Pleckstrin homology and RhoGEF domain containing G5

Overview
NamePleckstrin homology and RhoGEF domain containing G5
Smed IDSMED30025872
Length (bp)2506
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pleckstrin homology and RhoGEF domain containing G5 (SMED30025872) t-SNE clustered cells

Violin plots show distribution of expression levels for Pleckstrin homology and RhoGEF domain containing G5 (SMED30025872) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pleckstrin homology and RhoGEF domain containing G5 (SMED30025872) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pleckstrin homology and RhoGEF domain containing G5 (SMED30025872) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025872

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30025872SMESG000023541.1 SMESG000023540.1 dd_Smed_v4_10072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025872SMESG000023541.1 SMESG000023540.1 dd_Smed_v4_10072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30025872SMESG000023541.1 SMESG000023540.1 dd_Smed_v4_10072_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025872SMESG000023541.1 SMESG000023540.1 dd_Smed_v4_10072_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30025872SMESG000023541.1 SMESG000023540.1 dd_Smed_v4_10072_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30025872SMESG000023541.1 SMESG000023540.1 dd_Smed_v4_10072_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Human
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:HGNC Symbol;Acc:HGNC:29105])

HSP 1 Score: 193.741 bits (491), Expect = 8.524e-51
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I+ +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  YI WA    +  R  L+D LAKP  RLTKY +LL+++ +K      K  +  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAPI     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + +VI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  413 HQQEAVWELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTI 756          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Human
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:HGNC Symbol;Acc:HGNC:29105])

HSP 1 Score: 193.741 bits (491), Expect = 1.483e-50
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I+ +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  YI WA    +  R  L+D LAKP  RLTKY +LL+++ +K      K  +  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAPI     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + +VI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  336 HQQEAVWELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTI 679          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Human
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:HGNC Symbol;Acc:HGNC:29105])

HSP 1 Score: 193.741 bits (491), Expect = 1.786e-50
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I+ +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  YI WA    +  R  L+D LAKP  RLTKY +LL+++ +K      K  +  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAPI     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + +VI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  373 HQQEAVWELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTI 716          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Human
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:HGNC Symbol;Acc:HGNC:29105])

HSP 1 Score: 194.126 bits (492), Expect = 1.880e-50
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I+ +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  YI WA    +  R  L+D LAKP  RLTKY +LL+++ +K      K  +  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAPI     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + +VI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  413 HQQEAVWELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTI 756          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Human
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:HGNC Symbol;Acc:HGNC:29105])

HSP 1 Score: 193.741 bits (491), Expect = 1.934e-50
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I+ +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  YI WA    +  R  L+D LAKP  RLTKY +LL+++ +K      K  +  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAPI     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + +VI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  336 HQQEAVWELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTI 679          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Celegans
Match: rhgf-2 (RHo Guanine nucleotide exchange Factor [Source:UniProtKB/TrEMBL;Acc:Q22354])

HSP 1 Score: 114.39 bits (285), Expect = 8.669e-26
Identity = 85/348 (24.43%), Postives = 167/348 (47.99%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFE-FWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGID-EKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLT--APIQYGREKVIREILLQGSVKLREGTSKT-VDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +QQ AIWE++ TE  ++K + ++  +     ++    +   + +  +F N   +  V+++  W   I P++     T +      L++GF  I      Y  +    S     I    K +E F +++ WA   E  +R+ L D  + P  RLT+Y +LL+A+ K +  + E+  I  ++D  ++  +Q+N+++   +L   L ++   I+  D ++   D+L  + N    L+L    P+ + R+   R ++ +G ++++EG   +  DV   + TD+ LI +  +    + K++KPPI +  +  H  ++ N F  V L DF+   ALY       +    WT+ L
Sbjct:  131 KQQEAIWEIVTTEFRYIKLLRYLSNLSFYLTDLQNCGFLKDIENRLVFFNFVTLFNVNYDSLWLQSIEPILAKSRETGEPLDVNYLQNGFRDIENWSRCYTNFHLAHSDSLKHIQKKLKESENFRDFVTWAEAQENLDRQKLIDTFSVPMQRLTRYNLLLKAVLKVTTDENEREMISNLVDCAESATAQLNKELNNNDLRAMLGDVMRTIEGPDYVDQ--DELERLFNLKLPLNLGDFMPLLHPRKPTHRTLIYRGDLRMQEGKKGSKADVHCIIFTDMFLICRKVQGKKDRLKILKPPIHMGKMMFHYFADQNGFYLVHLTDFHTAQALYSMHTSGPEDTLRWTDML 476          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Celegans
Match: rhgf-2 (RHo Guanine nucleotide exchange Factor [Source:UniProtKB/TrEMBL;Acc:Q22354])

HSP 1 Score: 114.775 bits (286), Expect = 9.468e-26
Identity = 85/348 (24.43%), Postives = 167/348 (47.99%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFE-FWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGID-EKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLT--APIQYGREKVIREILLQGSVKLREGTSKT-VDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +QQ AIWE++ TE  ++K + ++  +     ++    +   + +  +F N   +  V+++  W   I P++     T +      L++GF  I      Y  +    S     I    K +E F +++ WA   E  +R+ L D  + P  RLT+Y +LL+A+ K +  + E+  I  ++D  ++  +Q+N+++   +L   L ++   I+  D ++   D+L  + N    L+L    P+ + R+   R ++ +G ++++EG   +  DV   + TD+ LI +  +    + K++KPPI +  +  H  ++ N F  V L DF+   ALY       +    WT+ L
Sbjct:  276 KQQEAIWEIVTTEFRYIKLLRYLSNLSFYLTDLQNCGFLKDIENRLVFFNFVTLFNVNYDSLWLQSIEPILAKSRETGEPLDVNYLQNGFRDIENWSRCYTNFHLAHSDSLKHIQKKLKESENFRDFVTWAEAQENLDRQKLIDTFSVPMQRLTRYNLLLKAVLKVTTDENEREMISNLVDCAESATAQLNKELNNNDLRAMLGDVMRTIEGPDYVDQ--DELERLFNLKLPLNLGDFMPLLHPRKPTHRTLIYRGDLRMQEGKKGSKADVHCIIFTDMFLICRKVQGKKDRLKILKPPIHMGKMMFHYFADQNGFYLVHLTDFHTAQALYSMHTSGPEDTLRWTDML 621          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Celegans
Match: rhgf-2 (RHo Guanine nucleotide exchange Factor [Source:UniProtKB/TrEMBL;Acc:Q22354])

HSP 1 Score: 114.775 bits (286), Expect = 9.468e-26
Identity = 85/348 (24.43%), Postives = 167/348 (47.99%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFE-FWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGID-EKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLT--APIQYGREKVIREILLQGSVKLREGTSKT-VDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +QQ AIWE++ TE  ++K + ++  +     ++    +   + +  +F N   +  V+++  W   I P++     T +      L++GF  I      Y  +    S     I    K +E F +++ WA   E  +R+ L D  + P  RLT+Y +LL+A+ K +  + E+  I  ++D  ++  +Q+N+++   +L   L ++   I+  D ++   D+L  + N    L+L    P+ + R+   R ++ +G ++++EG   +  DV   + TD+ LI +  +    + K++KPPI +  +  H  ++ N F  V L DF+   ALY       +    WT+ L
Sbjct:  276 KQQEAIWEIVTTEFRYIKLLRYLSNLSFYLTDLQNCGFLKDIENRLVFFNFVTLFNVNYDSLWLQSIEPILAKSRETGEPLDVNYLQNGFRDIENWSRCYTNFHLAHSDSLKHIQKKLKESENFRDFVTWAEAQENLDRQKLIDTFSVPMQRLTRYNLLLKAVLKVTTDENEREMISNLVDCAESATAQLNKELNNNDLRAMLGDVMRTIEGPDYVDQ--DELERLFNLKLPLNLGDFMPLLHPRKPTHRTLIYRGDLRMQEGKKGSKADVHCIIFTDMFLICRKVQGKKDRLKILKPPIHMGKMMFHYFADQNGFYLVHLTDFHTAQALYSMHTSGPEDTLRWTDML 621          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Celegans
Match: rhgf-2 (RHo Guanine nucleotide exchange Factor [Source:UniProtKB/TrEMBL;Acc:Q22354])

HSP 1 Score: 114.775 bits (286), Expect = 9.582e-26
Identity = 85/348 (24.43%), Postives = 167/348 (47.99%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFE-FWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGID-EKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLT--APIQYGREKVIREILLQGSVKLREGTSKT-VDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +QQ AIWE++ TE  ++K + ++  +     ++    +   + +  +F N   +  V+++  W   I P++     T +      L++GF  I      Y  +    S     I    K +E F +++ WA   E  +R+ L D  + P  RLT+Y +LL+A+ K +  + E+  I  ++D  ++  +Q+N+++   +L   L ++   I+  D ++   D+L  + N    L+L    P+ + R+   R ++ +G ++++EG   +  DV   + TD+ LI +  +    + K++KPPI +  +  H  ++ N F  V L DF+   ALY       +    WT+ L
Sbjct:  418 KQQEAIWEIVTTEFRYIKLLRYLSNLSFYLTDLQNCGFLKDIENRLVFFNFVTLFNVNYDSLWLQSIEPILAKSRETGEPLDVNYLQNGFRDIENWSRCYTNFHLAHSDSLKHIQKKLKESENFRDFVTWAEAQENLDRQKLIDTFSVPMQRLTRYNLLLKAVLKVTTDENEREMISNLVDCAESATAQLNKELNNNDLRAMLGDVMRTIEGPDYVD--QDELERLFNLKLPLNLGDFMPLLHPRKPTHRTLIYRGDLRMQEGKKGSKADVHCIIFTDMFLICRKVQGKKDRLKILKPPIHMGKMMFHYFADQNGFYLVHLTDFHTAQALYSMHTSGPEDTLRWTDML 763          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Celegans
Match: prhg-1 (pep chromosome:WBcel235:I:912415:926877:-1 gene:WBGene00022391.1 transcript:Y95B8A.12c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:prhg-1)

