SMED30025874

Overview
NameSMED30025874
Smed IDSMED30025874
Length (bp)1216
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30025874 (SMED30025874) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30025874 (SMED30025874) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30025874 (SMED30025874) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30025874 (SMED30025874) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025874

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025874SMESG000057003.1 Contig2851GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025874SMESG000014644.1 Contig2851GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30025874SMESG000014644.1 dd_Smed_v4_1924_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025874SMESG000014644.1 dd_Smed_v4_1924_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30025874SMESG000014644.1 dd_Smed_v4_1924_1_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025874 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.004939:25469..33595 -5965
v31.025945:3807..10002 -4441
Homology
BLAST of SMED30025874 vs. Ensembl Human
Match: OSTM1 (osteoclastogenesis associated transmembrane protein 1 [Source:HGNC Symbol;Acc:HGNC:21652])

HSP 1 Score: 75.8702 bits (185), Expect = 1.493e-14
Identity = 59/244 (24.18%), Postives = 106/244 (43.44%), Query Frame = 3
Query:  225 ELANISAQTTLCFLEFSQPLRICSNC----RNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQ--VFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDN--SQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            + AN SA+ T C +  ++P+R+C  C    +     +DN  +A  N      + +C   LL +D    +      F+  W + NC +C   +S E S     F+ L N  ++C +  +  NA        +  +          C+ C   Y  ++S Y+ MQ+     ++      +C D+ D MN TR LWS+ F C    S    + ++ +FI + + ++FY  +  +   K R +   +R
Sbjct:   90 DFANSSAELTGCLVRSARPVRLCQTCYPLFQQVVSKMDNISRAAGNT---SESQSCARSLLMADRMQIVVILSEFFNTTWQEANCANCLTNNSEELSNSTVYFLNLFNHTLTCFEHNLQGNAHSLLQTKNYSEV----------CKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCSDTVPVIAVSVFI-LFLPVVFYLSSFLHSEQKKRKLILPKR 319          
BLAST of SMED30025874 vs. Ensembl Human
Match: OSTM1 (osteoclastogenesis associated transmembrane protein 1 [Source:HGNC Symbol;Acc:HGNC:21652])

HSP 1 Score: 59.3066 bits (142), Expect = 6.107e-10
Identity = 41/169 (24.26%), Postives = 74/169 (43.79%), Query Frame = 3
Query:  438 FDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQ--VFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDN--SQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            F+  W + NC +C   +S E S     F+ L N  ++C +  +  NA        +  +          C+ C   Y  ++S Y+ MQ+     ++      +C D+ D MN TR LWS+ F C    S    + ++ +FI + + ++FY  +  +   K R +   +R
Sbjct:   15 FNTTWQEANCANCLTNNSEELSNSTVYFLNLFNHTLTCFEHNLQGNAHSLLQTKNYSEV----------CKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCSDTVPVIAVSVFI-LFLPVVFYLSSFLHSEQKKRKLILPKR 172          
BLAST of SMED30025874 vs. Ensembl Fly
Match: CG14969 (gene:FBgn0035440 transcript:FBtr0073082)

HSP 1 Score: 63.1586 bits (152), Expect = 8.594e-11
Identity = 64/253 (25.30%), Postives = 107/253 (42.29%), Query Frame = 3
Query:  195 KITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYT-RFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLI-FSLPLFIVIVVTLL-FYCLASTYFHDKMRVVFYKQRRLKY 944
            K  +C     +L +  ++   C    S P+ +C  C +  + + N +  L+       N NC    L SD    + + + +    W   NCE+C++ +   F + Y+    +L+N    CL+   +AS +                   C  C  +Y ++N FY  M++KV GS        VC D+ D MN TR  WSK  KC   +V L  F + + +V+++ +  FY  A         VV  K+R   +
Sbjct:   25 KKHSCEKLLADLGDAQSKFIYCATTKSVPVNLCEGCVDLYRNLTNDYGNLI------ANANCSKRYLNSDRINIVATTQGILTSLWQKANCENCFRDN---FWIVYSDNSTKLQN----CLE---SASSDL-----------------VCFKCKNDYVSLNDFYLSMEKKVGGS--------VCFDLQDNMNRTRLNWSKTLKCCQREVKLTNFLIAVGVVVLLPIFTFYITA---------VVVTKRREANH 227          
BLAST of SMED30025874 vs. Ensembl Zebrafish
Match: ostm1 (osteoclastogenesis associated transmembrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-081104-270])

