Corticotropin releasing hormone receptor 2

Overview
NameCorticotropin releasing hormone receptor 2
Smed IDSMED30025870
Length (bp)1529
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Corticotropin releasing hormone receptor 2 (SMED30025870) t-SNE clustered cells

Violin plots show distribution of expression levels for Corticotropin releasing hormone receptor 2 (SMED30025870) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Corticotropin releasing hormone receptor 2 (SMED30025870) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Corticotropin releasing hormone receptor 2 (SMED30025870) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025870

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30025870SMESG000064393.1 SMESG000064388.1 dd_Smed_v4_12337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025870SMESG000064393.1 SMESG000064388.1 dd_Smed_v4_12337_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 188.348 bits (477), Expect = 8.419e-54
Identity = 134/377 (35.54%), Postives = 205/377 (54.38%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  +  G++ + PCP  F G  YN   N  + CL N +WA R NY  C ++         H  V   +  +G+ +SL++L  AFV+F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV +   +++      + NFFWMF EG YL   IV TY  ++++ W F  IGW VP  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQ---SNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRK---RWHRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:HGNC Symbol;Acc:HGNC:2357])

HSP 1 Score: 188.348 bits (477), Expect = 8.419e-54
Identity = 134/377 (35.54%), Postives = 205/377 (54.38%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  +  G++ + PCP  F G  YN   N  + CL N +WA R NY  C ++         H  V   +  +G+ +SL++L  AFV+F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV +   +++      + NFFWMF EG YL   IV TY  ++++ W F  IGW VP  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQ---SNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRK---RWHRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Human
Match: CRHR1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:1394])

HSP 1 Score: 188.348 bits (477), Expect = 8.419e-54
Identity = 134/377 (35.54%), Postives = 205/377 (54.38%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  +  G++ + PCP  F G  YN   N  + CL N +WA R NY  C ++         H  V   +  +G+ +SL++L  AFV+F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV +   +++      + NFFWMF EG YL   IV TY  ++++ W F  IGW VP  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTMSPEVHQ---SNVGWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFICIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRK---RWHRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Human
Match: CRHR2 (corticotropin releasing hormone receptor 2 [Source:HGNC Symbol;Acc:HGNC:2358])

HSP 1 Score: 185.267 bits (469), Expect = 6.599e-53
Identity = 127/351 (36.18%), Postives = 192/351 (54.70%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC--------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRN 1141
            S+C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA + NY  C         K   H  +   +  +G+ +S+ +L +AF++F   +S+RCLRN+IH NLI +FI+R ++W  +        +    SN ++   I++      + NFFWMFVEG YL   IV TY  E+++   F  IGW +P  +  AW I  +  EN + W G      +  I   PIIL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ ++F   N+ L S QGF+VS+ YCFFNGEVR  +R 
Sbjct:   24 SYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVD----HEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVRK 358          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Human
Match: CRHR2 (corticotropin releasing hormone receptor 2 [Source:HGNC Symbol;Acc:HGNC:2358])