HSP 1 Score: 67.0106 bits (162), Expect = 3.407e-11
Identity = 89/379 (23.48%), Postives = 162/379 (42.74%), Query Frame = 3
Query:  642 AIWELMVTEQNFL-KQIHFIVQIY--------VVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVI----ENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDE-KNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIP--IINQYSKLDLTAP-----IQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXP------------PIFLDSIKIHKSNTN----------SFICVCLNDFNCITALYHFSNGDQKKIDLWTE 1649
            A+WEL  TE  FL +Q+  +  +Y        V G  +L       V  + +F NL  +  +S  F +  +  +     EN++ T+ +     L + F K    +  Y  YC         + S+ +  E F E+ +  +  E   R  L D L  P  R+T+  ILL+ I K S  +E K +++++ID +   +  +++ ++  +  ++LQ L +      V+ P   DL P   +  + ++ L+       + + R K+I E    G ++L E   +TVD+  FL  D+ ++TK KK          P            P+ LDS     +++N          +F+ + L  +  +  +Y     D+   +LW E
Sbjct:  196 AVWELFHTELVFLYRQLFVLRDVYKEPLKRCQVEGCLLL-------VEPDLLFGNLDQLCRISRTFCQSFLSLLSTVDKENWDCTQLVVD---LFERFSKGPSTISAYQAYCINYKATMEYLGSIRQKEERFTEFERICLADERCFRLQLEDLLIAPLQRITRLPILLREIHKRSEEEESKGKVEKVIDTMTESLRSIDDSVQWLHNFERLQQLQT-----QVVWPNISDLEPKSYVPDFLRVALSRQFCENLLAHPRRKLIHE----GPLELVEN-GRTVDMYAFLFNDMFVLTKTKKCASKLKVKGVPIGKSEHYIVQRQPVPLDSCVFCDADSNDQATPMSLKFAFVIIHLTRYYQVVGIYTLQAADKADKELWIE 554          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0332699)

HSP 1 Score: 160.229 bits (404), Expect = 4.208e-40
Identity = 102/344 (29.65%), Postives = 180/344 (52.33%), Query Frame = 3
Query:  636 QSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKL-DLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXX-XXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            Q+AIWEL+ TE  ++  +  +  +++   E ++ +     V    +FSN++ V   + +FW   + P++ +  +T +  +    ++GF+    I  PY +YC E S C+     L  +N LF  Y+ W  + +  NR  L D + +P  RLTKY +LL AI+K+ S ++E   I  M+ +V+ FV  VN  +      ++L+ +   I++YDV++   + L  +I Q S++ DL AP++      +R + ++G  K ++   K+ DV  FLLTD+LL+ K   K+ +G  KVI+ P   D + +  +  N+  CV LN+F   T  +     + K    W + L
Sbjct:  247 QTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKS-DVHCFLLTDLLLVCKTIAKRGLGALKVIRQPYLTDQLIVQLAPNNTLNCVYLNEFQVATTAFTLQCTEAKN---WYDAL 586          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0332698)

HSP 1 Score: 160.999 bits (406), Expect = 4.359e-40
Identity = 98/327 (29.97%), Postives = 174/327 (53.21%), Query Frame = 3
Query:  636 QSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKL-DLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLX-XXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALY 1604
            Q+AIWEL+ TE  ++  +  +  +++   E ++ +     V    +FSN++ V   + +FW   + P++ +  +T +  +    ++GF+    I  PY +YC E S C+     L  +N LF  Y+ W  + +  NR  L D + +P  RLTKY +LL AI+K+ S ++E   I  M+ +V+ FV  VN  +      ++L+ +   I++YDV++   + L  +I Q S++ DL AP++      +R + ++G  K ++   K+ DV  FLLTD+LL+     K+ +G  KVI+ P   D + +  +  N+  CV LN+F   T  +
Sbjct:  811 QTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKS-DVHCFLLTDLLLVCKTIAKRGLGALKVIRQPYLTDQLIVQLAPNNTLNCVYLNEFQVATTAF 1136          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0302716)

HSP 1 Score: 160.999 bits (406), Expect = 4.359e-40
Identity = 98/327 (29.97%), Postives = 174/327 (53.21%), Query Frame = 3
Query:  636 QSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKL-DLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLX-XXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALY 1604
            Q+AIWEL+ TE  ++  +  +  +++   E ++ +     V    +FSN++ V   + +FW   + P++ +  +T +  +    ++GF+    I  PY +YC E S C+     L  +N LF  Y+ W  + +  NR  L D + +P  RLTKY +LL AI+K+ S ++E   I  M+ +V+ FV  VN  +      ++L+ +   I++YDV++   + L  +I Q S++ DL AP++      +R + ++G  K ++   K+ DV  FLLTD+LL+     K+ +G  KVI+ P   D + +  +  N+  CV LN+F   T  +
Sbjct:  811 QTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKS-DVHCFLLTDLLLVCKTIAKRGLGALKVIRQPYLTDQLIVQLAPNNTLNCVYLNEFQVATTAF 1136          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0302715)

HSP 1 Score: 160.614 bits (405), Expect = 7.005e-40
Identity = 99/327 (30.28%), Postives = 175/327 (53.52%), Query Frame = 3
Query:  636 QSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKL-DLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXX-XXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALY 1604
            Q+AIWEL+ TE  ++  +  +  +++   E ++ +     V    +FSN++ V   + +FW   + P++ +  +T +  +    ++GF+    I  PY +YC E S C+     L  +N LF  Y+ W  + +  NR  L D + +P  RLTKY +LL AI+K+ S ++E   I  M+ +V+ FV  VN  +      ++L+ +   I++YDV++   + L  +I Q S++ DL AP++      +R + ++G  K ++   K+ DV  FLLTD+LL+ K   K+ +G  KVI+ P   D + +  +  N+  CV LN+F   T  +
Sbjct:  844 QTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKS-DVHCFLLTDLLLVCKTIAKRGLGALKVIRQPYLTDQLIVQLAPNNTLNCVYLNEFQVATTAF 1169          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Fly
Match: CG42674 (gene:FBgn0261556 transcript:FBtr0302713)