HSP 1 Score: 71.2478 bits (173), Expect = 2.767e-13
Identity = 57/245 (23.27%), Postives = 102/245 (41.63%), Query Frame = 3
Query:  258 CFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTIL 977
            C + +++P+++C NC    K +   +  + + +   GNV+C   L +SD    + +     +  WT   C+ C  +     + D   F+   N ++SC + + +   N S                 C+ C   Y  +N  Y  M++  T          +C DI D MN TR LWSK F C     +   V  + S  LF+ I+  L      S++ H +      K+R+L +      +S+++
Sbjct:  102 CLVFYARPVKVCQNCYTGFKGLKEIYLNISSGQ-GPGNVSCHDSLTRSDRLMLLYTLYSNLEDIWTSAKCDQCLTEHEEALTNDTRYFMATLNQSLSCFEQYKD---NHSE---------------LCKDCKPRYKRLNELYGKMEKNQT----------LCIDIEDAMNITRKLWSKNFGCSFPREETVPVIAVSSFMLFLPIIFYL------SSFLHSEQ-----KKRKLIHPKRAKSSSSLM 306          
BLAST of SMED30025874 vs. Ensembl Zebrafish
Match: ostm1 (osteoclastogenesis associated transmembrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-081104-270])

HSP 1 Score: 70.0922 bits (170), Expect = 6.403e-13
Identity = 55/232 (23.71%), Postives = 95/232 (40.95%), Query Frame = 3
Query:  258 CFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRL 938
            C + +++P+++C NC    K +   +  + + +   GNV+C   L +SD    + +     +  WT   C+ C  +     + D   F+   N ++SC + + +   N S                 C+ C   Y  +N  Y  M++  T          +C DI D MN TR LWSK F C     +   V  + S  LF+ I+  L      S++ H + +      R+L
Sbjct:   94 CLVFYARPVKVCQNCYTGFKGLKEIYLNISSGQ-GPGNVSCHDSLTRSDRLMLLYTLYSNLEDIWTSAKCDQCLTEHEEALTNDTRYFMATLNQSLSCFEQYKD---NHSE---------------LCKDCKPRYKRLNELYGKMEKNQT----------LCIDIEDAMNITRKLWSKNFGCSFPREETVPVIAVSSFMLFLPIIFYL------SSFLHSEQKKRKLIHRKL 290          
BLAST of SMED30025874 vs. Ensembl Zebrafish
Match: ostm1 (osteoclastogenesis associated transmembrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-081104-270])

HSP 1 Score: 53.1434 bits (126), Expect = 6.347e-8
Identity = 42/170 (24.71%), Postives = 66/170 (38.82%), Query Frame = 3
Query:  450 WTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKY 944
            WT   C+ C  +     + D   F+   N ++SC + + +   N S                 C+ C   Y  +N  Y  M++  T          +C DI D MN TR LWSK F C     +   V  + S  LF+ I+  L      S++ H + +      R+L +
Sbjct:   14 WTSAKCDQCLTEHEEALTNDTRYFMATLNQSLSCFEQYKD---NHSE---------------LCKDCKPRYKRLNELYGKMEKNQT----------LCIDIEDAMNITRKLWSKNFGCSFPREETVPVIAVSSFMLFLPIIFYL------SSFLHSEQKKRKLIHRKLPH 149          
BLAST of SMED30025874 vs. Ensembl Xenopus
Match: setd4 (SET domain containing 4 [Source:Xenbase;Acc:XB-GENE-5772357])