HSP 1 Score: 184.882 bits (468), Expect = 1.379e-52
Identity = 127/350 (36.29%), Postives = 192/350 (54.86%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC--------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            S+C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA + NY  C         K   H  +   +  +G+ +S+ +L +AF++F   +S+RCLRN+IH NLI +FI+R ++W  +        +    SN ++   I++      + NFFWMFVEG YL   IV TY  E+++   F  IGW +P  +  AW I  +  EN + W G      +  I   PIIL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ ++F   N+ L S QGF+VS+ YCFFNGEVR  +R
Sbjct:   38 SYCNTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYRIALVVNYLGHCVSVAALVAAFLLFLALRSIRCLRNVIHWNLITTFILRNVMWFLLQLVD----HEVHESNEVWCRCITTIFNYFVVTNFFWMFVEGCYLHTAIVMTYSTERLRKCLFLFIGWCIPFPIIVAWAIGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIMFIYFNSFLQSFQGFFVSVFYCFFNGEVRSAVR 371          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 107.457 bits (267), Expect = 1.146e-24
Identity = 110/396 (27.78%), Postives = 181/396 (45.71%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-----------ANYESCYKLSQHNSVLFW--------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSF----IIRVILWISIYASSFSKPY------------PQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTE---NIEDWVG--YRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHII-FICSPPESKLTVVFNI---TNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKC--ARF------QNNIR 1180
            C A YD VLCW PT         CP+   G + N Y    K C     WA +            N+  C+K+   ++ +          L  +G GLSL+SL  A  IFSYF+ LR  RN++H +L+++     I+R++L+I +  +  + P+            P +   + F L     +  F WMF+EG+YL   IV+ +   + K+  + I G+ +P + T  W++V++ +    +E  +G  Y      I+  P +  LV+N   +  ++  L  K++ + N  +               KK++K+ ++L+PLLG  +I+  I   P     +VF +   T +     QG  V+ IYCF N EV     NH+ K   AR+      QN +R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKY--IVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVT-FCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAG------------LKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEV-----NHVLKTFYARYRLLHKSQNELR 448          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 107.457 bits (267), Expect = 1.146e-24
Identity = 110/396 (27.78%), Postives = 181/396 (45.71%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-----------ANYESCYKLSQHNSVLFW--------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSF----IIRVILWISIYASSFSKPY------------PQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTE---NIEDWVG--YRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHII-FICSPPESKLTVVFNI---TNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKC--ARF------QNNIR 1180
            C A YD VLCW PT         CP+   G + N Y    K C     WA +            N+  C+K+   ++ +          L  +G GLSL+SL  A  IFSYF+ LR  RN++H +L+++     I+R++L+I +  +  + P+            P +   + F L     +  F WMF+EG+YL   IV+ +   + K+  + I G+ +P + T  W++V++ +    +E  +G  Y      I+  P +  LV+N   +  ++  L  K++ + N  +               KK++K+ ++L+PLLG  +I+  I   P     +VF +   T +     QG  V+ IYCF N EV     NH+ K   AR+      QN +R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKY--IVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVT-FCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAG------------LKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEV-----NHVLKTFYARYRLLHKSQNELR 448          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 107.457 bits (267), Expect = 1.190e-24
Identity = 110/396 (27.78%), Postives = 181/396 (45.71%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-----------ANYESCYKLSQHNSVLFW--------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSF----IIRVILWISIYASSFSKPY------------PQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTE---NIEDWVG--YRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHII-FICSPPESKLTVVFNI---TNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKC--ARF------QNNIR 1180
            C A YD VLCW PT         CP+   G + N Y    K C     WA +            N+  C+K+   ++ +          L  +G GLSL+SL  A  IFSYF+ LR  RN++H +L+++     I+R++L+I +  +  + P+            P +   + F L     +  F WMF+EG+YL   IV+ +   + K+  + I G+ +P + T  W++V++ +    +E  +G  Y      I+  P +  LV+N   +  ++  L  K++ + N  +               KK++K+ ++L+PLLG  +I+  I   P     +VF +   T +     QG  V+ IYCF N EV     NH+ K   AR+      QN +R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKY--IVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVT-FCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAG------------LKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEV-----NHVLKTFYARYRLLHKSQNELR 448          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 107.457 bits (267), Expect = 1.190e-24
Identity = 110/396 (27.78%), Postives = 181/396 (45.71%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-----------ANYESCYKLSQHNSVLFW--------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSF----IIRVILWISIYASSFSKPY------------PQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTE---NIEDWVG--YRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHII-FICSPPESKLTVVFNI---TNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKC--ARF------QNNIR 1180
            C A YD VLCW PT         CP+   G + N Y    K C     WA +            N+  C+K+   ++ +          L  +G GLSL+SL  A  IFSYF+ LR  RN++H +L+++     I+R++L+I +  +  + P+            P +   + F L     +  F WMF+EG+YL   IV+ +   + K+  + I G+ +P + T  W++V++ +    +E  +G  Y      I+  P +  LV+N   +  ++  L  K++ + N  +               KK++K+ ++L+PLLG  +I+  I   P     +VF +   T +     QG  V+ IYCF N EV     NH+ K   AR+      QN +R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKY--IVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVT-FCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAG------------LKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEV-----NHVLKTFYARYRLLHKSQNELR 448          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Celegans
Match: pdfr-1 (Calcitonin receptor-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q09460])