HSP 1 Score: 160.229 bits (404), Expect = 8.063e-40
Identity = 99/327 (30.28%), Postives = 175/327 (53.52%), Query Frame = 3
Query:  636 QSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKY-SGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKL-DLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXX-XXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALY 1604
            Q+AIWEL+ TE  ++  +  +  +++   E ++ +     V    +FSN++ V   + +FW   + P++ +  +T +  +    ++GF+    I  PY +YC E S C+     L  +N LF  Y+ W  + +  NR  L D + +P  RLTKY +LL AI+K+ S ++E   I  M+ +V+ FV  VN  +      ++L+ +   I++YDV++   + L  +I Q S++ DL AP++      +R + ++G  K ++   K+ DV  FLLTD+LL+ K   K+ +G  KVI+ P   D + +  +  N+  CV LN+F   T  +
Sbjct:  844 QTAIWELVTTEVYYIHALQTVTDLFLACLEAVQEEGLLIDVDQARLFSNVRAVCEANIKFWTLWLYPMVAHSAITHEPLRCAFFQEGFLSFASIFAPYKIYCAEQSTCQFYCKELNHNNALFTSYLAWCESQKMCNRLRLADIVVRPMQRLTKYSLLLAAIKKHMSDVEEIEAIDVMMHSVENFVGSVNNHLTMRQENERLKGVMVRIESYDVVDTNNEVLDKMIKQNSQMFDLCAPMRGCPAYHVRHLFMEGDHKFKDNLGKS-DVHCFLLTDLLLVCKTIAKRGLGALKVIRQPYLTDQLIVQLAPNNTLNCVYLNEFQVATTAF 1169          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 199.904 bits (507), Expect = 1.417e-52
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  296 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 727          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 199.904 bits (507), Expect = 1.579e-52
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  348 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 779          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 199.519 bits (506), Expect = 1.695e-52
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  248 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 679          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 199.519 bits (506), Expect = 1.695e-52
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  248 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 679          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Zebrafish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 199.519 bits (506), Expect = 1.695e-52
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  248 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 679          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 169.859 bits (429), Expect = 9.542e-43
Identity = 107/347 (30.84%), Postives = 187/347 (53.89%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGF-EILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGF-IKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ AIWEL+ TE  ++K++  I  +++     +       +V  +++FSN++++     +     + P++E    T+ +  P   + GF  K+ E + +PYI YC E   C   + +L + NELF  Y+ W+   ++ NR  L+D L KP  RLTKY +LL++I +K   +  +  I  MI +V+ F++ VN ++ +    ++L  + S ID+Y+ ++   D++  I+ ++ +LDLTAP+     +  R++LL+GS+K++EG    +DV  FL TD+ LITK  KK      + + P+ +D I   +  +  SF+ + LN+F    A Y F    Q     W E  
Sbjct:  352 HQQEAIWELLHTEATYIKKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEI----IQLHSTVMVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKILKEFCRLDLTAPMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERTKVIRQ-PLLVDKIVCRELKDPGSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAF 693          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 169.859 bits (429), Expect = 1.023e-42
Identity = 108/347 (31.12%), Postives = 188/347 (54.18%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGF-IKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ AIWEL+ TE  ++K++  I  +++     L+      +V  +++FSN++++     +     + P++E    T+ +  P   + GF  K+ E + +PYI YC E   C   + +L + NELF  Y+ W+   ++ NR  L+D L KP  RLTKY +LL++I +K   +  +  I  MI +V+ F++ VN ++ +    ++L  + S ID+Y+ ++   D++  I+ ++ +LDLTAP+     +  R++LL+GS+K++EG    +DV  FL TD+ LITK  KK      + + P+ +D I   +  +  SF+ + LN+F    A Y F    Q     W E  
Sbjct:  350 HQQEAIWELLHTEATYIKKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEI----IQLHSTVMVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKILKEFCRLDLTAPMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERTKVIRQ-PLLVDKIVCRELKDPGSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAF 691          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 169.859 bits (429), Expect = 1.048e-42
Identity = 108/347 (31.12%), Postives = 188/347 (54.18%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGF-IKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ AIWEL+ TE  ++K++  I  +++     L+      +V  +++FSN++++     +     + P++E    T+ +  P   + GF  K+ E + +PYI YC E   C   + +L + NELF  Y+ W+   ++ NR  L+D L KP  RLTKY +LL++I +K   +  +  I  MI +V+ F++ VN ++ +    ++L  + S ID+Y+ ++   D++  I+ ++ +LDLTAP+     +  R++LL+GS+K++EG    +DV  FL TD+ LITK  KK      + + P+ +D I   +  +  SF+ + LN+F    A Y F    Q     W E  
Sbjct:  357 HQQEAIWELLHTEATYIKKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEI----IQLHSTVMVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKILKEFCRLDLTAPMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERTKVIRQ-PLLVDKIVCRELKDPGSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAF 698          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 169.859 bits (429), Expect = 1.049e-42
Identity = 108/347 (31.12%), Postives = 188/347 (54.18%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGF-IKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ AIWEL+ TE  ++K++  I  +++     L+      +V  +++FSN++++     +     + P++E    T+ +  P   + GF  K+ E + +PYI YC E   C   + +L + NELF  Y+ W+   ++ NR  L+D L KP  RLTKY +LL++I +K   +  +  I  MI +V+ F++ VN ++ +    ++L  + S ID+Y+ ++   D++  I+ ++ +LDLTAP+     +  R++LL+GS+K++EG    +DV  FL TD+ LITK  KK      + + P+ +D I   +  +  SF+ + LN+F    A Y F    Q     W E  
Sbjct:  381 HQQEAIWELLHTEATYIKKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEI----IQLHSTVMVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKILKEFCRLDLTAPMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERTKVIRQ-PLLVDKIVCRELKDPGSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAF 722          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Xenopus
Match: PLEKHG5 (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:100496612])

HSP 1 Score: 169.474 bits (428), Expect = 1.184e-42
Identity = 108/347 (31.12%), Postives = 188/347 (54.18%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGF-IKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ AIWEL+ TE  ++K++  I  +++     L+      +V  +++FSN++++     +     + P++E    T+ +  P   + GF  K+ E + +PYI YC E   C   + +L + NELF  Y+ W+   ++ NR  L+D L KP  RLTKY +LL++I +K   +  +  I  MI +V+ F++ VN ++ +    ++L  + S ID+Y+ ++   D++  I+ ++ +LDLTAP+     +  R++LL+GS+K++EG    +DV  FL TD+ LITK  KK      + + P+ +D I   +  +  SF+ + LN+F    A Y F    Q     W E  
Sbjct:  362 HQQEAIWELLHTEATYIKKLKVITDLFLCCLLNLQESGILCEVEPDKLFSNIQEI----IQLHSTVMVPILEKARKTKSLLNPMDFQKGFRFKMFESLFKPYIRYCMEEEGCMEYMRNLHRDNELFKSYVTWSEKHKQCNRLKLSDMLVKPHQRLTKYPLLLKSILKKTDDLQVRESIILMISSVERFINHVNSRMRQRQEQQRLAAIISRIDSYEAVDSSTDEVDKILKEFCRLDLTAPMIGTSPEDTRQLLLEGSLKMKEGKDSKMDVYCFLFTDLFLITKPVKKAERTKVIRQ-PLLVDKIVCRELKDPGSFLLIYLNEFRSAVAAYTFQASGQSLCRGWIEAF 703          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 189.504 bits (480), Expect = 3.703e-49
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  374 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTI 717          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 189.504 bits (480), Expect = 3.721e-49
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  406 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTI 749          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 189.504 bits (480), Expect = 3.980e-49
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  406 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTI 749          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 189.119 bits (479), Expect = 4.013e-49
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  393 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTI 736          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Mouse
Match: Plekhg5 (pleckstrin homology domain containing, family G (with RhoGef domain) member 5 [Source:MGI Symbol;Acc:MGI:2652860])

HSP 1 Score: 189.119 bits (479), Expect = 5.717e-49
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  436 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTI 779          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. UniProt/SwissProt
Match: sp|O94827|PKHG5_HUMAN (Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens OX=9606 GN=PLEKHG5 PE=1 SV=3)

HSP 1 Score: 193.741 bits (491), Expect = 9.506e-50
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I+ +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  YI WA    +  R  L+D LAKP  RLTKY +LL+++ +K      K  +  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAPI     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + +VI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  392 HQQEAVWELLHTEASYIRKLRVIINLFLCCLLNLQESGLLCEVEAERLFSNIPEIAQLHRRLWASVMAPVLEKARRTRALLQPGDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYITWAEKHPQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTEEPRAKEAVVAMIGSVERFIHHVNACMRQRQERQRLAAVVSRIDAYEVVESSSDEVDKLLKEFLHLDLTAPIPGASPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTRVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASGQALCRGWVDTI 735          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. UniProt/SwissProt
Match: sp|Q6RFZ7|PKHG5_RAT (Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus OX=10116 GN=Plekhg5 PE=1 SV=1)

HSP 1 Score: 189.889 bits (481), Expect = 1.864e-48
Identity = 111/345 (32.17%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   + SL + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++   + ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +TL
Sbjct:  372 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPELARLHRGLWSSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRSLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDEPRAKEAIITMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKFLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIHLNEFHSAVGAYTFQASSQALCRSWVDTL 715          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. UniProt/SwissProt
Match: sp|Q66T02|PKHG5_MOUSE (Pleckstrin homology domain-containing family G member 5 OS=Mus musculus OX=10090 GN=Plekhg5 PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 2.784e-48
Identity = 109/345 (31.59%), Postives = 185/345 (53.62%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE ++++++  I  +++     L+      +V +E +FSN+ ++  +    W   + PV+E    TR + +P     GF   G + +PYI YC E   C   +  L + N+LF  Y+ WA   ++  R  L+D LAKP  RLTKY +LL+++ +K      K  I  MI +V+ F+  VN  + +    ++L  + S ID Y+V+E   D++  ++ ++  LDLTAP+     +  R++LL+GS++++EG    +DV  FL TD+LL      K   + KVI+PP+ +D I   +  +  SF+ + LN+F+     Y F    Q     W +T+
Sbjct:  406 HQQEAVWELLHTEVSYIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKARRTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQQCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMRQRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGSLRMKEGKDSKMDVYCFLFTDLLL-VTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLIYLNEFHSAVGAYTFQASSQALCRSWVDTI 749          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. UniProt/SwissProt
Match: sp|Q8R0J1|PKHG6_MOUSE (Pleckstrin homology domain-containing family G member 6 OS=Mus musculus OX=10090 GN=Plekhg6 PE=2 SV=2)

HSP 1 Score: 185.652 bits (470), Expect = 1.306e-47
Identity = 96/331 (29.00%), Postives = 184/331 (55.59%), Query Frame = 3
Query:  615 NKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGF-EILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNE-IQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITA 1598
            N+++  QQ A+WEL+ TE  +L+++  +  +   G   + R     +V +E +F N+ ++      FW+  ++P++E+   + Q   P  L++GF+  G+  +PY+ YC  + +  +     + +N LF  +++W    + S R+ L D L KP  R+TKY +LLQA++K S      E +  MI+AV++F+  +N ++ +    + L  +   I  Y+V+EP  +++   +  +S LDL  P+     +  R++LL+G V+++EG    +DV LFL +D+LL     ++   + KVI+PP+ L+ +      + NSF+ + L +F C+++
Sbjct:  156 NRQLCHQQEALWELLTTELIYLRKLKIMTDLLAAGLLNLQRVGLLTEVSAETLFGNVPNLIRAHRRFWEEVLQPILEDTRTSGQPLDPVSLQNGFLTFGQRFQPYVQYCLRVKQTMAYAREQQDTNPLFHTFVQWCEKHKRSGRQTLGDLLIKPHQRITKYPLLLQAVRKRSPEPRAQEALNAMIEAVESFLRHINGQVRQGEEQESLMAVAQRIGPYEVLEPSSEEVEKNLRPFSTLDLMTPVLGVAPEYTRQLLLEGPVRVKEGREGKMDVYLFLFSDVLL-VTKPQRKADRAKVIRPPLMLEKLVCRPLRDPNSFLLIHLTEFQCVSS 485          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. UniProt/SwissProt
Match: sp|Q3KR16|PKHG6_HUMAN (Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6 PE=1 SV=3)

