives = 264/339 (77.88%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNS 1115
            M+  +VGINGFGRIGR++ R A+   ++ VVAVNDPFI  +Y AYMLKYDSTHGQF  ++   ++ L ++S  ++ YN RNPEEIPW+ + +EYI+ES+GVFTT EKA  HL   + KKVIISAPS DAPMFVMGVNH+ Y  D+ V+SNASCTTNC+APLAK+IND F I E LMTT+H+ TATQKTVD PS KDWRGGR A QNIIP+STGAAKAVGK+IP+L GKL+GMA RVPTANVSV DLTC++    TYD I KA++ AA   + +GI+   +D IVSTD+ G+ HS IFD  AGI+LND+FVKLVAWYDNEW YS RVIDLI ++   D S
Sbjct:    1 MAPIKVGINGFGRIGRIVFRNAAQSCEVEVVAVNDPFIEPEYAAYMLKYDSTHGQFNGDIQTVEDGLVVNSRNVKFYNKRNPEEIPWAETGAEYIVESTGVFTTTEKAKAHLKGGA-KKVIISAPSADAPMFVMGVNHKSYTTDLEVISNASCTTNCLAPLAKVINDEFTIIEGLMTTIHSYTATQKTVDGPSAKDWRGGRTAAQNIIPSSTGAAKAVGKVIPALNGKLTGMAMRVPTANVSVVDLTCRIEKSATYDEIKKAIKIAA-GNELQGILSYTEDEIVSTDLIGNNHSSIFDAKAGISLNDNFVKLVAWYDNEWAYSRRVIDLISYIAGKDGS 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q9HGY7|G3P_ASPOR (Glyceraldehyde-3-phosphate dehydrogenase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=gpdA PE=2 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 1.361e-147
Identity = 212/337 (62.91%), Postives = 262/337 (77.74%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            M+ P+VGINGFGRIGR++ R A     ++VVAVNDPFI   Y AYMLKYDSTHG+F+  +   D  L ++   I  +  R+P  IPW ++ + YI+ES+GVFTT EKAS HL     KKVIISAPS DAPMFVMGVN+++YK D+NV+SNASCTTNC+APLAK+INDNFG+ E LMTTVH+ TATQKTVDAPS KDWRGGR A QNIIP+STGAAKAVGK+IPSL GKL+GM+ RVPTANVSV DLTC+     TY++I K ++ A+   + +GI+   +D IVSTD+ GD HS IFD  AGIALN+ F+KLV+WYDNEWGYS RV+DLI ++ ++D
Sbjct:    1 MATPKVGINGFGRIGRIVFRNAIASGDVDVVAVNDPFIETHYAAYMLKYDSTHGRFQGTIETYDEGLIVNGKKIRFFAERDPAAIPWGSAGAAYIVESTGVFTTTEKASAHL-KGGAKKVIISAPSADAPMFVMGVNNKEYKTDINVLSNASCTTNCLAPLAKVINDNFGLVEGLMTTVHSYTATQKTVDAPSAKDWRGGRTAAQNIIPSSTGAAKAVGKVIPSLNGKLTGMSMRVPTANVSVVDLTCRTEKAVTYEDIKKTIKAASEEGELKGILGYTEDDIVSTDLIGDAHSSIFDAKAGIALNEHFIKLVSWYDNEWGYSRRVVDLIAYISKVD 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P53430|G3P_MONPU (Glyceraldehyde-3-phosphate dehydrogenase OS=Monascus purpureus OX=5098 GN=GPD1 PE=3 SV=3)

HSP 1 Score: 422.935 bits (1086), Expect = 1.467e-146
Identity = 211/337 (62.61%), Postives = 262/337 (77.74%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            M +P+VGINGFGRIGR++ R A     +++VAVNDPFI + Y AYMLKYDSTHG+F   +    N L ++   I+ Y  R+P +IPWS + +EY++ES+GVFT  EKASLHL   + KKVIISAPS D+PMFVMGVN+ +Y  D+ V+SNASCTTNC+APLAK+IND FGI E LMTTVH+ TATQK VD PSNKDWRGGR A QNIIP+STGAAKAVGK+IPSL GKL+GM+ RVPT+NVSV DLT +L    TYD I +A++ A+  P  +G++   +D +VS+D+ GDPHS IFD  AGIALN +FVKLV+WYDNEWGYS RVIDLI ++ Q+D
Sbjct:    1 MVVPKVGINGFGRIGRIVFRNAIEHEGVDIVAVNDPFIEVHYAAYMLKYDSTHGRFNGTVEFDGNTLIVNGKKIKFYAERDPAQIPWSETGAEYVVESTGVFTKQEKASLHLKGGA-KKVIISAPSSDSPMFVMGVNNDQYTKDITVLSNASCTTNCLAPLAKVINDKFGIVEGLMTTVHSYTATQKVVDGPSNKDWRGGRTAAQNIIPSSTGAAKAVGKVIPSLNGKLTGMSMRVPTSNVSVVDLTARLEKAATYDEIKQAVKEASEGP-LKGVLGYTEDDVVSSDLNGDPHSSIFDAKAGIALNSNFVKLVSWYDNEWGYSRRVIDLIAYIAQVD 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|Q8J1H3|G3P_COCP7 (Glyceraldehyde-3-phosphate dehydrogenase OS=Coccidioides posadasii (strain C735) OX=222929 GN=GPD PE=3 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 2.036e-146
Identity = 211/333 (63.36%), Postives = 260/333 (78.08%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            +VGINGFGRIGR++ R A    ++ +VAVNDPFI   Y AYMLKYDSTHG+F+ ++   +N L +D   +  Y  R+P  IPW+ + ++Y+IES+GVFTT EKAS HL     KKVIISAPS DAPMFVMGVN+  YK D+ V+SNASCTTNC+APLAK++NDNFG+ E LMTTVH+ TATQKTVD PS+KDWRGGR A QNIIP+STGAAKAVGK+IPSL GKL+GM+ RVPT+NVSV DLTC+     TYD I +AM+  A+  + +GI+   +D +VS+D+ GDPHSCIFD  AGIALND F+KLVAWYDNEWGYS RVIDLI ++  +D
Sbjct:    4 KVGINGFGRIGRIVFRNAVEHPEVEIVAVNDPFIETHYAAYMLKYDSTHGRFKGDVKFSENGLDVDGKHVRFYQERDPANIPWAETGADYVIESTGVFTTTEKASAHLK-GGAKKVIISAPSADAPMFVMGVNNETYKSDIKVLSNASCTTNCLAPLAKVVNDNFGLVEGLMTTVHSYTATQKTVDGPSSKDWRGGRTAAQNIIPSSTGAAKAVGKVIPSLNGKLTGMSMRVPTSNVSVVDLTCRTDKSVTYDQIKEAMKK-ASANELKGIMSYSEDALVSSDLNGDPHSCIFDATAGIALNDHFIKLVAWYDNEWGYSRRVIDLIAYIAGVD 334          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Match: sp|P78958|G3P1_SCHPO (Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tdh1 PE=1 SV=1)