HSP 1 Score: 90.8929 bits (224), Expect = 3.359e-20
Identity = 71/260 (27.31%), Postives = 117/260 (45.00%), Query Frame = 3
Query:  207 CSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNST 971
            C     E AN SA  + C +  ++P+R+C +C  E   +    +++    +++G V+C   LLQSD    I      F++ W +  C  C +  S       + F+E+  S  +C         N S  K  T+ S  G   S CR C+ NY  +N  Y+ ++++            +C D+ D MN+TR LWSK F C     D   V  + +  LF+ I+    FY   S+Y H +      K+R+L + +    N++
Sbjct:   32 CLRLLAEFANHSASLSSCLVYNARPVRLCQHCYTEYVQLQTTMQSI-EAPLQNGTVSCAASLLQSDRVQVIVILNDFFEQTWEESKCSQCLQNQSQSLLNTTSEFMEMFLSLGTC--------FNLSR-KEPTVVSQQGNFSSICRNCSKNYRELNDLYSKLEKE----------KALCIDLEDAMNSTRILWSKTFNCTVPCTDTVPVIAVSAFILFLPII----FY--LSSYLHSEQ-----KKRKLIFPNRIKSNAS 260          
BLAST of SMED30025874 vs. Ensembl Mouse
Match: Ostm1 (osteopetrosis associated transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:2655574])

HSP 1 Score: 72.0182 bits (175), Expect = 1.607e-13
Identity = 59/251 (23.51%), Postives = 108/251 (43.03%), Query Frame = 3
Query:  207 CSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRD-GNVN----CEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQV-FTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLK 941
            C     + AN SA+ T C +  ++P+R+C  C    + V  K    M+N  R+ GN +    C   LL +D    +      F+  W + NC +C   +  + S +   F+ L N  ++C +      + +   PK  +           CR C   Y  ++  Y+ MQ+     ++      +C D+ D MN TR LWS+ F C  +  + +  + + + I+   + + L+S    ++ +      +RLK
Sbjct:   88 CRELLMDFANSSAELTACMVRSARPVRLCQTCYPLFQQVAIK----MDNISRNIGNTSEGPRCGGSLLTADRMQIVLMVSEFFNSTWQEANCANCLTNNGEDLSNNTEDFLSLFNKTLACFEHNLQGHTYSLLPPKNYS---------EVCRNCKEAYKNLSLLYSQMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSRTFNCSVTCSDTVSVVAVSVFILFLPVVFYLSSFLHSEQKKRKLILPKRLK 325          
BLAST of SMED30025874 vs. Ensembl Mouse
Match: Ostm1 (osteopetrosis associated transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:2655574])

HSP 1 Score: 55.0694 bits (131), Expect = 1.232e-8
Identity = 40/174 (22.99%), Postives = 72/174 (41.38%), Query Frame = 3
Query:  438 FDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDV-------SACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDN--SQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            F+  W + NC +C   +  + S +   F+ L N  ++C               FE    G  + +         CR C   Y  ++  Y+ MQ+     ++      +C D+ D MN TR LWS+ F C    S    + ++ +FI + + ++FY  +  +   K R +   +R
Sbjct:   11 FNSTWQEANCANCLTNNGEDLSNNTEDFLSLFNKTLAC---------------FEHNLQGHTYSLLPPKNYSEVCRNCKEAYKNLSLLYSQMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSRTFNCSVTCSDTVSVVAVSVFI-LFLPVVFYLSSFLHSEQKKRKLILPKR 168          
BLAST of SMED30025874 vs. Ensembl Mouse
Match: Ostm1 (osteopetrosis associated transmembrane protein 1 [Source:MGI Symbol;Acc:MGI:2655574])

HSP 1 Score: 54.6842 bits (130), Expect = 2.393e-8
Identity = 42/176 (23.86%), Postives = 75/176 (42.61%), Query Frame = 3
Query:  438 FDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDV-------SACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDN--SQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRL 938
            F+  W + NC +C   +  + S +   F+ L N  ++C               FE    G  + +         CR C   Y  ++  Y+ MQ+     ++      +C D+ D MN TR LWS+ F C    S    + ++ +FI + + ++FY   S++ H +      K+R+L
Sbjct:   11 FNSTWQEANCANCLTNNGEDLSNNTEDFLSLFNKTLAC---------------FEHNLQGHTYSLLPPKNYSEVCRNCKEAYKNLSLLYSQMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSRTFNCSVTCSDTVSVVAVSVFI-LFLPVVFY--LSSFLHSEQ-----KKRKL 163          
BLAST of SMED30025874 vs. UniProt/SwissProt
Match: sp|Q86WC4|OSTM1_HUMAN (Osteopetrosis-associated transmembrane protein 1 OS=Homo sapiens OX=9606 GN=OSTM1 PE=1 SV=1)