HSP 1 Score: 177.563 bits (449), Expect = 5.457e-45
Identity = 101/338 (29.88%), Postives = 180/338 (53.25%), Query Frame = 3
Query:  606 VYGNKEIYQ----QQSAIWELMVTEQNFLKQIHFIVQIYVVGF-EILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNE-IQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITA 1598
            V G+KE+ Q    QQ A+WEL+ TE  +++++  +  +   G   + R     +V +E +F N+  +      FW   + P +E    + Q   P  L+ GF+  G+   PY+ YC  + +  +     +++N LF  +++W    + S R+ L D L KP  R+TKY +LL A+ K S      E +  MI+AV++F+  +N ++ +    + L      I  Y+V+EP  D++   +  +S LDLT+P+     +  R++LL+G V+++EG    +DV LFL +D+LL     ++   K KVI+PP+ L+ +      + NSF+ + L +F C+++
Sbjct:  149 VPGHKEMSQELCHQQEALWELLTTELIYVRKLKIMTDLLAAGLLNLQRVGLLMEVSAETLFGNVPSLIRTHRSFWDEVLGPTLEETRASGQPLDPIGLQSGFLTFGQRFHPYVQYCLRVKQTMAYAREQQETNPLFHAFVQWCEKHKRSGRQMLCDLLIKPHQRITKYPLLLHAVLKRSPEARAQEALNAMIEAVESFLRHINGQVRQGEEQESLAAAAQRIGPYEVLEPPSDEVEKNLRPFSTLDLTSPMLGVASEHTRQLLLEGPVRVKEGREGKLDVYLFLFSDVLL-VTKPQRKADKAKVIRPPLMLEKLVCQPLRDPNSFLLIHLTEFQCVSS 485          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. TrEMBL
Match: A0A498ME76 (Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Labeo rohita OX=84645 GN=ROHU_025710 PE=4 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.559e-49
Identity = 113/359 (31.48%), Postives = 190/359 (52.92%), Query Frame = 3
Query:  600 QQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R +  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  + +M+ AV+ F++ V+ ++ +    +KL  +   I+ Y+ +E   +++  I+ +Y+  DLTAP+     + IR++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  399 KQLLDNPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLSEVEPVRLFSNIQDIVQLHTSLWAEVMLPALEKARQKRSVISPTELYQGFSTFGFRFKPYIHYCMEEEACMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREALNKMVAAVECFINSVDSQMRQREEKQKLAAIAGRIEAYEAVEGASEEVERILREYNNFDLTAPVMGAPPEEIRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKSVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFRCAVASYCFQANSGTQGRSWIEAI 757          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. TrEMBL
Match: A0A498P3K8 (Pleckstrin homology domain-containing family G member 5-like isoform X1 OS=Labeo rohita OX=84645 GN=ROHU_013959 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 1.691e-49
Identity = 113/359 (31.48%), Postives = 190/359 (52.92%), Query Frame = 3
Query:  600 QQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R +  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  + +M+ AV+ F++ V+ ++ +    +KL  +   I+ Y+ +E   +++  I+ +Y+  DLTAP+     + IR++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  399 KQLLDNPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLSEVEPVRLFSNIQDIVQLHTSLWAEVMLPALEKARQKRSVISPTELYQGFSTFGFRFKPYIHYCMEEEACMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREALNKMVAAVECFINNVDSQMRQREEKQKLAAIAGRIEAYEAVEGASEEVERILREYNNFDLTAPVMGAPPEEIRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKSVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFRCAVASYCFQANSGTQGRSWIEAI 757          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. TrEMBL
Match: A0A2R8QB15 (Pleckstrin homology domain-containing, family G (with RhoGef domain) member 5a OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.171e-49
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  296 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 727          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. TrEMBL
Match: A0A5A9NCJ2 (Pleckstrin-like proteiny domain-containing family G member 5 OS=Triplophysa tibetana OX=1572043 GN=E1301_Tti010529 PE=4 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.389e-49
Identity = 114/359 (31.75%), Postives = 190/359 (52.92%), Query Frame = 3
Query:  600 QQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            +Q+  N EI       QQ A+WEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R +  P  L  GF       +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I +M+ AV+ F++ V+ ++ +    +KL  + S I++Y+ +E   +++  I+ +Y+  DLTAP+     +  R++LL+GS+K++EG    +DV  FL TD+LLITK  K+      + +P I  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  388 KQLLENPEILSRRQCHQQEAVWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLSEVEPARLFSNIQDIVQLHTSLWAEVMLPALEKARQKRTLLDPIDLHQGFCTFSFRFKPYICYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTEDPPTREAINKMVAAVECFINSVDSQMRQREEKQKLAAIASRIESYEAVEGASEEVERILKEYNNFDLTAPVMGVPPEETRQLLLEGSLKMKEGKESKMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLIIRNVVCRELKDPGSFLLIYLNEFRCAVASYCFQANSGTQGRTWMEAI 746          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. TrEMBL
Match: F1R1Q2 (Pleckstrin homology domain-containing, family G (with RhoGef domain) member 5a OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=2)

HSP 1 Score: 199.904 bits (507), Expect = 3.532e-49
Identity = 136/435 (31.26%), Postives = 216/435 (49.66%), Query Frame = 3
Query:  390 PHRNRQRRSS-FSLLFPI-KGYSELDTKDIREELIRDMCLKLKDFTKSALP----NLSSNNMSENAFPPSLPENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            P R R R +S FS LF    G   L  +  R E ++    KL  +T   LP     LS +  S    P    E + +Q+  N EI       QQ AIWEL+ TE +++K++H I  +++ G   L+      +V    +FSN++D+  +    W   + P +E     R M  P  L  GF   G   +PYI YC E   C   + +L K NELF  Y+ WA   ++ NR  LTD L KP  RLTKY +LL+++ +K      +  I  M+ AV+ F++ V+ ++      +KL  +   I+ Y+ +E   +++  I+ +Y+  DL AP+     +  R++LL+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F C  A Y F      +   W E +
Sbjct:  348 PDRWRNRAASRFSGLFSSNSGNGSLGKECDRVEQLQS---KLYSYTMFGLPKMPPQLSFHRDSWEEEPNLELEESWKQLLENPEILTRRQCHQQEAIWELLQTESDYIKKLHVITDLFLCGLLNLQESGLLTEVEPTRLFSNIQDIVQLHSSLWTEVMLPALEKARQKRTMLNPTELHQGFSTFGFRFKPYIRYCMEEEGCMEYMRTLLKDNELFRIYVTWAETHKQCNRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPPTREAINRMVAAVECFINSVDSQMRHREEKQKLAAIAGRIEAYEAVEGASEEVERILKEYNNFDLMAPVMGAPPEETRQLLLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIHNVVCRELKDPGSFLLIYLNEFGCAVASYCFQANSGAQGRSWIEAI 779          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Cavefish
Match: plekhg6 (pleckstrin homology domain containing, family G (with RhoGef domain) member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-2517])

HSP 1 Score: 133.265 bits (334), Expect = 1.815e-31
Identity = 93/345 (26.96%), Postives = 171/345 (49.57%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFP-KVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYS-GIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHK-SNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE  ++ ++  I ++ +   E +  + F  +V S ++FSNL  +      FW+  + P++ N   T Q F P  L+ G ++  E    Y+ YC E  +         +SN  F  Y+ W     +  R  L D  AKP  R+TKY +LL+AI K +     +  +  M+++V  F+  +N+ ++  +    L +L+  I+ Y+  + + +++   I +  + DLT+P+Q     VIR++L++ ++K+R      ++V   L TD+LL     +K   K+KV++PP+ L+     +  +  SF+ V  +D  C   +Y  S    +    W   +
Sbjct:  153 HQQEALWELLQTELVYINKLTIITELVLSALEYVHQRGFLLEVTSAQLFSNLPSILEAHKLFWRDVMYPMLINVRQTGQPFDPLKLEPGCLQFAERFSAYLDYCWEEERNVEFTRRQLESNPQFQAYLLWVETHPQCVRMRLGDMQAKPHQRITKYPLLLKAILKTTEDTHTQGTLHRMLNSVGQFLDSINDYLQFKDDELALFDLSQRIEGYET-QGMNEEIDKFIQEACRFDLTSPVQGMGPTVIRKLLMEETLKVRGRKDSKLEVVALLFTDVLL-LTKSQKKSEKHKVVRPPVSLERTHCAELKDGYSFVLVEASDLGCAVNVYSVSAPSPESCTAWVSAI 495          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Cavefish
Match: plekhg5a (pleckstrin homology domain containing, family G (with RhoGef domain) member 5a [Source:ZFIN;Acc:ZDB-GENE-060503-766])

HSP 1 Score: 124.02 bits (310), Expect = 6.693e-29
Identity = 73/235 (31.06%), Postives = 127/235 (54.04%), Query Frame = 3
Query:  954 CRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNE-IQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            C   + +L K NELF  Y+ WA   ++ +R  LTD L KP  RLTKY +LL+++ K +      E +  MI  V+ F++ V+ ++ +    +KL  + S I+ Y+ +E   +++  I+ +Y++ DLTAP+       IR++ L+G++K++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  +F+ + LN+F    A Y F      +   W E +
Sbjct:    6 CMEYMRTLLKDNELFRIYVTWAETHKQCSRLKLTDMLVKPHQRLTKYPLLLKSVLKKTDDPAAREAVTRMIAVVEGFINSVDSQMRQREEKQKLTAIASRIEAYEAVEGASEEVEKILREYNQFDLTAPVMGASPDEIRQLHLEGALKMKEGKESRMDVYCFLFTDVLLITKPVKRVEKVKVIRQPLVIQNVVCRELKDPGAFLLIYLNEFRTAVASYCFQANSATQGRSWVEAV 240          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Cavefish
Match: plekhg5b (pleckstrin homology domain containing, family G (with RhoGef domain) member 5b [Source:ZFIN;Acc:ZDB-GENE-090908-6])