HSP 1 Score: 422.165 bits (1084), Expect = 2.668e-146
Identity = 214/338 (63.31%), Postives = 264/338 (78.11%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 1112
            M++P+VGINGFGRIGR++LR A   + I VVA+NDPFI ++YMAYM KYDSTHG+F  ++ IKD  L ID + I+V+N R+P +I WS S ++Y+IES+GVFTT E AS HL   + K+VIISAPS DAPM+V+GVN  K+ P   V+SNASCTTNC+APLAK+IND FGI+E LMTTVHATTATQKTVD PS KDWRGGRGA  NIIP+STGAAKAVGK+IP+L GKL+GMAFRVPT +VSV DLT KL   T Y++I  A++ A+  P  +G++   +D +VSTD CGD HS IFD  AGI L+  FVKLV+WYDNEWGYS RV+DL+ +    DN
Sbjct:    1 MAIPKVGINGFGRIGRIVLRNALVAKTIQVVAINDPFIDLEYMAYMFKYDSTHGRFDGSVEIKDGKLVIDGNAIDVHNERDPADIKWSTSGADYVIESTGVFTTQETASAHLKGGA-KRVIISAPSKDAPMYVVGVNEEKFNPSEKVISNASCTTNCLAPLAKVINDTFGIEEGLMTTVHATTATQKTVDGPSKKDWRGGRGASANIIPSSTGAAKAVGKVIPALNGKLTGMAFRVPTPDVSVVDLTVKLAKPTNYEDIKAAIKAASEGPM-KGVLGYTEDAVVSTDFCGDNHSSIFDASAGIQLSPQFVKLVSWYDNEWGYSRRVVDLVAYTAAKDN 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A0A7RPV5 (Glyceraldehyde-3-phosphate dehydrogenase OS=Littorina littorea OX=31216 GN=GAPDH PE=2 SV=1)

HSP 1 Score: 436.417 bits (1121), Expect = 1.875e-149
Identity = 216/335 (64.48%), Postives = 264/335 (78.81%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNS 1115
            +VGINGFGRIGRL+LRAA   + + VVAVNDPFI + YM YM +YDSTHGQ++  + +KDN L +D   I V+N ++P  IPW  + ++YI+ES+GVFTTI+KAS HL   + KKVIISAPS DAPM+V+GVN + Y  D NVVSNASCTTNC+APLA +IND FGI+E LMTTVHA TATQKTVD PS+KDWRGGRGA+QNIIP+STGAAKAVGK+IP L GKL+GMAFRVPTA+VSV DLT +L     YD I KAM+ AA  P  +GI+   +D +VS D  GDP S IFD  AGI L+D+FVKL++WYDNE+GYSNRV++LI HM ++D S
Sbjct:    4 KVGINGFGRIGRLVLRAALQNKDVTVVAVNDPFIDLAYMVYMFRYDSTHGQYKGTIEVKDNKLVVDGQAIAVFNEKDPSAIPWGTAGADYIVESTGVFTTIDKASAHLKGGA-KKVIISAPSADAPMYVIGVNEKSYTKDKNVVSNASCTTNCLAPLAMVINDKFGIEEGLMTTVHAATATQKTVDGPSSKDWRGGRGAYQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTADVSVVDLTVRLKKGAKYDEIKKAMKEAADGP-LKGILGYTEDDVVSMDFLGDPRSSIFDAKAGIQLSDTFVKLISWYDNEYGYSNRVVELITHMAKVDTS 336          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A1Y2GQE4 (Glyceraldehyde-3-phosphate dehydrogenase OS=Lobosporangium transversale OX=64571 GN=BCR41DRAFT_351566 PE=3 SV=1)

HSP 1 Score: 434.491 bits (1116), Expect = 1.122e-148
Identity = 222/334 (66.47%), Postives = 264/334 (79.04%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 1112
            ++GINGFGRIGRL+LRAA   +Q+ VVAVNDPFI  DYM YM KYDSTHG+++ ++  KD  L +D H I V+  +NPEEIPW +  ++Y++ES+GVFTT EKAS HL     KKVIISAPS DAPMFV GVN   YKP+  VVSNASCTTNC+APLAK+I+DNFGI EALMTTVHATTATQKTVD PSNKDWRGGRGA  NIIP+STGAAKAVGK+IP L GKL+GMAFRVPT++VSV DLT +L    +Y++I  A++ AA     +GI+   +D +VSTD  GD HS +FD GAGIALND+FVKLVAWYDNE+GYSNR IDLI +M   DN
Sbjct:    4 KIGINGFGRIGRLVLRAALQNKQVEVVAVNDPFIDADYMVYMFKYDSTHGRYKGHVEAKDGHLIVDGHKIAVHGFKNPEEIPWGSDGADYVVESTGVFTTTEKASAHLK-GGAKKVIISAPSADAPMFVCGVNLDAYKPEYKVVSNASCTTNCLAPLAKVIHDNFGITEALMTTVHATTATQKTVDGPSNKDWRGGRGAGANIIPSSTGAAKAVGKVIPDLNGKLTGMAFRVPTSDVSVVDLTARLSKPASYNDIKAAIKKAAEG-DMKGILAYTEDHVVSTDFVGDTHSSVFDAGAGIALNDTFVKLVAWYDNEYGYSNRCIDLILYMASKDN 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A355FR12 (Glyceraldehyde-3-phosphate dehydrogenase OS=Firmicutes bacterium OX=1879010 GN=gap PE=3 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 6.114e-148
Identity = 219/334 (65.57%), Postives = 260/334 (77.84%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 1112
            +VGINGFGRIGRL+ RAA    Q+ VV +NDPFI +DYM YMLKYDS HG+F+  + ++ + L ++   + V+    PEEIPWS+  +EYI+ES+GVFT  EKAS H  +   KKVIISAPS DAPMFVMGVNH KY  DMNVVSNASCTTNC+APLAK+I+DNFGI E LMTTVHATTATQKTVD PS KDWRGGR A  NIIP+STGAAKAVGK+IP L GKL+GM+FRVPT NVSV DLTC+L    +YD I  A++ AA   + +GI+   +D +VSTD   D H+CIFD  AGIALND+FVKLVAWYDNEWGYSN+V+DLICHM  +D 
Sbjct:    4 KVGINGFGRIGRLVFRAAVDNPQVEVVGINDPFIDLDYMVYMLKYDSVHGRFQGEVKVEGDHLVVNGKKVAVFGSMKPEEIPWSSCGAEYIVESTGVFTVTEKASAHF-EGGAKKVIISAPSKDAPMFVMGVNHDKYTKDMNVVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHATTATQKTVDGPSKKDWRGGRSASANIIPSSTGAAKAVGKVIPELNGKLTGMSFRVPTINVSVVDLTCRLEKGASYDEIKAAVKNAAE-NELKGIMDYTEDDVVSTDFISDSHTCIFDAKAGIALNDNFVKLVAWYDNEWGYSNKVLDLICHMAAVDQ 335          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A183B816 (Glyceraldehyde-3-phosphate dehydrogenase OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS15351 PE=3 SV=1)