HSP 1 Score: 75.8702 bits (185), Expect = 7.171e-14
Identity = 59/244 (24.18%), Postives = 106/244 (43.44%), Query Frame = 3
Query:  225 ELANISAQTTLCFLEFSQPLRICSNC----RNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQ--VFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDN--SQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            + AN SA+ T C +  ++P+R+C  C    +     +DN  +A  N      + +C   LL +D    +      F+  W + NC +C   +S E S     F+ L N  ++C +  +  NA        +  +          C+ C   Y  ++S Y+ MQ+     ++      +C D+ D MN TR LWS+ F C    S    + ++ +FI + + ++FY  +  +   K R +   +R
Sbjct:   90 DFANSSAELTGCLVRSARPVRLCQTCYPLFQQVVSKMDNISRAAGNT---SESQSCARSLLMADRMQIVVILSEFFNTTWQEANCANCLTNNSEELSNSTVYFLNLFNHTLTCFEHNLQGNAHSLLQTKNYSEV----------CKNCREAYKTLSSLYSEMQKMNELENKAEPGTHLCIDVEDAMNITRKLWSRTFNCSVPCSDTVPVIAVSVFI-LFLPVVFYLSSFLHSEQKKRKLILPKR 319          
BLAST of SMED30025874 vs. UniProt/SwissProt
Match: sp|Q8BGT0|OSTM1_MOUSE (Osteopetrosis-associated transmembrane protein 1 OS=Mus musculus OX=10090 GN=Ostm1 PE=1 SV=1)