HSP 1 Score: 107.457 bits (267), Expect = 1.190e-24
Identity = 110/396 (27.78%), Postives = 181/396 (45.71%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-----------ANYESCYKLSQHNSVLFW--------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSF----IIRVILWISIYASSFSKPY------------PQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTE---NIEDWVG--YRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHII-FICSPPESKLTVVFNI---TNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKC--ARF------QNNIR 1180
            C A YD VLCW PT         CP+   G + N Y    K C     WA +            N+  C+K+   ++ +          L  +G GLSL+SL  A  IFSYF+ LR  RN++H +L+++     I+R++L+I +  +  + P+            P +   + F L     +  F WMF+EG+YL   IV+ +   + K+  + I G+ +P + T  W++V++ +    +E  +G  Y      I+  P +  LV+N   +  ++  L  K++ + N  +               KK++K+ ++L+PLLG  +I+  I   P     +VF +   T +     QG  V+ IYCF N EV     NH+ K   AR+      QN +R
Sbjct:   74 CNATYDTVLCWPPTPANSSVTLQCPH-MKGLDPNKY--IVKRCDETGRWAGKKPGHYENPWGWTNFTVCFKIDYEDAKIAQEVARNARKLEFVGLGLSLVSLILAISIFSYFRRLRVFRNLLHLHLMIAMLMVVILRLVLYIDLIFTGENGPHTNSAEGKTINTMPIVCEGMFFFLEYFKTVT-FCWMFLEGIYLNNQIVFGFFNSEPKLLPYFIAGYGIPLVHTMLWLLVVLIKKDFKVERCLGSYYLEPEFWILDGPRMAELVINLFFICNVIRVLYSKVRESNNTSEAG------------LKKSVKAAMMLLPLLGVPNIMQTIPFAPTRDNIMVFAVWTYTASFTYMYQGLMVASIYCFTNKEV-----NHVLKTFYARYRLLHKSQNELR 448          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0087936)

HSP 1 Score: 189.889 bits (481), Expect = 4.298e-54
Identity = 133/381 (34.91%), Postives = 192/381 (50.39%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVL----------FWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWI-SIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMV----TENIEDWVGY--------RGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQS 1222
            CP+ +D VLCW  T  G +A+ PC  EF G +Y+  +NA ++C PN TW   ++Y+ C++ S    V+            +Y  GY LS  +L  A +IF  FK LRCLRN IH NL L++I   +LWI +++    +    Q     L  +     L NFFWMFVEGLYL  ++V T+  + +    + +IGW  PA+    W I        EN E + G            +  I  +P  L L+VN + L+ I+  LI KL++    +            T +Y KA K+ +VL+PL G ++++ +  P +     +F    A L S+QGF+V+L YCF N EVR TLR H F   R   NI    +I N   HR S
Sbjct:   84 CPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLEN-EHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLE------------TRQYYKASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLR-HGFTRWRESRNIHRNSSIKN-RRHRAS 449          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Fly
Match: Dh44-R2 (gene:FBgn0033744 transcript:FBtr0113075)

HSP 1 Score: 188.734 bits (478), Expect = 1.272e-53
Identity = 130/374 (34.76%), Postives = 189/374 (50.53%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVL----------FWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWI-SIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMV----TENIEDWVGY--------RGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICN 1201
            CP+ +D VLCW  T  G +A+ PC  EF G +Y+  +NA ++C PN TW   ++Y+ C++ S    V+            +Y  GY LS  +L  A +IF  FK LRCLRN IH NL L++I   +LWI +++    +    Q     L  +     L NFFWMFVEGLYL  ++V T+  + +    + +IGW  PA+    W I        EN E + G            +  I  +P  L L+VN + L+ I+  LI KL++    +            T +Y KA K+ +VL+PL G ++++ +  P +     +F    A L S+QGF+V+L YCF N EVR TLR H F   R   NI    +I N
Sbjct:   84 CPSSFDSVLCWPRTNAGSLAVLPCFEEFKGVHYDTTDNATRFCFPNGTWDHYSDYDRCHQNSGSIPVVPDFSPNVELPAIIYAGGYFLSFATLVVALIIFLSFKDLRCLRNTIHANLFLTYITSALLWILTLFLQVITTESSQAGCITLVIMFQYFYLTNFFWMFVEGLYLYTLVVQTFSSDNISFIIYALIGWGCPAVCILVWSIAKAFAPHLEN-EHFNGLEIDCAWMRESHIDWIFKVPASLALLVNLVFLIRIMWVLITKLRSAHTLE------------TRQYYKASKALLVLIPLFGITYLLVLTGPEQGISRNLFEAIRAFLISTQGFFVALFYCFLNSEVRQTLR-HGFTRWRESRNIHRNSSIKN 443          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Fly
Match: Dh44-R1 (gene:FBgn0033932 transcript:FBtr0087485)