HSP 1 Score: 429.098 bits (1102), Expect = 1.439e-146
Identity = 219/339 (64.60%), Postives = 261/339 (76.99%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNS 1115
            M  PRVGINGFGRIGRL+LRAA     ++VVA+NDPFI +DYM YMLKYDSTHG+F   + I    L +    I V+N R+P +IPW  S++EY++ES+GVFTTI+KA  H++  + KKV+ISAPS DAPMFV GVNH KY  DM VVSNASCTTNC+APLAK+IND FGI E LMTTVH+ TATQK VD PSNK WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPTA+VSV DLTC+L     YD I  A++ AA  P  +G++   +D IVSTD+ G   S  FD  AGI+LND+FVKL+AWYDNE+GYS RV+DLI HMF +D+S
Sbjct:    1 MGKPRVGINGFGRIGRLVLRAAIEKGTVDVVAINDPFIELDYMRYMLKYDSTHGRFPHEIGIAGGKLTVKGAHIAVHNERDPTKIPWGESQAEYVVESTGVFTTIDKAKAHISGGA-KKVVISAPSADAPMFVFGVNHEKYSKDMQVVSNASCTTNCLAPLAKVINDKFGIVEGLMTTVHSYTATQKVVDGPSNKAWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTADVSVVDLTCRLAKAAKYDEIKAAVKAAADGPM-KGVLDYTEDLIVSTDLLGSHVSSTFDAQAGISLNDNFVKLIAWYDNEFGYSCRVVDLITHMFHVDHS 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Match: A0A0D2C2M2 (Glyceraldehyde-3-phosphate dehydrogenase OS=Exophiala oligosperma OX=215243 GN=PV06_05041 PE=3 SV=1)

HSP 1 Score: 428.713 bits (1101), Expect = 1.870e-146
Identity = 215/333 (64.56%), Postives = 268/333 (80.48%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQID 1109
            +VGINGFGRIGR++ R A     ++VVAVNDPFI   Y AYMLKYDSTHGQF+  + +K + L ++   ++ Y  R+P EIPWS + +EYI+ES+GVFTT EKAS HL   + KKV+ISAPS DAPMFVMGVN+++YKPD+ V+SNASCTTNC+APLAK+INDNFG++E LMTT+H+ TATQKTVD PS KDWRGGR A QNIIP+STGAAKAVGK+IPSL GKL+GM+ RVPT+NVSV DLTC L    +Y+ I KA++ AA+  + +GI+   +D IVSTD+ GDPHS IFDV AGIALND FVKLV+WYDNEWGYS RV+DL+ ++ ++D
Sbjct:    4 QVGINGFGRIGRIVYRNALEHDDVHVVAVNDPFIEPKYAAYMLKYDSTHGQFKGTIEVKSDSLVVNGKEVKFYMKRDPAEIPWSETGAEYIVESTGVFTTTEKASAHLKGGA-KKVVISAPSADAPMFVMGVNNKEYKPDIPVISNASCTTNCLAPLAKVINDNFGMKEGLMTTIHSYTATQKTVDGPSAKDWRGGRTAAQNIIPSSTGAAKAVGKVIPSLNGKLTGMSMRVPTSNVSVVDLTCVLEKPASYEEIKKAIK-AASEGELKGILGYTEDDIVSTDLNGDPHSSIFDVKAGIALNDHFVKLVSWYDNEWGYSRRVLDLLAYIAKVD 334          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:103027606])

HSP 1 Score: 412.535 bits (1059), Expect = 1.768e-143
Identity = 211/331 (63.75%), Postives = 254/331 (76.74%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VGINGFGRIGRL+ RAA + +++ VVA+NDPFI +DYM YM KYDSTHG+++  +  +   L ID H I V++ R+P  I W ++ ++Y++ES+GVFTTIEKAS HL   + K+VIISAPS DAPMFVMGVNH KY   + VVSNASCTTNC+APLAK+INDNF I E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLT +L     YD+I K ++ A+  P  +GI+   +  +VSTD  GD  S IFD GAGIALND FVKLV WYDNE+GYSNRV DL+ HM
Sbjct:    1 MVKVGINGFGRIGRLVTRAAFHSKKVEVVAINDPFIDLDYMVYMFKYDSTHGKYKGEVKAEGGKLVIDGHAITVFSERDPANIKWGDAGADYVVESTGVFTTIEKASAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLKVVSNASCTTNCLAPLAKVINDNFVIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPM-KGILGYTEHQVVSTDFNGDERSSIFDAGAGIALNDHFVKLVTWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: ENSAMXT00000050002.1 (glyceraldehyde-3-phosphate dehydrogenase-like [Source:NCBI gene;Acc:103041091])

HSP 1 Score: 406.371 bits (1043), Expect = 4.190e-141
Identity = 206/329 (62.61%), Postives = 256/329 (77.81%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            +VGINGFGRIGRL+ R A    ++++VA+NDPFI I+YM YM  YDSTHG+F+  +  ++  LFI++HPI V++ ++P  I W+++ +EY++ES+GVFTT+EKAS HL   + K+VIISAPS DAPMFVMGVN   Y   M V+SNASCTTNC+APLAK+I+DNFGI E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLT +L     Y+ I K ++ AA  P  RGI+   D+P+VSTD  GD HS  FD  AGIAL+D+FVKLV WYDNE+GYS+RVIDL+ ++
Sbjct:    3 KVGINGFGRIGRLVTRVAFLTEKVDIVAINDPFIDIEYMVYMFTYDSTHGRFKGEVKSENGKLFINNHPITVFSEKDPANIKWADTGAEYVVESTGVFTTVEKASAHLKGGA-KRVIISAPSADAPMFVMGVNQNVYDKSMKVISNASCTTNCLAPLAKVIHDNFGIIEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYERIKKVVKAAAEGP-LRGILGYTDEPLVSTDFNGDSHSSYFDADAGIALSDNFVKLVTWYDNEYGYSSRVIDLMVYI 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 389.423 bits (999), Expect = 2.248e-134
Identity = 201/329 (61.09%), Postives = 251/329 (76.29%), Query Frame = 3
Query:  114 VGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            VGINGFGRIGRL+LRA    + I V A+NDPFI + YM YM KYDSTHG++   +  ++  L +D   I V+    P EIPW ++ + Y++ES+GVF ++EKAS H+     K+V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVP A+VSV DLTC+L    +Y +I +A++ AA  P  +G +   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS+RV DL+ +M
Sbjct:    6 VGINGFGRIGRLVLRAC-LQKGIKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHI-QGGAKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGP-LKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 389.423 bits (999), Expect = 2.248e-134
Identity = 201/329 (61.09%), Postives = 251/329 (76.29%), Query Frame = 3
Query:  114 VGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            VGINGFGRIGRL+LRA    + I V A+NDPFI + YM YM KYDSTHG++   +  ++  L +D   I V+    P EIPW ++ + Y++ES+GVF ++EKAS H+     K+V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVP A+VSV DLTC+L    +Y +I +A++ AA  P  +G +   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS+RV DL+ +M
Sbjct:    6 VGINGFGRIGRLVLRAC-LQKGIKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHI-QGGAKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGP-LKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:111192112])