HSP 1 Score: 72.0182 bits (175), Expect = 1.124e-12
Identity = 59/251 (23.51%), Postives = 108/251 (43.03%), Query Frame = 3
Query:  207 CSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRD-GNVN----CEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQV-FTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLK 941
            C     + AN SA+ T C +  ++P+R+C  C    + V  K    M+N  R+ GN +    C   LL +D    +      F+  W + NC +C   +  + S +   F+ L N  ++C +      + +   PK  +           CR C   Y  ++  Y+ MQ+     ++      +C D+ D MN TR LWS+ F C  +  + +  + + + I+   + + L+S    ++ +      +RLK
Sbjct:   88 CRELLMDFANSSAELTACMVRSARPVRLCQTCYPLFQQVAIK----MDNISRNIGNTSEGPRCGGSLLTADRMQIVLMVSEFFNSTWQEANCANCLTNNGEDLSNNTEDFLSLFNKTLACFEHNLQGHTYSLLPPKNYS---------EVCRNCKEAYKNLSLLYSQMQKLNGLENKAEPETHLCIDVEDAMNITRKLWSRTFNCSVTCSDTVSVVAVSVFILFLPVVFYLSSFLHSEQKKRKLILPKRLK 325          
BLAST of SMED30025874 vs. TrEMBL
Match: H0ZPI5 (Osteoclastogenesis associated transmembrane protein 1 OS=Taeniopygia guttata OX=59729 GN=OSTM1 PE=4 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 3.267e-17
Identity = 65/247 (26.32%), Postives = 106/247 (42.91%), Query Frame = 3
Query:  231 ANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNV--NCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSA------CRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            A  SA  T C    ++P+R+C  C    + +  ++ +++   +  G+   NC   LL SD +  + +    F++ W   NC +C K +S   S     F++L N +++C               FE    G G D+S       C+ CN  Y+ +N  Y ++Q              +C D+ D MN TR LWS+ F C     D   V  + S  LF+ IV    FY  +  +   K R++   +R
Sbjct:   62 AEGSAALTGCLGRRARPVRLCQGCHGHYRRLLAQYGSIVR-AVGGGSESHNCAKSLLTSDXAAVVVTLSEFFNETWEAANCANCLKNNSEGLSNSTEEFLDLFNKSLTC---------------FEHNLQGQGIDLSPNNYTEVCKNCNETYTKLNDLYNHLQRMNRQGGESAHSAHLCIDVEDAMNITRKLWSRTFNCSLPCSDTVPVIAVSSFILFLPIV----FYLSSFLHSKQKKRILILPKR 288          
BLAST of SMED30025874 vs. TrEMBL
Match: Q0IHW1 (Uncharacterized protein OS=Xenopus tropicalis OX=8364 GN=ostm1 PE=2 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 4.649e-17
Identity = 70/254 (27.56%), Postives = 116/254 (45.67%), Query Frame = 3
Query:  225 ELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNST 971
            E AN SA  + C +  ++P+R+C +C  E   +    +++    +++G V+C   LLQSD    I      F++ W +  C  C +  S       + F+E+  S  +C         N S  K  T+ S  G   S CR C+ NY  +N  Y+ ++++            +C D+ D MN+TR LWSK F C     D   V  + +  LF+ I+    FY   S+Y H +      K+R+L + +    N++
Sbjct:   33 EFANHSASLSSCLVYNARPVRLCQHCYTEYVQLQTTMQSI-EAPLQNGTVSCAASLLQSDRVQVIVILNDFFEQTWEESKCSQCLQNQSQSLLNTTSEFMEMFLSLGTC--------FNLSR-KEPTVVSQQGNFSSICRNCSKNYRELNDLYSKLEKE----------KALCIDLEDAMNSTRILWSKTFNCTVPCTDTVPVIAVSAFILFLPII----FY--LSSYLHSEQ-----KKRKLIFPNRIKSNAS 255          
BLAST of SMED30025874 vs. TrEMBL
Match: A0A5G3JXG4 (SET domain containing 4 OS=Xenopus tropicalis OX=8364 GN=setd4 PE=4 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 5.275e-17
Identity = 71/260 (27.31%), Postives = 117/260 (45.00%), Query Frame = 3
Query:  207 CSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNST 971
            C     E AN SA  + C +  ++P+R+C +C  E   +    +++    +++G V+C   LLQSD    I      F++ W +  C  C +  S       + F+E+  S  +C         N S  K  T+ S  G   S CR C+ NY  +N  Y+ ++++            +C D+ D MN+TR LWSK F C     D   V  + +  LF+ I+    FY   S+Y H +      K+R+L + +    N++
Sbjct:   32 CLRLLAEFANHSASLSSCLVYNARPVRLCQHCYTEYVQLQTTMQSI-EAPLQNGTVSCAASLLQSDRVQVIVILNDFFEQTWEESKCSQCLQNQSQSLLNTTSEFMEMFLSLGTC--------FNLSR-KEPTVVSQQGNFSSICRNCSKNYRELNDLYSKLEKE----------KALCIDLEDAMNSTRILWSKTFNCTVPCTDTVPVIAVSAFILFLPII----FY--LSSYLHSEQ-----KKRKLIFPNRIKSNAS 260          
BLAST of SMED30025874 vs. TrEMBL
Match: A0A151MJP4 (Osteopetrosis-associated transmembrane protein 1 OS=Alligator mississippiensis OX=8496 GN=OSTM1 PE=4 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 6.727e-17
Identity = 66/239 (27.62%), Postives = 105/239 (43.93%), Query Frame = 3
Query:  243 AQTTLCFLEFSQPLRICSNC----RNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            A  + C +  ++P+R+C +C    R   + +DN  +A+ N+     + NC   LL SD    +      F+K W + NC +C K  S   S     F++L N  + C +       N        + S +      CR CN  Y  +N+ YT MQ +    + +     +C D+ D MN TR LWS+ F C     D   V  + S  LF+ +V    FY  +  +   K R++F  +R
Sbjct:   62 AALSGCLVRSARPVRLCQSCYGLFRAVTEQLDNITRAVGNS---SKSYNCAKSLLMSDRLQIVVVLSEFFNKTWEEANCANCLKNSSEGLSNATIEFLDLFNKTLMCFE------HNLQGQAISLVASNY---TEVCRNCNVTYKKLNTLYTEMQRESEHGESE-HSKHLCIDVEDAMNITRRLWSRTFNCSVPCSDTVPVIAVSSFILFLPVV----FYLSSFLHSKQKKRILFLPKR 283          
BLAST of SMED30025874 vs. TrEMBL
Match: A0A452HIJ3 (Osteoclastogenesis associated transmembrane protein 1 OS=Gopherus agassizii OX=38772 GN=OSTM1 PE=4 SV=1)