HSP 1 Score: 185.267 bits (469), Expect = 3.953e-52
Identity = 124/361 (34.35%), Postives = 186/361 (51.52%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVLFW---------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVM------------------VTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTV-VFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHL 1147
            C   +D +LCW  T RG +A+  C +E  G +Y++ +NA ++C  N TW +  NY++C  L    SV  +         +Y IGY LSL+SL  A ++F+YFK LRCLRN IH NL  ++I+  + WI + +   S          L  L     L NFFWM VEGLYL +++V T+  + ++   +  IGW  PAL    W +                    + E   DW+ Y+G +          +L++N   LL I+  LI KL++    +            T +Y+KA K+ +VL+PL G ++++ +  P ES L   +F +  A+L S+QGF VSL YCF N EVR  LR+H+
Sbjct:   53 CLTQFDSILCWPRTARGTLAVLQCMDELQGIHYDSSKNATRFCHANGTWEKYTNYDACAHLPAPESVPEFEVIVELPTIIYYIGYTLSLVSLSLALIVFAYFKELRCLRNTIHANLFFTYIMSALFWILLLSVQISIRSGVGSCIALITLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNLRFNIYASIGWGGPALFVVTWAVAKSLTVTYSTPEKYEINCPWMQETHVDWI-YQGPV--------CAVLIINLTFLLRIMWVLITKLRSANTVE------------TRQYRKAAKALLVLIPLFGITYLVVLAGPSESGLMGHMFAVLRAVLLSTQGFSVSLFYCFLNSEVRNALRHHI 392          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Fly
Match: Pdfr (gene:FBgn0260753 transcript:FBtr0070436)

HSP 1 Score: 122.094 bits (305), Expect = 3.566e-29
Identity = 110/386 (28.50%), Postives = 177/386 (45.85%), Query Frame = 2
Query:  134 QNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRAN-----------YESCYK------LSQHNSVLFWLYI-----------IGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSN--------------VLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAW----VIVMVTENIEDWVGYR-GKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHL 1147
            Q   +C   +D +LCW PT  G +A   CP  F G +   +  A + C  +  W  R N           Y  CYK      + Q  S  F  YI           +G  LSL +L  + +IF  F+SLR  R  IH NL ++ +++VI+ +++Y   F +   +  +N                + L   ++ A F WMF+EGLYL  ++          +  F+ +GW VP L+TT W    V+ M T   E    Y       I+  P + ++++N   L+ I+  L+ KL+ ++       R            KA+++ +VL+PLLG ++++   +P ++     V++     L+S QGF+++LIYCF NGEVR  L   L
Sbjct:  142 QTGLYCNWTWDTLLCWPPTPAGVLARMNCPGGFHGVDTRKF--AIRKCELDGRWGSRPNATEVNPPGWTDYGPCYKPEIIRLMQQMGSKDFDAYIDIARRTRTLEIVGLCLSLFALIVSLLIFCTFRSLRNNRTKIHKNLFVAMVLQVIIRLTLYLDQFRRGNKEAATNTSLSVIENTPYLCEASYVLLEYARTAMFMWMFIEGLYLHNMVTVAVFQGSFPLKFFSRLGWCVPILMTTVWARCTVMYMDTSLGECLWNYNLTPYYWILEGPRLAVILLNFCFLVNIIRVLVMKLRQSQASDIEQTR------------KAVRAAIVLLPLLGITNLLHQLAPLKTATNFAVWSYGTHFLTSFQGFFIALIYCFLNGEVRAVLLKSL 513          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Fly
Match: hec (gene:FBgn0030437 transcript:FBtr0343652)