HSP 1 Score: 389.423 bits (999), Expect = 2.248e-134
Identity = 201/329 (61.09%), Postives = 251/329 (76.29%), Query Frame = 3
Query:  114 VGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            VGINGFGRIGRL+LRA    + I V A+NDPFI + YM YM KYDSTHG++   +  ++  L +D   I V+    P EIPW ++ + Y++ES+GVF ++EKAS H+     K+V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVP A+VSV DLTC+L    +Y +I +A++ AA  P  +G +   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS+RV DL+ +M
Sbjct:    6 VGINGFGRIGRLVLRAC-LQKGIKVTAINDPFIDLQYMVYMFKYDSTHGRYHGEVRQENGKLIVDDQAISVFQCMKPAEIPWGDAGAVYVVESTGVFLSVEKASSHI-QGGAKRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPVADVSVVDLTCRLTKPASYADIKEAVKKAAHGP-LKGFLGYTEDSVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEFGYSHRVADLLLYM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 377.481 bits (968), Expect = 9.717e-131
Identity = 196/305 (64.26%), Postives = 232/305 (76.07%), Query Frame = 3
Query:  114 VGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFV 1028
            +GINGFGRIGRL+ RAA     INVVA+NDPFI ++YM YM KYDSTHG+F+ ++ ++D  L I+ H + VY+ R+P  IPW    ++Y++ES+GVFTTI+KASLHL   + K VIISAPS DAPMFVMGVNH KY P + VVSNASCTTNC+APLAK+INDNFGI E LMTTVH+ TATQKTVD PS K WR GRGA QNIIPASTGAAKAVG +IP L GKL+GMAFRVPT NVSV DLTC+L    +YD I   +R A+     +GI+   +D +VSTD  GD HS IFD  AGIALN  FV
Sbjct:    4 IGINGFGRIGRLVARAAVQKEDINVVAINDPFIDLEYMVYMFKYDSTHGRFKGDVKVEDGKLLINGHAVSVYSERDPANIPWGKHGADYVVESTGVFTTIDKASLHLKGGA-KHVIISAPSADAPMFVMGVNHEKYDPSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHSYTATQKTVDGPSAKLWRDGRGASQNIIPASTGAAKAVGMVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAKPASYDEIKAKVREASKG-DLKGILGYTEDLVVSTDFNGDTHSSIFDAQAGIALNKQFV 306          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:317743])

HSP 1 Score: 327.791 bits (839), Expect = 5.002e-112
Identity = 169/250 (67.60%), Postives = 197/250 (78.80%), Query Frame = 3
Query:  120 INGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYD 869
            IN FGRIGRL+ RAA     INVVA+NDPFI ++YM YM KYDSTHG+F+ ++ ++D  L I+ H + VY+ R+P  IPW    ++Y++ES+GVFTTI+KASLHL   + K VIISAPS DAPMFVMGVNH KY P + VVSNASCTTNC+APLAK+INDNFGI E LMTTVH+ TATQKTVD PS K WR GRGA QNIIPASTGAAKAVG +IP L GKL+GMAFRVPT NVSV DLTC+L    T D
Sbjct:    7 INQFGRIGRLVARAAVQKEDINVVAINDPFIDLEYMVYMFKYDSTHGRFKGDVKVEDGKLLINGHAVSVYSERDPANIPWGKHGADYVVESTGVFTTIDKASLHLKGGA-KHVIISAPSADAPMFVMGVNHEKYDPSLKVVSNASCTTNCLAPLAKVINDNFGIVEGLMTTVHSYTATQKTVDGPSAKLWRDGRGASQNIIPASTGAAKAVGMVIPELNGKLTGMAFRVPTPNVSVVDLTCRLAKPVTRD 255          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH1 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 1; involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall; protein abundance increases in response to DNA replication stress; GAPDH-derived antimicrobial peptides secreted by S. cerevisiae are active against a wide variety of wine-related yeasts and bateria [Source:SGD;Acc:S000003588])

HSP 1 Score: 387.111 bits (993), Expect = 2.110e-134
Identity = 196/329 (59.57%), Postives = 246/329 (74.77%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            R+ INGFGRIGRL+LR A   + I VVAVNDPFI  DY AYM+KYDSTHG+++  +S  D  + ID   I  Y  R+P  +PW + K +  ++S+GVF  ++ A  H+ D+  KKV+I+APS  APMFV+GVNH KY PD  +VSNASCTTNC+APLAK+IND FGI+E LMTTVH+ TATQKTVD PS+KDWRGGR A  NIIP+STGAAKAVGK++P L GKL+GMAFRVPT +VSV DLT KL    TYD I KA++ AA  P  +G++   +D +VS+D  GD H+ IFD  AGI L+  FVKL++WYDNE+GYS RV+DLI ++
Sbjct:    3 RIAINGFGRIGRLVLRLALQRKDIEVVAVNDPFISNDYAAYMVKYDSTHGRYKGTVSHDDKHIIIDGVKIATYQERDPANLPWGSLKIDVAVDSTGVFKELDTAQKHI-DAGAKKVVITAPSSSAPMFVVGVNHTKYTPDKKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLEKEATYDQIKKAVKAAAEGPM-KGVLGYTEDAVVSSDFLGDTHASIFDASAGIQLSPKFVKLISWYDNEYGYSARVVDLIEYV 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH3 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 3; involved in glycolysis and gluconeogenesis; tetramer that catalyzes the reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in the cytoplasm and cell wall; GAPDH-derived antimicrobial peptides secreted by S. cerevisiae are active against a wide variety of wine-related yeasts and bacteria; binds AU-rich RNA [Source:SGD;Acc:S000003424])

HSP 1 Score: 381.719 bits (979), Expect = 2.884e-132
Identity = 194/329 (58.97%), Postives = 242/329 (73.56%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            RV INGFGRIGRL++R A     + VVA+NDPFI  DY AYM KYDSTHG++   +S  D  + +D   I  Y  R+P  +PW +S  +  I+S+GVF  ++ A  H+ D+  KKV+I+APS  APMFVMGVN  KY  D+ +VSNASCTTNC+APLAK+IND FGI+E LMTTVH+ TATQKTVD PS+KDWRGGR A  NIIP+STGAAKAVGK++P L GKL+GMAFRVPT +VSV DLT KL   TTYD I K ++ AA   + +G++   +D +VS+D  GD HS IFD  AGI L+  FVKLV+WYDNE+GYS RV+DL+ H+
Sbjct:    3 RVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPANLPWGSSNVDIAIDSTGVFKELDTAQKHI-DAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEG-KLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHV 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Match: TDH2 (Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), isozyme 2; involved in glycolysis and gluconeogenesis; tetramer that catalyzes reaction of glyceraldehyde-3-phosphate to 1,3 bis-phosphoglycerate; detected in cytoplasm and cell wall; protein abundance increases in response to DNA replication stress; GAPDH-derived antimicrobial peptides are active against a wide variety of wine-related yeasts and bateria; TDH2 has a paralog, TDH3, that arose from the whole genome duplication [Source:SGD;Acc:S000003769])