HSP 1 Score: 89.7373 bits (221), Expect = 4.258e-18
Identity = 54/199 (27.14%), Postives = 111/199 (55.78%), Query Frame = 3
Query: 1062 LAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            LAKP  RLTKY +LL+ I +K      K+ +  M+  V++F++ V+ K+ +    +KL  +++ +++Y+ +E   +++   + +++++DLTAP+     +  R++ L+G+++++EG    ++V  FL TD+LLITK  K+      + +P +  + +     +  SF+ + LN+F    A Y F      +   W + +
Sbjct:    2 LAKPHQRLTKYPLLLKTILKKTDDSAAKDALLNMVVCVESFINSVDSKMLQRQEKQKLAAISARVESYEAVEGSSEEVERALREFNRIDLTAPMIDTSPEETRQLHLEGALRMKEGKDSRMEVYCFLFTDLLLITKPVKRLEKVKVIRQPLLIHNIVCKELKDPGSFVLIYLNEFKSAVAAYSFQANSTSQGRSWVDAI 200          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Cavefish
Match: plekhg5b (pleckstrin homology domain containing, family G (with RhoGef domain) member 5b [Source:ZFIN;Acc:ZDB-GENE-090908-6])

HSP 1 Score: 72.7886 bits (177), Expect = 8.007e-13
Identity = 64/232 (27.59%), Postives = 101/232 (43.53%), Query Frame = 3
Query:  357 NASNKNLTPNIPHRNRQRRSSFS-LLFPIKGYSELDTKDIREELIRDMCLKLKDFTKSALPNLSS------NNMSENAFPPSLP-ENNLQQVYGNKEIY-----QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRP-KYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYI 1010
              S  +L P   +R  +  S FS   FP  G  E+D    R E + +   +L+ +T   LP +        ++  E    P+L  E + Q +  N E        QQ AIWEL+ TE   LK++  I  +++ G   L+      +V   ++F+N++D+  V    W   + P +E     R +  P  +  GF       EPY+ YC E   C   + +  + NELF  YI
Sbjct:  313 GGSLPSLPPGFDNRKNRAASRFSGFFFPGSG-KEVD----RVEQLNN---RLQMYTFHGLPKVPPQPSFHHDSWEEEEDEPNLTLEESWQNLLENPETLSERQLHQQEAIWELLQTEATNLKKLRVITDLFLCGLLNLQDCGLLVEVEPAKLFNNIQDLVRVHTALWNQVMLPALERARRDRSLLDPTDMHLGFQTFSSRFEPYLRYCMEEESCMEYMRTQLRDNELFKIYI 536          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Cavefish
Match: plekhg7 (pleckstrin homology domain containing, family G (with RhoGef domain) member 7 [Source:ZFIN;Acc:ZDB-GENE-070410-15])

HSP 1 Score: 63.5438 bits (153), Expect = 4.465e-10
Identity = 75/289 (25.95%), Postives = 131/289 (45.33%), Query Frame = 3
Query:  627 YQQQSAIWELMVTE-QNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLI--PIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREG------TSKTVDVKLFLLTDILL 1457
            +++Q AIWEL  +E   FL Q+  + ++++     L+ +     + S  +F+NL ++  VSF F    +R + E +          LL       GE I      YC   +     + SL K+ E F  Y+KW    E+  R  L D L  P  R T+Y +LL+ I ++ SG +E+  +Q +++ VD  +  +  K++             ++D Y  ++ L + L+  P+     K  +   +++  + V  E L+   V L EG       +K  +V LFL  + LL
Sbjct:   22 HKRQEAIWELFTSECVYFLDQLMVLKEVFLTTLSDLQMRDCLQDIDSWGLFANLNELCLVSFGFLTSLLRVIKELWATPETDVTQTLLAVMKKAFGESICHCLQKYCLNYTTAILYLDSL-KTREDFGSYVKWCERKEQCRRLQLKDLLVAPLQRFTRYPLLLKNIERRSSGEEEEGGLQSVVELVDRAICDLEGKVK-------------WLDNYQKVKQLKEALVWLPVWEIDKKAHVPESLKHLLKAVTLENLVSNRVLLYEGKLILTENAKLHEVYLFLFDEFLL 296          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000058.1 (pep scaffold:Pmarinus_7.0:GL483830:992:10453:1 gene:ENSPMAG00000000054.1 transcript:ENSPMAT00000000058.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 1.887e-7
Identity = 50/203 (24.63%), Postives = 96/203 (47.29%), Query Frame = 3
Query:  624 IYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFP---KVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEE-----SNREPLTDHLAKPFLRLTKYKILLQAIQKY---SGIDEKNEIQEMIDAVDTFVSQVNE 1199
            + ++Q    EL+ TE+++++ + ++V+ Y+    ++R  + P   K   + +F N+  +     +F+           E+ + + +P  L   FIK    L  YI+YC           +  KS  + +EYI     FEE      +R  LTD L KP  R+ KY++LL+ I K+   +G+D   +++  ++ +     Q N+
Sbjct:   47 LRRRQYVFQELVETERDYVRDLGYVVEGYMA---VMREDWVPDDLKGKDKMVFGNIHQIHDWHRDFFLG---------ELEKCLEEPDRLAPLFIKHERRLHMYIVYC----------QNKPKSEHIVSEYID--TYFEELKQRMGHRLQLTDLLIKPVQRIMKYQLLLKDILKFTRKAGLD-STDLERAVEVMCVVPKQCND 224          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002100.1 (pep scaffold:Pmarinus_7.0:GL476406:348473:416758:-1 gene:ENSPMAG00000001847.1 transcript:ENSPMAT00000002100.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 1.363e-6
Identity = 51/218 (23.39%), Postives = 93/218 (42.66%), Query Frame = 3
Query:  762 EEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQ--------MFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGID-EKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAP---IQYGREKVIREILL 1379
            E IF N++++  V   F    +  + ++Y ++           FKPRLL             Y  YC+++    + I+ L ++ E F   +      E   +  L D L  P  R+ KY +LL+ + K++    EK +++  +DA++     +NE   +   +K++  +    D+  V    G+D       Y KL +      +Q GR K  R + L
Sbjct:   52 ETIFMNIEELHRVHRAF----VAEIRQSYSLSGGRKFHELFLTFKPRLL------------IYGRYCSQLEGAHTCINRLLQTREDFKNKLDECTTKENGGKFSLRDLLVVPMQRVLKYHLLLKELHKHTTDQTEKTQVKRALDAMEDLAMYLNEVKRDNETLKQIVEIQRSFDSSFV---QGED-------YGKLKMDGDLKVLQVGRAKQERYVFL 243          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Sea Lamprey
Match: ARHGEF11 (Rho guanine nucleotide exchange factor 11 [Source:HGNC Symbol;Acc:HGNC:14580])

HSP 1 Score: 49.6766 bits (117), Expect = 3.014e-6
Identity = 60/279 (21.51%), Postives = 124/279 (44.44%), Query Frame = 3
Query:  516 FTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLK-DGFIKIGEILEPYIL-YCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGI-----DEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLT 1331
            F+++A+P +S+     +A P + P   +     +           EL  TE+  ++ +  + +++   F  L P       + +IF NL ++  +  E     +R + E  ++  ++    L + DG  + GE+L+     +C+  S+    + S +K +  F + +  A +  +  R  L D +     RLTKY +LLQ I KY+ +      +  ++ +  +     ++ VNE + ET   ++L++    +D    +  L     P++  +  LDLT
Sbjct:  677 FSRAAVPTVSTVQQLRDAEPAAPPRRFVAAEPDSGGALSLCRGA-ELFHTEKKHVQNLKVLYEVF---FSRLAP-VLTNNETYQIFINLDEILPI-HESLNEAMRKIREKSQVVAEIGDLMLARFDG--EAGEVLKAATAKFCSLQSQALDIVRSKQKKDPRFQQLMMEAESKPKCRRLQLKDFMLTEMQRLTKYPLLLQNILKYTQVRTVEHPDHKKLHKAGECCRRILNDVNETVRETENAQRLEDYQRRLD----LSSLERSYNPLVTDFKNLDLT 943          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Nematostella
Match: EDO39608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9N2])