HSP 1 Score: 90.1225 bits (222), Expect = 8.398e-17
Identity = 63/239 (26.36%), Postives = 101/239 (42.26%), Query Frame = 3
Query:  231 ANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQR 932
            A+ S + T C +  ++P+R+C +C    ++V  + K +          NC   LL SD    +      F+  W   NC +C K +S   S     F+ L N+ + C +          N + + I  G       CR C+  YS +N+ Y  MQ+      R      +C D+ D MN TR LWS+ F C     D   V  + S  LF+ ++    FY  +  +   K R++   +R
Sbjct:   19 ASSSVRLTGCLVRSARPVRLCQSCYRHFQSVTEQLKNITRAVGNSSESNCAKSLLMSDRVQLVVILSQFFNSTWEKANCANCLKNNSEGLSNSTIEFLNLFNTTLMCFE---------HNFQGQAINLGPSNHTEVCRNCSRTYSNLNALYNKMQKMT--EQRSEHRTPLCIDVEDAMNITRRLWSRTFNCSVPCSDTVPVIAVSSFILFLPVI----FYLSSFLHSKQKKRILILPKR 242          
BLAST of SMED30025874 vs. Ensembl Cavefish
Match: ostm1 (osteoclastogenesis associated transmembrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-081104-270])

HSP 1 Score: 77.0258 bits (188), Expect = 2.160e-15
Identity = 56/245 (22.86%), Postives = 97/245 (39.59%), Query Frame = 3
Query:  258 CFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTIL 977
            C +  ++P+R+C NC     + ++ +  + + + + GNV+C+  L++SD    + +        WT   C  C   D    +     FI   N ++SC + +                         C  C A Y  +N  Y+ M +            G C DI D MN TR LWSK+F C     +   V  + S  LF+ ++  L      S + H +      K+R+L +      N +++
Sbjct:   95 CLVSSARPVRVCQNCYQAYSSFNDIYTNISSGQTQSGNVSCQDSLMRSDRLMLLFNLYSSLTDIWTSALCTQCLTPDQKSLTNSTLDFISYLNKSLSCFEKYQENHTEL------------------CMDCKATYKGLNEMYSTMLKN----------KGYCIDIEDAMNVTRRLWSKKFGCTVPREETVPVIAVSSFMLFLPVIFYL------SNFLHSEQ-----KKRKLIHPKRAKSNHSLM 300          
BLAST of SMED30025874 vs. Ensembl Medaka
Match: ostm1 (osteoclastogenesis associated transmembrane protein 1 [Source:NCBI gene;Acc:101155979])

HSP 1 Score: 72.7886 bits (177), Expect = 6.388e-14
Identity = 61/263 (23.19%), Postives = 110/263 (41.83%), Query Frame = 3
Query:  189 DYKITNCSMYKQELANISAQT----TLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKC-----DNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMS 950
            D +I+N   Y  EL +I +Q       C +  ++P+R+C  C +   ++ N +  + ++++  GN +C   L++SD    +          W   NC+ C  +     + + T F++  N  +SC + +                   G     C+ C ++Y  +N  Y+ M++ +            C D+ D MN TR LWSK F C     +   V  + S  LF+ I+    FY  +  +   K R + + +R   Y S
Sbjct:   66 DLEISN---YCLELLSIFSQRYSDYVKCLVPAARPVRVCMKCYSGYGSLLNAYMNISSDQMGPGNESCRDSLMRSDRLMLVYVLFSNMQDLWEKSNCDFCITEKFQGVNNETTHFMKNLNQTLSCFEKYQQ-----------------GNHTELCKNCKSSYKGLNELYSSMEKTL------------CIDVEDAMNMTRILWSKNFNCSMPRGETVPVIAVSSFMLFLPII----FYLSSFLHSEQKKRKLIHPKRMKSYSS 292          
BLAST of SMED30025874 vs. Planmine SMEST
Match: SMESG000014644.1 (SMESG000014644.1)

HSP 1 Score: 593.578 bits (1529), Expect = 0.000e+0
Identity = 309/310 (99.68%), Postives = 309/310 (99.68%), Query Frame = 3
Query:  111 MINCRXXXXXXXXXXXXXXXXXXYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK*QVSDRNVIGALDIEIP 1040
            MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK QVSDRNVIGALDIEIP
Sbjct:    1 MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK-QVSDRNVIGALDIEIP 309          
BLAST of SMED30025874 vs. Planmine SMEST
Match: SMESG000014644.1 (SMESG000014644.1)