HSP 1 Score: 380.948 bits (977), Expect = 6.186e-132
Identity = 192/331 (58.01%), Postives = 245/331 (74.02%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + RV INGFGRIGRL++R A   + + VVA+NDPFI  DY AYM KYDSTHG++   +S  D  + +D H I  +  R+P  +PW++   +  I+S+GVF  ++ A  H+ D+  KKV+I+APS  APMFVMGVN  KY  D+ +VSNASCTTNC+APLAK+IND FGI+E LMTTVH+ TATQKTVD PS+KDWRGGR A  NIIP+STGAAKAVGK++P L GKL+GMAFRVPT +VSV DLT KL   TTYD I K ++ AA   + +G++   +D +VS+D  GD +S IFD  AGI L+  FVKLV+WYDNE+GYS RV+DL+ H+
Sbjct:    1 MVRVAINGFGRIGRLVMRIALQRKNVEVVALNDPFISNDYSAYMFKYDSTHGRYAGEVSHDDKHIIVDGHKIATFQERDPANLPWASLNIDIAIDSTGVFKELDTAQKHI-DAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKVINDAFGIEEGLMTTVHSMTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVVDLTVKLNKETTYDEIKKVVKAAAEG-KLKGVLGYTEDAVVSSDFLGDSNSSIFDAAAGIQLSPKFVKLVSWYDNEYGYSTRVVDLVEHV 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO40842 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7S5Y2])

HSP 1 Score: 399.823 bits (1026), Expect = 6.470e-139
Identity = 197/327 (60.24%), Postives = 247/327 (75.54%), Query Frame = 3
Query:  117 GINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            GINGFGRIGRL+ RA+     + +VA+NDPFI +DYM YM KYDSTHG+F+  +  KD  L I+  P+ V+  ++P +IPW  + ++Y++ES+GVFTT+EKA  HL   + KKVIISAPS DAPMFVMGVNH KY P M VVSNASCTTNC+APL K+INDNFG++E LMTT+HA TATQKTVD PS K+WR GRGA QN+IPASTGAAKAVGK+IP + GKL+GMAFRVP A+VSV DLTC+L     Y+ I   ++ A+   +    +   +D +VSTD  G+  S +FD  AGI LND FVKLV WYDNE+GYS+RV+DL+ +M
Sbjct:    5 GINGFGRIGRLVCRASLERDDVQIVAINDPFIDLDYMVYMFKYDSTHGRFKGTVEAKDGKLVINGKPVSVFACKDPTQIPWGETGADYVVESTGVFTTLEKAGFHLKGGA-KKVIISAPSADAPMFVMGVNHEKYDPSMTVVSNASCTTNCLAPLVKVINDNFGLEEGLMTTIHAYTATQKTVDGPSAKNWRDGRGAHQNVIPASTGAAKAVGKVIPEVNGKLTGMAFRVPVADVSVVDLTCRLKKPAKYEEIKAVVKKASESKEMGQYLGYTEDQVVSTDFIGERVSSVFDARAGIQLNDKFVKLVTWYDNEYGYSHRVVDLMRYM 330          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO29412 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7T3Q4])

HSP 1 Score: 200.675 bits (509), Expect = 6.490e-62
Identity = 116/268 (43.28%), Postives = 166/268 (61.94%), Query Frame = 3
Query:  297 LFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDA-PMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            ++ID   I++++ R+P ++ W +   + + E +G FT  E A++HL   + KKV++SAP+  A    V GVNH     +  VVSNASCTTNC+APLAK++N++ GI E +MTT+HA T  Q   D  SN  +R  R A  ++IP  TGAA+AVG ++P L GKLSG+A RVPTANVS+ DL+      T  + I   MR A+    +  I+   + P+VS D    P SCIFD      +++  +K+ AWYDNEWG+SNR++D    M
Sbjct:    1 MYIDGDAIQIFSERDPHKLDWKSLDIDIVFECTGRFTEREAAAVHLAQGA-KKVLVSAPAKGADATIVYGVNHDILTAEHTVVSNASCTTNCLAPLAKVLNEHIGITEGMMTTIHAYTNDQHLSDVYSNDIYR-ARAATLSMIPTRTGAAEAVGLVLPELKGKLSGLAVRVPTANVSLVDLSFTPARATHAEEINHLMREASQ-GSFSNIIEYNELPLVSVDFNHHPASCIFD-STQTRVSEGLIKVFAWYDNEWGFSNRMLDTALAM 264          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Match: EDO25919 (Glyceraldehyde-3-phosphate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:A7TDD3])

HSP 1 Score: 149.828 bits (377), Expect = 1.941e-42
Identity = 98/262 (37.40%), Postives = 146/262 (55.73%), Query Frame = 3
Query:  342 PEEIPWSNSKSE--YIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYD---NIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSF-VKLVAWYDNEWGYSNRVIDLICHMFQI 1106
            PEEI ++    E   +I+++G FTT E    HLT     KV+++AP    P  V GVNH ++ PD +N+ S ASCTTN + P+  +I D  G+ +  + T+HA T  Q  VD   +K +R GR A  N++   TGA  AV K +PSL GKL+  A RVP  N S+  L  ++   TT +   NI+K  + A        I   +++ +VS+D+ G P   I+D  A I   D   + +  WYDNE+GYS++VI L  ++ ++
Sbjct:   12 PEEIDYTQYGIEDALVIDNTGAFTTEEALQRHLTSKGATKVLLTAPGKGVPNIVYGVNHTEFNPDEVNIYSAASCTTNAITPILNVIEDTLGVTKGHIETIHAYTNDQNLVDN-MHKKYRRGRSAALNMVITETGAGSAVAKALPSLAGKLTSNAIRVPVPNGSLVVLNLEVDKTTTVEELNNIIK--KYALEGKLVEQIKYSLNNELVSSDIVGTPAPSIYDSNATIVSADGKNIVMYVWYDNEYGYSHQVIRLAKYISKV 270          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:101172760])

HSP 1 Score: 415.616 bits (1067), Expect = 1.110e-144
Identity = 210/331 (63.44%), Postives = 254/331 (76.74%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VGINGFGRIGRL+ RAA   +++ +VA+NDPFI +DYM YM KYDSTH +F+  +  +   L ID H I V++ R+P  I W  + ++Y++ES+GVFTTIEKAS HL   + K+VIISAPS DAPMFVMGVNH KY   + VVSNASCTTNC+APLAK+++DNFGI E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLT +L     YD+I K ++ A+  P  +G +   +D +VSTD  GD HS IFD GAGIALND FVKLV+WYDNE+GYSNRV DL+ HM
Sbjct:    1 MVKVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHNRFKGEVKAEGGKLVIDGHQITVFHERDPTNIKWGEAGAQYVVESTGVFTTIEKASAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVVHDNFGIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPM-KGFLGYTEDQVVSTDFNGDTHSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdh (glyceraldehyde-3-phosphate dehydrogenase [Source:NCBI gene;Acc:101172760])