HSP 1 Score: 159.844 bits (403), Expect = 4.259e-40
Identity = 116/348 (33.33%), Postives = 191/348 (54.89%), Query Frame = 3
Query:  633 QQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFP-KVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEE-SNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDE-KNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNL-NSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKS-NTNSFICVCLNDFNCITALYHF--SNGDQKKIDLWTETL 1655
            QQ AIWEL+ TE  ++ ++  + +++++    ++ + F   V  E++FSN++D+  +++ FW  C+  V E    T +   P  + + F    +  EPYI YC E S+C          NE F  YI W       +NR  LTD+L KP  RLTKY +LL+AI K +  +E K  I +MI  V++ +S+VN  + E     KL+++ N   D Y VIE + +++  I+  Y+ LDL   I  G + + R ++ +G ++L E   K +DV +FL TD+LL    K K   KY+VIKPP+ +D + +H S +  +F+ V +N++N +   +    SN DQ +   W + +
Sbjct:  417 QQEAIWELLFTEVTYIHKLSIVKKLFILCLRNVQSEGFLLDVEIEKLFSNIEDIYELNYSFWVDCLCEVAEKSRKTGKPLNPMDMNEAFPMFDKRFEPYITYCMEESRCLKYFKEKIIENEDFRTYITWCEEHRLCTNRLKLTDYLVKPMQRLTKYPLLLKAIHKKTQDEEMKEGIWKMILTVESLLSKVNGAMREMYERNKLRSVANRIQDNYTVIEAVNEEMEKILVNYNSLDLMEHIP-GMD-IPRCVIHEGPLRLVEKQGK-MDVHVFLFTDLLL--ITKPKKADKYRVIKPPMMVDKLYVHASKDPGTFLLVYVNEYNTVVHAFALQGSNADQTQ---WMDAI 756          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Nematostella
Match: EDO49694 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG07])

HSP 1 Score: 75.0998 bits (183), Expect = 8.010e-14
Identity = 73/283 (25.80%), Postives = 133/283 (47.00%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIV--QIYVVGFEILR--PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEP-YILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYS--GIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILL 1457
            +++ A+WEL  +E  +L   H +V  ++++    I++   +Y   V    IF N++++  VS +F K  +  V +  +   Q      + + F + G  + P Y  YC   SK    +   +KS E F E++KW        R  LTD L  P   LTKY +LL+ I+K +  G D+ + +  +I +V+  + ++  K++    +++LQ L   +    ++E      +P       +    P +       R++L +G + L E T +  DV  FL  D+LL
Sbjct:  675 KRREALWELFHSEVVYLMD-HVLVLREVFLEPLRIVQQMEEYLQNVDPNMIFCNVEELCEVSAKFAKDLLL-VFKGDQSNSQFGSTAAVVNAFTEFGWRVHPQYQEYCLNYSKVLGYLDQCKKS-EDFQEFVKWCEADPRCKRLQLTDLLVAPLQHLTKYPLLLKNIRKRTSEGDDQHSSLSSVIKSVELSIKELEGKVKSLANLERLQELQKCLVWPSIVELDPKTYVPEF--LRGILAKQPCEGLLTSANRQLLHEGHLVLHESTKQ--DVYAFLFDDMLL 950          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Medaka
Match: plekhg5b (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:101161470])

HSP 1 Score: 192.2 bits (487), Expect = 3.935e-50
Identity = 104/345 (30.14%), Postives = 187/345 (54.20%), Query Frame = 3
Query:  627 YQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            + QQ AIWEL+ TE  ++K++  I  +++ G   L+      +V    +FSN++++  +    W   + PV+      R +  P LL DGF       +PYI YC E   C   + +L + NELF +YI WA   ++ NR  L D LAKP  RLTKY +LL+++ +K   +  ++ +  M+  V++F++ V+ ++ +    +KL  +++ ID Y+ +E   +++  I+ +Y++ DL AP++    +  R++ L+G+++++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SFI + LN+FN   A Y F      +   W + +
Sbjct:  355 FHQQEAIWELLNTEAAYIKKLRVITDLFLSGLLNLQESGLLSEVEPTRLFSNIQEIVRLHTSLWNQVMLPVLHRAREARALLDPTLLYDGFRTFDTRFQPYIRYCMEEESCMEYMRTLLRDNELFRKYITWAETKKQCNRLKLADMLAKPHQRLTKYPLLLKSVLKKTDELSARDIVSSMVVMVESFINSVDSQMRQRQERQKLATISARIDCYEAVEGSSEEVEKILKEYNRFDLMAPMRGTSPEETRQLQLEGALRMKEGKDSRMDVYCFLFTDLLLITKPVKRLEKVKVIRQPLLIHNIVCKELKDPGSFILIYLNEFNSAVAAYTFQANSATQGRCWIDAI 699          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Medaka
Match: plekhg5b (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:101161470])

HSP 1 Score: 191.815 bits (486), Expect = 4.910e-50
Identity = 104/345 (30.14%), Postives = 187/345 (54.20%), Query Frame = 3
Query:  627 YQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILR-PKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            + QQ AIWEL+ TE  ++K++  I  +++ G   L+      +V    +FSN++++  +    W   + PV+      R +  P LL DGF       +PYI YC E   C   + +L + NELF +YI WA   ++ NR  L D LAKP  RLTKY +LL+++ +K   +  ++ +  M+  V++F++ V+ ++ +    +KL  +++ ID Y+ +E   +++  I+ +Y++ DL AP++    +  R++ L+G+++++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SFI + LN+FN   A Y F      +   W + +
Sbjct:  399 FHQQEAIWELLNTEAAYIKKLRVITDLFLSGLLNLQESGLLSEVEPTRLFSNIQEIVRLHTSLWNQVMLPVLHRAREARALLDPTLLYDGFRTFDTRFQPYIRYCMEEESCMEYMRTLLRDNELFRKYITWAETKKQCNRLKLADMLAKPHQRLTKYPLLLKSVLKKTDELSARDIVSSMVVMVESFINSVDSQMRQRQERQKLATISARIDCYEAVEGSSEEVEKILKEYNRFDLMAPMRGTSPEETRQLQLEGALRMKEGKDSRMDVYCFLFTDLLLITKPVKRLEKVKVIRQPLLIHNIVCKELKDPGSFILIYLNEFNSAVAAYTFQANSATQGRCWIDAI 743          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Medaka
Match: plekhg5b (pleckstrin homology and RhoGEF domain containing G5 [Source:NCBI gene;Acc:101161470])

HSP 1 Score: 191.815 bits (486), Expect = 6.038e-50
Identity = 103/345 (29.86%), Postives = 186/345 (53.91%), Query Frame = 3
Query:  627 YQQQSAIWELMVTEQNFLKQIHFIVQIYVVGF-EILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI-QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            + QQ AIWEL+ TE  ++K++  I  +++ G   +       +V    +FSN++++  +    W   + PV+      R +  P LL DGF       +PYI YC E   C   + +L + NELF +YI WA   ++ NR  L D LAKP  RLTKY +LL+++ +K   +  ++ +  M+  V++F++ V+ ++ +    +KL  +++ ID Y+ +E   +++  I+ +Y++ DL AP++    +  R++ L+G+++++EG    +DV  FL TD+LLITK  K+      + +P +  + +     +  SFI + LN+FN   A Y F      +   W + +
Sbjct:  421 FHQQEAIWELLNTEAAYIKKLRVITDLFLSGLLNLQESGLLSEVEPTRLFSNIQEIVRLHTSLWNQVMLPVLHRAREARALLDPTLLYDGFRTFDTRFQPYIRYCMEEESCMEYMRTLLRDNELFRKYITWAETKKQCNRLKLADMLAKPHQRLTKYPLLLKSVLKKTDELSARDIVSSMVVMVESFINSVDSQMRQRQERQKLATISARIDCYEAVEGSSEEVEKILKEYNRFDLMAPMRGTSPEETRQLQLEGALRMKEGKDSRMDVYCFLFTDLLLITKPVKRLEKVKVIRQPLLIHNIVCKELKDPGSFILIYLNEFNSAVAAYTFQANSATQGRCWIDAI 765          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Medaka
Match: plekhg6 (pleckstrin homology and RhoGEF domain containing G6 [Source:NCBI gene;Acc:101169881])

HSP 1 Score: 113.62 bits (283), Expect = 2.636e-25
Identity = 84/346 (24.28%), Postives = 172/346 (49.71%), Query Frame = 3
Query:  630 QQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYF-PKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNEIQ--EMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIK-IHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
             QQ A+WEL+ TE  ++ ++  I  + +     L  + F  +V  +++F NL  +      FW+  + P+++    T + F P  L++G ++       Y  YC E            +SN  F  +I+W  +  +  R  L D  AKP  R+TKY +LL+A+ K++ ++   ++    M+ +V+ F+  +N+ +++ +  + L      ++ Y+V E + +++   + +  K +L  PI+    +V+R++LL+ ++K+R    + ++V   L +D++L     +K     KV++PP+ LD I+ I   + +SF+ V + +   +  +  F  G       W  T+
Sbjct:  168 HQQEALWELISTELIYINKLKIIKDLVIAALLNLHQRGFLQEVSPDQLFYNLPSILQAHQLFWQEVVYPMVQEVRQTGKPFDPMGLEEGCLQFHNRFLVYREYCWEEENSLDFTRKQMESNPHFQTFIQWVESHPQGERMRLGDMQAKPHQRITKYPLLLKAVLKHT-VEPPVQLALIGMLSSVNIFLESINDYMQKKDDEQALYISARRVEGYEV-EGITEEIDKYVQEICKFNLECPIRGVNPEVVRKLLLEENLKVRVRKDQKLEVVALLFSDVIL-LTKIQKRGEGLKVVRPPLALDRIECIALKDGSSFLLVEVGELQSVMNVLIFVAGTSLSCSKWVSTI 510          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Medaka
Match: plekhg7 (pleckstrin homology and RhoGEF domain containing G7 [Source:NCBI gene;Acc:101166867])