HSP 1 Score: 545.428 bits (1404), Expect = 0.000e+0
Identity = 283/283 (100.00%), Postives = 283/283 (100.00%), Query Frame = 3
Query:  111 MINCRXXXXXXXXXXXXXXXXXXYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN 959
            MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN
Sbjct:    1 MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN 283          
BLAST of SMED30025874 vs. Planmine SMEST
Match: SMESG000014644.1 (SMESG000014644.1)

HSP 1 Score: 545.043 bits (1403), Expect = 0.000e+0
Identity = 283/283 (100.00%), Postives = 283/283 (100.00%), Query Frame = 3
Query:  111 MINCRXXXXXXXXXXXXXXXXXXYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN 959
            MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN
Sbjct:    1 MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN 283          
BLAST of SMED30025874 vs. Planmine SMEST
Match: SMESG000014644.1 (SMESG000014644.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 259/259 (100.00%), Postives = 259/259 (100.00%), Query Frame = 3
Query:  213 MYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK 989
            MYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK
Sbjct:    1 MYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK 259          
BLAST of SMED30025874 vs. Planmine SMEST
Match: SMESG000014644.1 (SMESG000014644.1)

HSP 1 Score: 517.694 bits (1332), Expect = 0.000e+0
Identity = 249/249 (100.00%), Postives = 249/249 (100.00%), Query Frame = 3
Query:  213 MYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN 959
            MYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN
Sbjct:    1 MYKQELANISAQTTLCFLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVSTTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQVFTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTGSDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVVTLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDN 249          
The following BLAST results are available for this feature:
BLAST of SMED30025874 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
OSTM11.493e-1424.18osteoclastogenesis associated transmembrane protei... [more]
OSTM16.107e-1024.26osteoclastogenesis associated transmembrane protei... [more]
back to top
BLAST of SMED30025874 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025874 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG149698.594e-1125.30gene:FBgn0035440 transcript:FBtr0073082[more]
back to top
BLAST of SMED30025874 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ostm12.767e-1323.27osteoclastogenesis associated transmembrane protei... [more]
ostm16.403e-1323.71osteoclastogenesis associated transmembrane protei... [more]
ostm16.347e-824.71osteoclastogenesis associated transmembrane protei... [more]
back to top
BLAST of SMED30025874 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
setd43.359e-2027.31SET domain containing 4 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of SMED30025874 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Ostm11.607e-1323.51osteopetrosis associated transmembrane protein 1 [... [more]
Ostm11.232e-822.99osteopetrosis associated transmembrane protein 1 [... [more]
Ostm12.393e-823.86osteopetrosis associated transmembrane protein 1 [... [more]
back to top
BLAST of SMED30025874 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q86WC4|OSTM1_HUMAN7.171e-1424.18Osteopetrosis-associated transmembrane protein 1 O... [more]
sp|Q8BGT0|OSTM1_MOUSE1.124e-1223.51Osteopetrosis-associated transmembrane protein 1 O... [more]
back to top
BLAST of SMED30025874 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H0ZPI53.267e-1726.32Osteoclastogenesis associated transmembrane protei... [more]
Q0IHW14.649e-1727.56Uncharacterized protein OS=Xenopus tropicalis OX=8... [more]
A0A5G3JXG45.275e-1727.31SET domain containing 4 OS=Xenopus tropicalis OX=8... [more]
A0A151MJP46.727e-1727.62Osteopetrosis-associated transmembrane protein 1 O... [more]
A0A452HIJ38.398e-1726.36Osteoclastogenesis associated transmembrane protei... [more]
back to top
BLAST of SMED30025874 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ostm12.160e-1522.86osteoclastogenesis associated transmembrane protei... [more]
back to top
BLAST of SMED30025874 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025874 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025874 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025874 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ostm16.388e-1423.19osteoclastogenesis associated transmembrane protei... [more]
back to top
BLAST of SMED30025874 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014644.10.000e+099.68SMESG000014644.1[more]
SMESG000014644.10.000e+0100.00SMESG000014644.1[more]
SMESG000014644.10.000e+0100.00SMESG000014644.1[more]
SMESG000014644.10.000e+0100.00SMESG000014644.1[more]
SMESG000014644.10.000e+0100.00SMESG000014644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025874 ID=SMED30025874|Name=SMED30025874|organism=Schmidtea mediterranea sexual|type=transcript|length=1216bp
TTACACTGTAAGTTAATTTCATCTTTTTTAAAACTTATTCCTGAAATTAT
TTAATAATAAAATTCTCACCTCTTTGTCATCGTAATTGTCGAATTATCGA
TATTGTAGAAATGATAAACTGCAGAATTTCAATAATTTTCATCGTTTTCT
TGTTAATCAGTGAATCGTTTAGTTTCGAATATTTCACTGATTATAAAATT
ACAAACTGCTCAATGTATAAACAGGAATTAGCAAATATTTCAGCTCAAAC
AACGCTCTGTTTTCTCGAATTTTCTCAGCCACTGAGAATATGCTCAAATT
GTCGCAATGAAAAGAAAGCAGTTGATAATAAATTTAAAGCTTTGATGAAC
AATAAAATCAGAGATGGAAATGTTAATTGTGAACCGATTCTCCTCCAGTC
TGACGTCTCAACAACAATTGAAAGTTTTAAATTAGTCTTTGACAAAGAAT
GGACAGATGGCAACTGTGAACATTGTTACAAGAAAGATTCCCCTGAGTTC
TCTGTGGATTATACGCGATTCATCGAACTTGAAAATTCAGCCATGAGCTG
TTTACAAGTCTTCACTAACGCTAGCCTAAATTTCTCAAATCCCAAATTTG
AAACGATCTGGAGTGGATTTGGTTTCGATGTCTCTGCATGCAGGGCTTGC
AATGCCAATTACTCGGCTGTCAATAGCTTTTACACTTATATGCAGGAAAA
AGTTACAGGGAGCGACAGACAGCTATTGTGGAATGGAGTTTGCGGGGATA
TCGGAGACATTATGAACACCACTCGATATTTATGGTCAAAGGAATTCAAG
TGTGACAACAGCCAAGTTAATCTGATTTTCTCGCTCCCATTGTTCATTGT
GATTGTTGTCACTCTCTTGTTTTACTGCCTGGCTTCAACATATTTCCATG
ACAAAATGCGAGTAGTATTCTACAAGCAGCGCCGCCTCAAGTACATGAGC
AATGATAACGGAAACTCGACTATATTAGAAACGATGAAATAACAGGTTAG
TGACAGAAACGTGATTGGTGCTCTTGATATTGAGATTCCCTGAATAATTT
CTCCTGTGATCTTCAAATTCGTAATTTTTGTTTTAATTTACACATTAATT
ATTTTCATTTCCATGTCACATATTGATTATTGTGATTTTTTGAATTATTT
GTTGATATTTGTTTGTTTTTATTGATTGTGATGTGAAATATATGAATAAC
TGATGTCTTGATTAAG
back to top