HSP 1 Score: 415.616 bits (1067), Expect = 1.110e-144
Identity = 210/331 (63.44%), Postives = 254/331 (76.74%), Query Frame = 3
Query:  105 LPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            + +VGINGFGRIGRL+ RAA   +++ +VA+NDPFI +DYM YM KYDSTH +F+  +  +   L ID H I V++ R+P  I W  + ++Y++ES+GVFTTIEKAS HL   + K+VIISAPS DAPMFVMGVNH KY   + VVSNASCTTNC+APLAK+++DNFGI E LM+TVHA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVGK+IP L GKL+GMAFRVPT NVSV DLT +L     YD+I K ++ A+  P  +G +   +D +VSTD  GD HS IFD GAGIALND FVKLV+WYDNE+GYSNRV DL+ HM
Sbjct:    1 MVKVGINGFGRIGRLVTRAAFTSKKVEIVAINDPFIDLDYMVYMFKYDSTHNRFKGEVKAEGGKLVIDGHQITVFHERDPTNIKWGEAGAQYVVESTGVFTTIEKASAHLKGGA-KRVIISAPSADAPMFVMGVNHEKYDNSLTVVSNASCTTNCLAPLAKVVHDNFGIVEGLMSTVHAITATQKTVDGPSGKLWRDGRGASQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDLTVRLEKPAKYDDIKKVVKAASEGPM-KGFLGYTEDQVVSTDFNGDTHSSIFDAGAGIALNDHFVKLVSWYDNEFGYSNRVCDLMAHM 329          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:101167730])

HSP 1 Score: 398.667 bits (1023), Expect = 5.796e-138
Identity = 205/334 (61.38%), Postives = 257/334 (76.95%), Query Frame = 3
Query:   99 MSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M+   VGINGFGRIGRL+LRA    + I VVA+NDPFI + YM YM KYDSTHG++   +S +D  L +D + I V+    P EIPW ++ ++Y++ES+GVF ++EKASLH+     ++V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA  NIIPASTGAAKAVGK+IP+L GKL+GMAFRVP A+VSV DLTC+L    +Y  I +A++ AA  P  +GI+   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS RV DL+ +M
Sbjct:    1 MADLHVGINGFGRIGRLVLRAC-LQKGIKVVAINDPFIDLQYMVYMFKYDSTHGRYHGEVSHEDGKLIVDGNAISVFQCMKPAEIPWGSAGAKYVVESTGVFLSVEKASLHI-QGGAQRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHANIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVADVSVVDLTCRLSKAASYGEIKEAVKKAAHGPM-KGILGYTEDQVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEYGYSTRVADLLLYM 331          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Match: gapdhs (glyceraldehyde-3-phosphate dehydrogenase 2 [Source:NCBI gene;Acc:101167730])

HSP 1 Score: 350.903 bits (899), Expect = 7.339e-120
Identity = 179/292 (61.30%), Postives = 226/292 (77.40%), Query Frame = 3
Query:  225 MAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPD-MNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHM 1097
            M YM KYDSTHG++   +S +D  L +D + I V+    P EIPW ++ ++Y++ES+GVF ++EKASLH+     ++V++SAPS DAPMFVMGVN  KY P  M +VSNASCTTNC+APLAK+I+DNFGI+EALMTTVHA TATQKTVD PS K WR GRGA  NIIPASTGAAKAVGK+IP+L GKL+GMAFRVP A+VSV DLTC+L    +Y  I +A++ AA  P  +GI+   +D +VS+D  GD HS IFD GAGI+LND+FVKL++WYDNE+GYS RV DL+ +M
Sbjct:    1 MVYMFKYDSTHGRYHGEVSHEDGKLIVDGNAISVFQCMKPAEIPWGSAGAKYVVESTGVFLSVEKASLHI-QGGAQRVVVSAPSPDAPMFVMGVNEDKYDPSSMTIVSNASCTTNCLAPLAKVIHDNFGIEEALMTTVHAYTATQKTVDGPSAKAWRDGRGAHANIIPASTGAAKAVGKVIPALNGKLTGMAFRVPVADVSVVDLTCRLSKAASYGEIKEAVKKAAHGPM-KGILGYTEDQVVSSDFIGDTHSSIFDAGAGISLNDNFVKLISWYDNEYGYSTRVADLLLYM 290          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000012145.1 (SMESG000012145.1)

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 347/362 (95.86%), Postives = 347/362 (95.86%), Query Frame = 3
Query:   36 MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNSYN 1121
            MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNC               EALMTTVHATTATQKTVDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNSYN
Sbjct:    1 MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNC---------------EALMTTVHATTATQKTVDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNSYN 347          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000012145.1 (SMESG000012145.1)

HSP 1 Score: 626.32 bits (1614), Expect = 0.000e+0
Identity = 320/336 (95.24%), Postives = 321/336 (95.54%), Query Frame = 3
Query:   36 MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAW 1043
            MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNC               EALMTTVHATTATQKTVDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVA+
Sbjct:    1 MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNC---------------EALMTTVHATTATQKTVDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAF 321          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000034925.1 (SMESG000034925.1)

HSP 1 Score: 428.328 bits (1100), Expect = 8.410e-150
Identity = 217/338 (64.20%), Postives = 265/338 (78.40%), Query Frame = 3
Query:  102 SLPRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNS 1115
            S P+VGINGFGRIGRL+LRA    + +  V VNDPF+ +DYM YM KYDSTHG+F+ ++      L +    I V+  ++P +IPW   +++Y++ESSGVFTTI  AS HL   + KKVIISAPS DAPMFVMGVN  KY+  MNVVSNASCTTNC+APLAKII+DNFGI+EALMTTVHA TATQKTVDAPS KDWRGGRGA QNIIP+STGAAKAVGK+IP L GKL+GMAFRVPT +VSV DLT +L   T Y  I +A++ A+  P  +GI+   +D +VSTD+CGD  S IFD  AGI L+D+FVKL++WYDNE+GYSNRVIDLICHM+++DN+
Sbjct:    3 SKPKVGINGFGRIGRLVLRAGLLKKNVTFVGVNDPFVDVDYMVYMFKYDSTHGKFKDSVKADKGNLIVGDQSIAVFMEKDPTKIPWDKVQADYVVESSGVFTTIAAASAHL--PATKKVIISAPSADAPMFVMGVNQDKYEKTMNVVSNASCTTNCLAPLAKIIHDNFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGMAFRVPTPDVSVVDLTVRLKKPTKYQAIKEAVKKASQGPM-KGIMGYTEDQVVSTDMCGDVRSSIFDAEAGIQLSDTFVKLISWYDNEFGYSNRVIDLICHMYKVDNA 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000023748.1 (SMESG000023748.1)