HSP 1 Score: 100.138 bits (248), Expect = 3.194e-22
Identity = 103/368 (27.99%), Postives = 171/368 (46.47%), Query Frame = 2
Query:  128 KNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-------ANYESC--YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVM-----------VTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPE-SKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFK 1153
            + +N  FCP  +D  LCW  T  G +  + CP+   GFN      A K CL N +W +        +NY +C  Y+  +    +  LY+ GY LSL++L  + +IF  FKSLRC R  IH +L  S     + WI  Y     +    +  N L+ + +        L N+FWMF EGL+L +V+V  +  + + +  F +I W  P  +   + +             +T+++  W+           +PI L L+ + I L+ ++  ++ KL     Q           P     +KA+++T++L+PL G  H +    P   ++L   + + + +L S QGF VS ++CF N +V   +R  L K
Sbjct:  113 QKENRLFCPLNFDGYLCWPRTPAGTVLSQYCPDFVEGFNRKFL--AHKTCLENGSWYRHPVSNQTWSNYTNCVDYEDLEFRQFINELYVKGYALSLLALLISIIIFLGFKSLRCTRIRIHVHLFASLACTCVAWILWYRLVVERS-ETIAENPLWCIGLHLVVHYFMLVNYFWMFCEGLHLHLVLVVVFVKDTIVMRWFIVISWFSPIPIAIVYGLARHFSSPDNKHCWITDSLYLWI---------FSVPITLSLLASFIFLINVLRVIVRKLHPQSAQ-----------PAPLAIRKAVRATIILVPLFGLQHFLLPYRPDAGTQLDHFYQMLSVVLVSLQGFVVSFLFCFANHDVTFAIRTLLNK 457          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Zebrafish
Match: crhr1 (corticotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-081231-1])

HSP 1 Score: 188.734 bits (478), Expect = 5.671e-54
Identity = 134/380 (35.26%), Postives = 206/380 (54.21%), Query Frame = 2
Query:  146 FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCY---------KLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            FC    D +  CW  +  G +   PCP  F G  YN   N  + CL N TWA++ NY  C          KL  H +V+  +  +G+ +SL +L  AF++F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV++   +++      + NFFWMF EG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ +VF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   58 FCNTSIDGIGTCWPRSSAGEVVSRPCPESFLGVRYNTTNNVYRECLANGTWAKKGNYSQCQEILNEEKKSKLHYHIAVI--INYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFILRNATWFVVQLTMNPEVHE---SNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKRAGIYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRK---RWHRWQD----KHSIRARVARAMSIP 413          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Zebrafish
Match: CRHR2 (corticotropin-releasing factor receptor 2 [Source:NCBI gene;Acc:100335005])

HSP 1 Score: 162.925 bits (411), Expect = 2.095e-45
Identity = 119/328 (36.28%), Postives = 187/328 (57.01%), Query Frame = 2
Query:  263 AEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWI-------SIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNN--IRTR 1186
            A + CL N TWA ++NY +C        K   H  +   +   G+ +S+ +L  AF++F   +S+RCLRNIIH NLI +FI+R ++W        +IY ++  +P+ ++++ +     ++    NFFWMFVEG YL   IV TY  +K++ W F  IGW +P  +   W I  +  EN + W G   GK +  I   P+IL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGEVR   R    +  R+Q+N  +R R
Sbjct:    3 AYRECLENGTWALKSNYSNCEPILEEKRKYPMHYKIALIINYFGHCVSVGALIIAFILFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLVDQNIYETN--EPWCRLITTIYNYFVVT----NFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIIVWAIAKLYNENEQCWFGKEPGKYVDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAARK---RWHRWQDNHALRVR 309          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 157.918 bits (398), Expect = 5.558e-42
Identity = 122/374 (32.62%), Postives = 185/374 (49.47%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-------ANYESCYKLSQHN---------SVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW----ISIYASSFSKPYPQMVSNVLFALN----------ISSQLA----------NFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNIT---NAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            C   +D +LCW     G++    CP     FN+  +  A + C  N TW          ANY  C K   H            L+ +Y +GY +SL SL  A VI  YF+ L C RN IH +L LSF++R I      + +Y+ S  +   ++    L ++           I  ++A          N++W+ VEGLYL  +I  T+  ++  +W FT+IGW VPA+  T W  V  T  + E W    G +K IV +PI+  +VVN +  L I+  L  KL+ T   + ++R+         +Y+K LKST+VLMPL G  +I+F+  P      V++ I      + +S QGF+V++IYCF NGEV+  ++
Sbjct:   38 CLPEWDGILCWPEGVPGKMVSTSCPEYIYDFNHKGH--AYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLADTECWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQ---------QYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIK 400          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Zebrafish
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 157.532 bits (397), Expect = 9.871e-42
Identity = 122/374 (32.62%), Postives = 185/374 (49.47%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-------ANYESCYKLSQHN---------SVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW----ISIYASSFSKPYPQMVSNVLFALN----------ISSQLA----------NFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNIT---NAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            C   +D +LCW     G++    CP     FN+  +  A + C  N TW          ANY  C K   H            L+ +Y +GY +SL SL  A VI  YF+ L C RN IH +L LSF++R I      + +Y+ S  +   ++    L ++           I  ++A          N++W+ VEGLYL  +I  T+  ++  +W FT+IGW VPA+  T W  V  T  + E W    G +K IV +PI+  +VVN +  L I+  L  KL+ T   + ++R+         +Y+K LKST+VLMPL G  +I+F+  P      V++ I      + +S QGF+V++IYCF NGEV+  ++
Sbjct:   63 CLPEWDGILCWPEGVPGKMVSTSCPEYIYDFNHKGH--AYRRCDLNGTWELASHNNKTWANYSECAKFFPHYNQNQEREVFDRLYLIYTVGYSISLGSLMVATVILGYFRRLHCTRNYIHMHLFLSFMLRAISIFVKDVVLYSGSALQEMERITVEDLKSITEAPPANKTQFIGCKVAVTLFLYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAMFVTIWASVRATLADTECWDLSAGNLKWIVQIPILTAIVVNFLLFLNIIRVLATKLRETNAGRCDTRQ---------QYRKLLKSTLVLMPLFGVHYIVFMAMPYTEVSGVLWQIQMHYEMLFNSVQGFFVAIIYCFCNGEVQAEIK 425          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Zebrafish
Match: pth3r (parathyroid hormone 3 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-12])