protein sequence of SMED30025874-orf-1

>SMED30025874-orf-1 ID=SMED30025874-orf-1|Name=SMED30025874-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=294bp
MINCRISIIFIVFLLISESFSFEYFTDYKITNCSMYKQELANISAQTTLC
FLEFSQPLRICSNCRNEKKAVDNKFKALMNNKIRDGNVNCEPILLQSDVS
TTIESFKLVFDKEWTDGNCEHCYKKDSPEFSVDYTRFIELENSAMSCLQV
FTNASLNFSNPKFETIWSGFGFDVSACRACNANYSAVNSFYTYMQEKVTG
SDRQLLWNGVCGDIGDIMNTTRYLWSKEFKCDNSQVNLIFSLPLFIVIVV
TLLFYCLASTYFHDKMRVVFYKQRRLKYMSNDNGNSTILETMK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR019172Osteopetrosis-assoc_TM_1
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR019172Osteopetrosis-associated transmembrane protein 1 precursorPFAMPF09777OSTMP1coord: 33..274
e-value: 4.3E-33
score: 114.7
IPR019172Osteopetrosis-associated transmembrane protein 1 precursorPANTHERPTHR15644OSTEOPETROSIS ASSOCIATED TRANSMEMBRANE PROTEIN 1coord: 29..267
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..21
score: 0.836
NoneNo IPR availableTMHMMTMhelixcoord: 236..258