HSP 1 Score: 68.9366 bits (167), Expect = 1.670e-11
Identity = 78/291 (26.80%), Postives = 135/291 (46.39%), Query Frame = 3
Query:  603 QVYGNKEIYQQQSAIWELMVTE-QNFLKQIHFIVQIYVVGFEILRPK-YFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGE-ILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSG-IDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVI--REILLQGSVKLREGTSKTVDVKLFLLTDILL 1457
            Q+  +  + ++Q AIWEL  +E   FL Q+  + ++++V    L+ +     V    +F+N+ ++  VS  F +  +  + +  E+T +   P LL+       E I      YC   S     + SL K  E F  Y+KW    E+  R  L D L  P  RLT+Y +LL+ + K     +E+  +Q + + VDT +  +  K++  +  +K++ L   +    V E      IP   ++    +TA      + +I  R +L +G + L E T K +D  LFL  + LL
Sbjct:  322 QMSPDSHVRKRQEAIWELFTSECVYFLDQLMVLNEVFLVTLSNLQLRNCLTDVNVWSLFANVNELCLVSSSFLRNLLNVIKDTLEIT-ESGGPTLLELLSKAFKESICNSLQKYCLNYSSALLYLDSL-KLREDFGSYLKWCERKEQCRRLQLRDLLVAPLQRLTRYSLLLRNVAKRCQEEEERRGMQVIAEQVDTSICDLEGKVKWLHNFQKVKLLRDALVWTPVWERDKRAFIPETLKHLLKTVTA------DNLISHRSLLHEGKLVLTENT-KLIDAYLFLFDEFLL 603          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 820.461 bits (2118), Expect = 0.000e+0
Identity = 439/530 (82.83%), Postives = 449/530 (84.72%), Query Frame = 3
Query:   66 MNQSRRKSSTDLLTMPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSIEDDNEVDQTDSSVYHVSSVARNNLPSTNLMDYENRLIIQSNFSSSLCNASNKNLTPNIPHRNRQRRSSFSLLFPIKGYSELDTKDIREELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            MNQSRRKSSTDLLTMPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSIEDDNEVDQTDSSVYHVSSVARNNL STN +  +  L ++    S+L N S+ N++ N               FP                                P+L  NN+              QQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYE TRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEK EIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCIT LYHFSNGDQKKIDLWTETL
Sbjct:    1 MNQSRRKSSTDLLTMPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSIEDDNEVDQTDSSVYHVSSVARNNLSSTNELIRDMCLKLKDFTKSALPNLSSNNMSENA--------------FP--------------------------------PSLPENNL--------------QQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCITGLYHFSNGDQKKIDLWTETL 470          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 425/516 (82.36%), Postives = 435/516 (84.30%), Query Frame = 3
Query:  108 MPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSIEDDNEVDQTDSSVYHVSSVARNNLPSTNLMDYENRLIIQSNFSSSLCNASNKNLTPNIPHRNRQRRSSFSLLFPIKGYSELDTKDIREELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            MPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSIEDDNEVDQTDSSVYHVSSVARNNL STN +  +  L ++    S+L N S+ N++ N               FP                                P+L  NN+              QQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYE TRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEK EIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCIT LYHFSNGDQKKIDLWTETL
Sbjct:    1 MPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSIEDDNEVDQTDSSVYHVSSVARNNLSSTNELIRDMCLKLKDFTKSALPNLSSNNMSENA--------------FP--------------------------------PSLPENNL--------------QQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCITGLYHFSNGDQKKIDLWTETL 456          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 389/392 (99.23%), Postives = 389/392 (99.23%), Query Frame = 3
Query:  480 ELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            ELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYE TRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEK EIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCIT LYHFSNGDQKKIDLWTETL
Sbjct:   31 ELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCITGLYHFSNGDQKKIDLWTETL 422          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Planmine SMEST
Match: SMESG000023540.1 (SMESG000023540.1)

HSP 1 Score: 765.763 bits (1976), Expect = 0.000e+0
Identity = 389/392 (99.23%), Postives = 389/392 (99.23%), Query Frame = 3
Query:  480 ELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLXXXXXXXXXXXXXXXXPPIFLDSIKIHKSNTNSFICVCLNDFNCITALYHFSNGDQKKIDLWTETL 1655
            ELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYE TRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEK EIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCIT LYHFSNGDQKKIDLWTETL
Sbjct:   50 ELIRDMCLKLKDFTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVTEQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFWKYCIRPVIENYETTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSSISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAIQKYSGIDEKKEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYDVIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSKTVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFICVCLNDFNCITGLYHFSNGDQKKIDLWTETL 441          
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Planmine SMEST
Match: SMESG000023541.1 (SMESG000023541.1)