HSP 1 Score: 426.402 bits (1095), Expect = 4.722e-149
Identity = 215/336 (63.99%), Postives = 266/336 (79.17%), Query Frame = 3
Query:  108 PRVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDNS 1115
            P+VGINGFGRIGRL+LRA     +++ V +NDPF+ ++YM YM KYDSTHG ++ ++S +D  L +    I+++  ++P +IPWS+  +EY++ESSG FTTI+ AS HL   S KKVIISAPS DAPMFVMGVNH+ Y+  MNVVSNASCTTNC+APLAKII+D FGI+EALMTTVHA TATQKTVDAPS KDWRGGRGA QNIIP+STGAAKAVGK+IP L GKL+G+AFRVPT +VSV DLT +L     Y++IV A+R        RGI+   D+ +VSTD+CGD  S IFD  AGI LND FVKL++WYDNE+GYSNRVIDLICHM++ID++
Sbjct:    5 PKVGINGFGRIGRLVLRAGLIQGKVDFVGINDPFVDVNYMVYMFKYDSTHGIYKNDVSEQDGFLVVADQKIQIFMEKDPSKIPWSDVDAEYVVESSGAFTTIQSASAHL--PSAKKVIISAPSADAPMFVMGVNHQLYEKSMNVVSNASCTTNCLAPLAKIIHDKFGIEEALMTTVHAVTATQKTVDAPSLKDWRGGRGAGQNIIPSSTGAAKAVGKVIPELNGKLTGIAFRVPTPDVSVVDLTVRLQNPAKYEDIVNAIRLECEG-SMRGIMGFTDEALVSTDLCGDTRSSIFDASAGIQLNDKFVKLISWYDNEFGYSNRVIDLICHMYRIDHT 337          
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Match: SMESG000033355.1 (SMESG000033355.1)

HSP 1 Score: 423.32 bits (1087), Expect = 7.066e-148
Identity = 215/334 (64.37%), Postives = 256/334 (76.65%), Query Frame = 3
Query:  111 RVGINGFGRIGRLILRAASYGRQINVVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNVRNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDAPMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMXXXXXXXXXXXXXDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKLSGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVVDDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDLICHMFQIDN 1112
            +VGINGFGRIGRL+LRAA     I+VVA+NDPFI ++YM YM KYDSTHG+F   +  KD+ L ++ H I V+N RNPEEIPW  +  EY++ES+GVFTTI+KAS H+ ++  KKVIISAPS DAPMFVMGVN  KY P M VVSNASCTTNC+APLAK+INDNFGI+E LMTT+HA TATQKTVD PS K WR GRGA QNIIPASTGAAKAVG++I  L GKL+GMAFRVP A+VSV DLTCKL     Y  I  A++ A+     + I+   +D +VS D  GD HS IFD  AGI LND+FVKLV+WYDNE+GYS RV+DLI +M   D+
Sbjct:    4 QVGINGFGRIGRLVLRAAIEKETIDVVAINDPFINLEYMVYMFKYDSTHGKFPGTVEAKDDKLMVNGHAISVFNERNPEEIPWDKANCEYVVESTGVFTTIDKASAHIKNNRAKKVIISAPSADAPMFVMGVNQEKYDPKMKVVSNASCTTNCLAPLAKVINDNFGIEEGLMTTIHAYTATQKTVDGPSAKLWRDGRGAAQNIIPASTGAAKAVGQVITELNGKLTGMAFRVPVADVSVVDLTCKLKKPAKYSEIKAAIKKASETSM-KNILGYTEDEVVSQDFRGDQHSSIFDANAGIQLNDTFVKLVSWYDNEFGYSCRVVDLIAYMMTRDH 336          
The following BLAST results are available for this feature:
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GAPDH1.059e-14261.26glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDH1.059e-14261.26glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDH1.059e-14261.26glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
GAPDHS1.778e-13260.18glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
GAPDH3.001e-12362.20glyceraldehyde-3-phosphate dehydrogenase [Source:H... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpd-32.644e-13962.54Glyceraldehyde-3-phosphate dehydrogenase 3 [Sourc... [more]
gpd-32.644e-13962.54Glyceraldehyde-3-phosphate dehydrogenase 3 [Sourc... [more]
gpd-21.373e-13862.54Glyceraldehyde-3-phosphate dehydrogenase 2 [Sourc... [more]
gpd-21.373e-13862.54Glyceraldehyde-3-phosphate dehydrogenase 2 [Sourc... [more]
gpd-13.470e-13862.83Glyceraldehyde-3-phosphate dehydrogenase 1 [Sourc... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gapdh23.881e-14063.28gene:FBgn0001092 transcript:FBtr0074112[more]
Gapdh23.881e-14063.28gene:FBgn0001092 transcript:FBtr0332618[more]
Gapdh11.637e-13762.09gene:FBgn0001091 transcript:FBtr0100479[more]
Gapdh11.637e-13762.09gene:FBgn0001091 transcript:FBtr0088903[more]
CG90106.808e-11753.75gene:FBgn0034173 transcript:FBtr0087067[more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gapdh1.977e-14163.44glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh1.977e-14163.44glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs6.876e-13761.38glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
gapdhs6.876e-13761.38glyceraldehyde-3-phosphate dehydrogenase, spermato... [more]
gapdh5.348e-10465.83glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mbd39.464e-14565.05methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd31.249e-14065.02methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd31.523e-14065.02methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd31.598e-14064.92methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
mbd32.133e-14065.02methyl-CpG binding domain protein 3 [Source:Xenbas... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm103589.514e-14060.73predicted gene 10358 [Source:MGI Symbol;Acc:MGI:37... [more]
Gapdh3.091e-13961.40glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gapdh3.091e-13961.40glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
Gm38391.349e-13860.73predicted pseudogene 3839 [Source:MGI Symbol;Acc:M... [more]
Gapdh1.613e-13861.40glyceraldehyde-3-phosphate dehydrogenase [Source:M... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q00640|G3P_BLUGH6.764e-14864.01Glyceraldehyde-3-phosphate dehydrogenase OS=Blumer... [more]
sp|Q9HGY7|G3P_ASPOR1.361e-14762.91Glyceraldehyde-3-phosphate dehydrogenase OS=Asperg... [more]
sp|P53430|G3P_MONPU1.467e-14662.61Glyceraldehyde-3-phosphate dehydrogenase OS=Monasc... [more]
sp|Q8J1H3|G3P_COCP72.036e-14663.36Glyceraldehyde-3-phosphate dehydrogenase OS=Coccid... [more]
sp|P78958|G3P1_SCHPO2.668e-14663.31Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Schi... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0A7RPV51.875e-14964.48Glyceraldehyde-3-phosphate dehydrogenase OS=Littor... [more]
A0A1Y2GQE41.122e-14866.47Glyceraldehyde-3-phosphate dehydrogenase OS=Lobosp... [more]
A0A355FR126.114e-14865.57Glyceraldehyde-3-phosphate dehydrogenase OS=Firmic... [more]
A0A183B8161.439e-14664.60Glyceraldehyde-3-phosphate dehydrogenase OS=Echino... [more]
A0A0D2C2M21.870e-14664.56Glyceraldehyde-3-phosphate dehydrogenase OS=Exophi... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gapdh1.768e-14363.75glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
ENSAMXT00000050002.14.190e-14162.61glyceraldehyde-3-phosphate dehydrogenase-like [Sou... [more]
gapdhs2.248e-13461.09glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs2.248e-13461.09glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs2.248e-13461.09glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gapdh9.717e-13164.26glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh5.002e-11267.60glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
TDH12.110e-13459.57Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
TDH32.884e-13258.97Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
TDH26.186e-13258.01Glyceraldehyde-3-phosphate dehydrogenase (GAPDH), ... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO408426.470e-13960.24Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
EDO294126.490e-6243.28Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
EDO259191.941e-4237.40Glyceraldehyde-3-phosphate dehydrogenase [Source:... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gapdh1.110e-14463.44glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdh1.110e-14463.44glyceraldehyde-3-phosphate dehydrogenase [Source:N... [more]
gapdhs5.796e-13861.38glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
gapdhs7.339e-12061.30glyceraldehyde-3-phosphate dehydrogenase 2 [Source... [more]
back to top
BLAST of Glyceraldehyde-3-phosphate dehydrogenase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012145.10.000e+095.86SMESG000012145.1[more]
SMESG000012145.10.000e+095.24SMESG000012145.1[more]
SMESG000034925.18.410e-15064.20SMESG000034925.1[more]
SMESG000023748.14.722e-14963.99SMESG000023748.1[more]
SMESG000033355.17.066e-14864.37SMESG000033355.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025877 ID=SMED30025877|Name=Glyceraldehyde-3-phosphate dehydrogenase|organism=Schmidtea mediterranea sexual|type=transcript|length=1242bp
TTTAATAGTTAATTATAATATCGTTTATTTGCAATATGTATTCTCAATGG
CGGAAATATAGTGGACCTTTTATCTCTGCTGGCGAGCCTCCTCTAAATAT
GTCGTTGCCTCGAGTTGGCATTAACGGATTCGGACGAATTGGTCGACTGA
TACTTAGAGCTGCTTCATATGGAAGACAGATTAACGTAGTTGCCGTCAAT
GACCCTTTTATTCCCATTGACTACATGGCTTACATGTTGAAATACGATTC
TACCCACGGCCAATTTAGGATGAATTTGTCCATAAAAGACAACATTTTGT
TTATTGATTCACACCCAATAGAAGTTTACAACGTCAGGAATCCAGAGGAA
ATTCCGTGGAGTAATTCGAAAAGTGAATATATAATAGAAAGCTCAGGTGT
CTTCACGACGATTGAAAAAGCATCGCTGCATTTAACTGACAGTTCTGTCA
AAAAGGTCATCATATCCGCACCGTCAGTCGATGCGCCAATGTTTGTTATG
GGCGTGAATCACAGGAAATATAAGCCGGATATGAATGTTGTTTCAAATGC
CTCATGCACTACAAATTGTGTAGCTCCTCTTGCTAAGATTATAAATGACA
ACTTTGGAATCCAGGAAGCTTTGATGACCACTGTCCACGCCACAACCGCA
ACACAGAAAACAGTGGATGCTCCGTCAAATAAGGATTGGAGAGGAGGACG
AGGAGCATTCCAAAATATCATTCCAGCCAGTACAGGAGCTGCAAAAGCCG
TTGGGAAAATCATTCCTAGCTTGACAGGTAAACTCAGCGGAATGGCATTC
AGAGTGCCAACGGCAAACGTGTCTGTTGCTGATTTGACTTGCAAACTATA
TGCTCATACAACATACGACAACATTGTCAAAGCAATGAGAACAGCAGCGA
CCTGCCCCCAATACAGAGGCATTGTCTGTGTGGTAGATGATCCCATTGTG
TCGACTGATGTTTGTGGAGATCCCCATTCTTGCATCTTTGATGTTGGTGC
TGGAATAGCGCTTAATGATAGCTTTGTCAAACTCGTTGCTTGGTATGACA
ACGAATGGGGGTACAGCAACAGGGTCATTGATCTTATTTGCCACATGTTT
CAAATTGACAATAGTTACAATTGATTTTGATCTGACCTTTATTGATCGCG
ATTTGTGTGAATGTCTATATTATTGTGGCATACTATTGATTATTGATTAT
TGATTATTATTAGCGATTATATCTATTCACTATTAAAAAAAA
back to top