HSP 1 Score: 143.665 bits (361), Expect = 9.005e-37
Identity = 117/381 (30.71%), Postives = 182/381 (47.77%), Query Frame = 2
Query:   89 KCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-------ANYESC--YKLSQHNSV------LFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVI-LWIS---IYA--------SSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNIT---NAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            +C +T    +   +  N   C   +D ++CW   +  ++    CP     FN+  Y  A ++C  +  W Q        ANY  C  Y  + H+        L+ +Y IGY +SL +L  A  I  YFK L C RN IH +L  SFI R I +++    +YA            +  P +       L +     N +W+ VEGLYL  +I   +  +K  +W  TIIGW +PA+  + WV   V+  + + W    G +K I  +PI+  +VVN    L I+  L  KL  T   + + R+         +Y+K LKST+VLMPL G  +++F+  P      +++ I      + +SSQGF+V+ IYCF NGEV+  ++
Sbjct:   44 RCERTIRAQSDVVRENN---CAPEWDGIICWPTGKPNQMVAVLCPEYIYDFNHRGY--AYRHCDASGNWEQVSIINRTWANYTECTTYLHTNHSDQEEVFERLYLMYTIGYSISLAALLVAVSILCYFKRLHCTRNYIHIHLFTSFICRAISIFVKDAVLYAVTNDGELEDGAVEQRPMVGCKAAVTLFLYLLATNHYWILVEGLYLHSLIFMAFLSDKNCLWALTIIGWGIPAVFVSIWVSARVSLADTQCWDISAGNLKWIYQVPILAAIVVNFFLFLNIIRVLASKLWETNTGKLDPRQ---------QYRKLLKSTMVLMPLFGVHYMLFMALPYTDVTGLLWQIQMHYEMLFNSSQGFFVAFIYCFCNGEVQAEVK 410          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 186.808 bits (473), Expect = 1.290e-53
Identity = 130/376 (34.57%), Postives = 203/376 (53.99%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQ------HNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQ-----LANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  T  G++   PCP  F G  YN   N  + C  N +WA R +Y  C ++ +      H  +   +  +G+ +SL +L  AF++F   +S+RCLRNIIH NLI +FI+R + W   +    +  +    SNV++   ++       + NFFWMF EG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  +N + W G +  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   17 CNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSWAGRGDYTQCQEILKQEKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTW---FVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRK---RWHRWQD----KHSIRARVARAMSIP 370          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 187.193 bits (474), Expect = 2.537e-53
Identity = 134/409 (32.76%), Postives = 214/409 (52.32%), Query Frame = 2
Query:   50 VMMNYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQ------HNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQ-----LANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            ++M        F+  +   +  T  F    ++ C A  D +  CW  T  G++   PCP  F G  YN   N  + C  N +WA R +Y  C ++ +      H  +   +  +G+ +SL +L  AF++F   +S+RCLRNIIH NLI +FI+R + W   +    +  +    SNV++   ++       + NFFWMF EG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  +N + W G +  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   24 ILMLQVRIHESFLTLKTDKYVGTVSFSPTGLA-CNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSWAGRGDYTQCQEILKQEKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTW---FVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRK---RWHRWQD----KHSIRARVARAMSIP 409          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Xenopus
Match: yif1b (Yip1 interacting factor homolog B, membrane trafficking protein [Source:Xenbase;Acc:XB-GENE-922881])