HSP 1 Score: 369.392 bits (947), Expect = 2.692e-123
Identity = 191/192 (99.48%), Postives = 191/192 (99.48%), Query Frame = 3
Query: 1740 MLRVDKSSPKFSRIRPKSQSNSESIDSDLQNEFSFRRKAPVTKKHKNRREFSDSKSKTYSGVPQRKNSNPISKPTNFFTDKNKLYKSNSFADDMEKSKTRKNLSDCSDIDEPFESSQKESQHLSTSKRSSVTEKSEKIGNLQSVNPSFSDLKVKDCRKTNNKTNNIIESNFSSKSVNKLEKKLSISLSTLNT 2315
            MLRVDKSSPKFSRIRPKSQSNSESIDSDLQNEFSFRRKAPVTKKHKNRREFSDSKSKTYSGVPQRKNSNPISKPTNFFTDKNKLYKSNSFADDMEKSKTRKNLSDCSDIDEPFESSQKE QHLSTSKRSSVTEKSEKIGNLQSVNPSFSDLKVKDCRKTNNKTNNIIESNFSSKSVNKLEKKLSISLSTLNT
Sbjct:    1 MLRVDKSSPKFSRIRPKSQSNSESIDSDLQNEFSFRRKAPVTKKHKNRREFSDSKSKTYSGVPQRKNSNPISKPTNFFTDKNKLYKSNSFADDMEKSKTRKNLSDCSDIDEPFESSQKEFQHLSTSKRSSVTEKSEKIGNLQSVNPSFSDLKVKDCRKTNNKTNNIIESNFSSKSVNKLEKKLSISLSTLNT 192          
The following BLAST results are available for this feature:
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG58.524e-5131.59pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.483e-5031.59pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.786e-5031.59pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.880e-5031.59pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.934e-5031.59pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rhgf-28.669e-2624.43RHo Guanine nucleotide exchange Factor [Source:Un... [more]
rhgf-29.468e-2624.43RHo Guanine nucleotide exchange Factor [Source:Un... [more]
rhgf-29.468e-2624.43RHo Guanine nucleotide exchange Factor [Source:Un... [more]
rhgf-29.582e-2624.43RHo Guanine nucleotide exchange Factor [Source:Un... [more]
prhg-13.407e-1123.48pep chromosome:WBcel235:I:912415:926877:-1 gene:WB... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG426744.208e-4029.65gene:FBgn0261556 transcript:FBtr0332699[more]
CG426744.359e-4029.97gene:FBgn0261556 transcript:FBtr0332698[more]
CG426744.359e-4029.97gene:FBgn0261556 transcript:FBtr0302716[more]
CG426747.005e-4030.28gene:FBgn0261556 transcript:FBtr0302715[more]
CG426748.063e-4030.28gene:FBgn0261556 transcript:FBtr0302713[more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg5a1.417e-5231.26pleckstrin homology domain containing, family G (w... [more]
plekhg5a1.579e-5231.26pleckstrin homology domain containing, family G (w... [more]
plekhg5a1.695e-5231.26pleckstrin homology domain containing, family G (w... [more]
plekhg5a1.695e-5231.26pleckstrin homology domain containing, family G (w... [more]
plekhg5a1.695e-5231.26pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG59.542e-4330.84pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.023e-4231.12pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.048e-4231.12pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.049e-4231.12pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG51.184e-4231.12pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhg53.703e-4931.59pleckstrin homology domain containing, family G (w... [more]
Plekhg53.721e-4931.59pleckstrin homology domain containing, family G (w... [more]
Plekhg53.980e-4931.59pleckstrin homology domain containing, family G (w... [more]
Plekhg54.013e-4931.59pleckstrin homology domain containing, family G (w... [more]
Plekhg55.717e-4931.59pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O94827|PKHG5_HUMAN9.506e-5031.59Pleckstrin homology domain-containing family G mem... [more]
sp|Q6RFZ7|PKHG5_RAT1.864e-4832.17Pleckstrin homology domain-containing family G mem... [more]
sp|Q66T02|PKHG5_MOUSE2.784e-4831.59Pleckstrin homology domain-containing family G mem... [more]
sp|Q8R0J1|PKHG6_MOUSE1.306e-4729.00Pleckstrin homology domain-containing family G mem... [more]
sp|Q3KR16|PKHG6_HUMAN5.457e-4529.88Pleckstrin homology domain-containing family G mem... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A498ME761.559e-4931.48Pleckstrin homology domain-containing family G mem... [more]
A0A498P3K81.691e-4931.48Pleckstrin homology domain-containing family G mem... [more]
A0A2R8QB153.171e-4931.26Pleckstrin homology domain-containing, family G (w... [more]
A0A5A9NCJ23.389e-4931.75Pleckstrin-like proteiny domain-containing family ... [more]
F1R1Q23.532e-4931.26Pleckstrin homology domain-containing, family G (w... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg61.815e-3126.96pleckstrin homology domain containing, family G (w... [more]
plekhg5a6.693e-2931.06pleckstrin homology domain containing, family G (w... [more]
plekhg5b4.258e-1827.14pleckstrin homology domain containing, family G (w... [more]
plekhg5b8.007e-1327.59pleckstrin homology domain containing, family G (w... [more]
plekhg74.465e-1025.95pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000000058.11.887e-724.63pep scaffold:Pmarinus_7.0:GL483830:992:10453:1 gen... [more]
ENSPMAT00000002100.11.363e-623.39pep scaffold:Pmarinus_7.0:GL476406:348473:416758:-... [more]
ARHGEF113.014e-621.51Rho guanine nucleotide exchange factor 11 [Source:... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO396084.259e-4033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO496948.010e-1425.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plekhg5b3.935e-5030.14pleckstrin homology and RhoGEF domain containing G... [more]
plekhg5b4.910e-5030.14pleckstrin homology and RhoGEF domain containing G... [more]
plekhg5b6.038e-5029.86pleckstrin homology and RhoGEF domain containing G... [more]
plekhg62.636e-2524.28pleckstrin homology and RhoGEF domain containing G... [more]
plekhg71.670e-1126.80pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of Pleckstrin homology and RhoGEF domain containing G5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023540.10.000e+082.83SMESG000023540.1[more]
SMESG000023540.10.000e+082.36SMESG000023540.1[more]
SMESG000023540.10.000e+099.23SMESG000023540.1[more]
SMESG000023540.10.000e+099.23SMESG000023540.1[more]
SMESG000023541.12.692e-12399.48SMESG000023541.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025872 ID=SMED30025872|Name=Pleckstrin homology and RhoGEF domain containing G5|organism=Schmidtea mediterranea sexual|type=transcript|length=2506bp
TTCATATTAAATTGATTGCTATTAAAAATATCCGTGGAAAAAAATATTTC
AATAAATAAATTTCAATGAATCAAAGTCGTCGTAAGTCATCAACAGATTT
GCTTACAATGCCTAAAATTATGCTGTCACGTCGATCACAGTCTCCGTCGA
AAATGCTCCATATTACAGAATTGTGGACTTCTTTATCAAAAAGTGAACTA
GATTATACTTCTATTGAAGATGACAATGAGGTCGATCAGACTGATTCTAG
CGTATATCACGTAAGCTCGGTGGCCAGAAATAATCTCCCCTCAACTAATT
TAATGGATTATGAAAATCGGCTAATTATCCAATCAAATTTTAGTTCAAGT
TTGTGTAACGCGTCTAATAAAAACCTTACACCGAATATACCGCATAGAAA
TAGACAACGACGTAGTTCATTTAGCCTTCTTTTTCCGATAAAAGGTTATT
CCGAATTGGATACAAAAGACATAAGAGAGGAACTTATTAGAGACATGTGT
CTAAAGTTAAAGGATTTCACAAAATCTGCTTTACCTAATTTATCCAGTAA
TAATATGTCAGAAAACGCTTTCCCACCTTCATTACCAGAAAATAACTTAC
AACAGGTTTACGGAAATAAGGAGATTTATCAACAGCAGTCAGCGATCTGG
GAGCTAATGGTGACGGAACAGAATTTTCTGAAGCAAATTCATTTTATTGT
TCAGATATATGTTGTTGGCTTTGAGATTTTACGTCCGAAATATTTTCCCA
AAGTAATGTCGGAAGAAATTTTCAGTAATCTCAAAGATGTAAAAACAGTT
TCGTTTGAATTTTGGAAATATTGCATTCGGCCTGTCATTGAAAATTACGA
AATGACAAGACAAATGTTTAAACCGAGACTTTTGAAAGATGGATTTATAA
AAATTGGAGAAATTCTGGAGCCATATATTTTATACTGTACAGAAATATCC
AAATGCAGGTCCTCTATATCATCTCTGGAAAAATCAAATGAACTTTTCGC
TGAATACATAAAGTGGGCAATGAATTTCGAGGAGTCAAACCGAGAACCAC
TTACTGATCATTTGGCAAAGCCATTTCTTCGACTCACAAAATATAAAATA
CTCCTACAAGCAATTCAGAAATATTCAGGAATTGATGAAAAGAATGAAAT
TCAAGAAATGATTGATGCGGTGGATACTTTTGTCAGTCAAGTCAATGAAA
AAATAGAAGAAACAAATTTAATGAAAAAACTTCAAAATTTGAATTCATTT
ATTGACACTTATGATGTGATTGAGCCACTGGGGGATGATTTAATCCCTAT
TATCAATCAGTACAGTAAATTAGACTTGACAGCTCCAATTCAATATGGAA
GAGAAAAGGTTATACGTGAAATATTATTACAAGGGTCGGTGAAATTACGA
GAAGGAACTTCGAAGACAGTTGATGTCAAATTATTTCTACTAACTGATAT
TTTATTGATAACGAAATTCAAGAAAAAGCACATTGGAAAGTATAAGGTGA
TAAAGCCTCCTATATTTCTAGATTCCATCAAAATACATAAATCCAATACT
AATTCATTTATTTGTGTTTGTTTGAATGATTTCAACTGCATTACGGCTCT
ATATCATTTTAGCAATGGAGATCAGAAGAAAATAGACTTATGGACCGAGA
CCTTGCAAGCAGCAGCTCAAAAATATTCCAAACAGAAATCAAAGTTTCTC
AATTCATTATTTTGTAAAGAATTCCATGAATCAATTCCAATGTTAAGAGT
AGACAAATCATCTCCAAAGTTCTCTAGAATAAGACCTAAATCTCAATCCA
ATTCCGAGAGTATTGACAGTGATTTACAGAATGAATTCAGCTTTCGGCGA
AAAGCCCCAGTAACAAAAAAACACAAAAATAGAAGAGAATTTAGTGATTC
TAAATCCAAAACATATTCAGGTGTCCCTCAAAGAAAAAACAGTAACCCAA
TTTCGAAACCGACTAATTTTTTTACAGATAAAAATAAACTGTATAAATCC
AATTCTTTTGCTGATGATATGGAAAAATCAAAGACCAGAAAAAACCTAAG
TGATTGTTCAGATATTGATGAGCCATTTGAAAGTTCTCAAAAAGAATCTC
AACATTTAAGTACTTCCAAAAGGTCTTCAGTAACTGAGAAATCTGAGAAA
ATTGGGAATCTTCAAAGTGTAAATCCGAGTTTCTCAGATTTAAAAGTGAA
AGACTGCAGAAAAACAAACAATAAAACAAACAACATAATTGAATCAAATT
TTTCATCCAAATCTGTAAATAAATTAGAAAAGAAATTAAGTATATCCTTG
AGCACTCTGAACACTTGAAACGAATATGCGATAAACTGTCTTTTTATAAA
ACTTTTATGCAAGTCAGTAAAGTAATCCGAAAATAAAACCGCCCGATCCT
CTCGGAGATTTTACTTGTCCGTGTTAATTAAATAAGAACTTATCAAGTCT
CATTGAATTTTGAAATATTTTAAATGTTTAGTAAATATTTTATCGGAATT
GTTTTT
back to top

protein sequence of SMED30025872-orf-1

>SMED30025872-orf-1 ID=SMED30025872-orf-1|Name=SMED30025872-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=751bp
MNQSRRKSSTDLLTMPKIMLSRRSQSPSKMLHITELWTSLSKSELDYTSI
EDDNEVDQTDSSVYHVSSVARNNLPSTNLMDYENRLIIQSNFSSSLCNAS
NKNLTPNIPHRNRQRRSSFSLLFPIKGYSELDTKDIREELIRDMCLKLKD
FTKSALPNLSSNNMSENAFPPSLPENNLQQVYGNKEIYQQQSAIWELMVT
EQNFLKQIHFIVQIYVVGFEILRPKYFPKVMSEEIFSNLKDVKTVSFEFW
KYCIRPVIENYEMTRQMFKPRLLKDGFIKIGEILEPYILYCTEISKCRSS
ISSLEKSNELFAEYIKWAMNFEESNREPLTDHLAKPFLRLTKYKILLQAI
QKYSGIDEKNEIQEMIDAVDTFVSQVNEKIEETNLMKKLQNLNSFIDTYD
VIEPLGDDLIPIINQYSKLDLTAPIQYGREKVIREILLQGSVKLREGTSK
TVDVKLFLLTDILLITKFKKKHIGKYKVIKPPIFLDSIKIHKSNTNSFIC
VCLNDFNCITALYHFSNGDQKKIDLWTETLQAAAQKYSKQKSKFLNSLFC
KEFHESIPMLRVDKSSPKFSRIRPKSQSNSESIDSDLQNEFSFRRKAPVT
KKHKNRREFSDSKSKTYSGVPQRKNSNPISKPTNFFTDKNKLYKSNSFAD
DMEKSKTRKNLSDCSDIDEPFESSQKESQHLSTSKRSSVTEKSEKIGNLQ
SVNPSFSDLKVKDCRKTNNKTNNIIESNFSSKSVNKLEKKLSISLSTLNT
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000219DH-domain
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0007165signal transduction
GO:0035767endothelial cell chemotaxis
GO:0043065positive regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043542endothelial cell migration
GO:0043547positive regulation of GTPase activity
GO:0051056regulation of small GTPase mediated signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0004871signal transducer activity
GO:0005085guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
GO:0005886plasma membrane
GO:0005911cell-cell junction
GO:0016020membrane
GO:0030027lamellipodium
GO:0030054cell junction
GO:0030139endocytic vesicle
GO:0042995cell projection
GO:0048471perinuclear region of cytoplasm