protein sequence of SMED30025877-orf-1

>SMED30025877-orf-1 ID=SMED30025877-orf-1|Name=SMED30025877-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=363bp
MYSQWRKYSGPFISAGEPPLNMSLPRVGINGFGRIGRLILRAASYGRQIN
VVAVNDPFIPIDYMAYMLKYDSTHGQFRMNLSIKDNILFIDSHPIEVYNV
RNPEEIPWSNSKSEYIIESSGVFTTIEKASLHLTDSSVKKVIISAPSVDA
PMFVMGVNHRKYKPDMNVVSNASCTTNCVAPLAKIINDNFGIQEALMTTV
HATTATQKTVDAPSNKDWRGGRGAFQNIIPASTGAAKAVGKIIPSLTGKL
SGMAFRVPTANVSVADLTCKLYAHTTYDNIVKAMRTAATCPQYRGIVCVV
DDPIVSTDVCGDPHSCIFDVGAGIALNDSFVKLVAWYDNEWGYSNRVIDL
ICHMFQIDNSYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0016620oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0004365glyceraldehyde-3-phosphate dehydrogenase (NAD+) (phosphorylating) activity
GO:0016491oxidoreductase activity
GO:0050661NADP binding
GO:0051287NAD binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR006424Glyceraldehyde-3-P_DH_1
IPR036291NAD(P)-bd_dom_sf
IPR020831GlycerAld/Erythrose_P_DH
IPR020828GlycerAld_3-P_DH_NAD(P)-bd
IPR016040NAD(P)-bd_dom
IPR020829GlycerAld_3-P_DH_cat
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006006glucose metabolic process
GO:0006096glycolytic process
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPRINTSPR00078G3PDHDRGNASEcoord: 133..146
score: 49.92
coord: 293..308
score: 40.25
coord: 195..211
score: 73.34
coord: 168..186
score: 76.45
coord: 252..269
score: 71.27
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPIRSFPIRSF000149GAPDHcoord: 23..359
e-value: 2.5E-118
score: 392.8
IPR020831Glyceraldehyde/Erythrose phosphate dehydrogenase familyPANTHERPTHR10836GLYCERALDEHYDE 3-PHOSPHATE DEHYDROGENASEcoord: 26..357
IPR020828Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domainSMARTSM00846gp_dh_n_7coord: 25..174
e-value: 3.2E-77
score: 272.5
IPR020828Glyceraldehyde 3-phosphate dehydrogenase, NAD(P) binding domainPFAMPF00044Gp_dh_Ncoord: 26..125
e-value: 3.1E-33
score: 114.1
NoneNo IPR availableGENE3DG3DSA:3.30.360.10coord: 173..337
e-value: 6.2E-143
score: 477.6
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 26..351
e-value: 6.2E-143
score: 477.6
NoneNo IPR availablePANTHERPTHR10836:SF79GLYCERALDEHYDE-3-PHOSPHATE DEHYDROGENASE, TESTIS-SPECIFICcoord: 26..357
NoneNo IPR availableSUPERFAMILYSSF55347Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domaincoord: 173..337
IPR020829Glyceraldehyde 3-phosphate dehydrogenase, catalytic domainPFAMPF02800Gp_dh_Ccoord: 179..337
e-value: 5.1E-61
score: 204.9
IPR006424Glyceraldehyde-3-phosphate dehydrogenase, type ITIGRFAMTIGR01534TIGR01534coord: 26..349
e-value: 2.2E-120
score: 399.7
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 26..190