HSP 1 Score: 186.808 bits (473), Expect = 2.979e-53
Identity = 130/377 (34.48%), Postives = 203/377 (53.85%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQ-------HNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQ-----LANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  T  G++   PCP  F G  YN   N  + C  N +WA R +Y  C ++ +       H  +   +  +G+ +SL +L  AF++F   +S+RCLRNIIH NLI +FI+R + W   +    +  +    SNV++   ++       + NFFWMF EG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  +N + W G +  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASIDMIGTCWPRTAAGQMVARPCPEYFQGVQYNTTGNVYRECHLNGSWAGRGDYTQCQEILKQEKKTKVHYHIAIVINFLGHSISLCALLVAFILFLRLRSIRCLRNIIHWNLITAFILRNVTW---FVMQLTLSHEAHDSNVVWCRLVTIAHNYFYVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKKAGVYTDFIYQGPVILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVTPGEDEISRVVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRK---RWHRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 186.422 bits (472), Expect = 3.122e-53
Identity = 129/363 (35.54%), Postives = 199/363 (54.82%), Query Frame = 2
Query:  122 FFKNQNISF-CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCY-------KLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMV------SNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            FF+++      PA  D +  CW  +  G +   PCP+ F+G  YN   +  + C  N TWA   NY  C        K + H  +   +  +G+ +S+++L  AF++F   +S+RCLRNIIH NLI +FI+R I+W  +          QM+      SN ++   I++      + NFFWMFVEG YL   IV TY  +K++ W F  IGW +P+ +   W +  +  EN + W+G   GK +  I   P+IL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGEVR   R
Sbjct:   22 FFQDKRTGLEIPATIDQIGTCWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLL----------QMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAAR 362          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Xenopus
Match: slc17a9 (solute carrier family 17 member 9 [Source:Xenbase;Acc:XB-GENE-5753894])

HSP 1 Score: 186.037 bits (471), Expect = 5.141e-53
Identity = 127/354 (35.88%), Postives = 195/354 (55.08%), Query Frame = 2
Query:  146 FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCY-------KLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMV------SNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            +C A  D +  CW  +  G +   PCP+ F+G  YN   +  + C  N TWA   NY  C        K + H  +   +  +G+ +S+++L  AF++F   +S+RCLRNIIH NLI +FI+R I+W  +          QM+      SN ++   I++      + NFFWMFVEG YL   IV TY  +K++ W F  IGW +P+ +   W +  +  EN + W+G   GK +  I   P+IL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGEVR   R
Sbjct:   42 YCSATIDQIGTCWPRSIAGGLVERPCPDSFNGIRYNTTRSVTRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISVLALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLL----------QMIDHRIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAVCKLFYENEQCWIGKEPGKYIDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAAR 373          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 193.741 bits (491), Expect = 4.116e-56
Identity = 133/380 (35.00%), Postives = 204/380 (53.68%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHR-QSVP 1228
            ++C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA R NY  C        K   H  +   +  +G+ +S+++L +AF++F   +S+RCLRN+IH NLI +FI+R I W     I       ++ + + ++ +     ++    NFFWMFVEG YL   IV TY  E ++ W F  IGW +P  +  AW +  +  EN + W G      +  I   P++L+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ +VF   N+ L S QGF+VS+ YCFFNGEVR  LR    +  R+Q+     H    +P  R  S+P
Sbjct:   38 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVT----NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRK---RWHRWQD-----HHALRVPVARAMSIP 393          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 194.126 bits (492), Expect = 4.901e-56
Identity = 133/380 (35.00%), Postives = 204/380 (53.68%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHR-QSVP 1228
            ++C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA R NY  C        K   H  +   +  +G+ +S+++L +AF++F   +S+RCLRN+IH NLI +FI+R I W     I       ++ + + ++ +     ++    NFFWMFVEG YL   IV TY  E ++ W F  IGW +P  +  AW +  +  EN + W G      +  I   P++L+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ +VF   N+ L S QGF+VS+ YCFFNGEVR  LR    +  R+Q+     H    +P  R  S+P
Sbjct:   58 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVT----NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRK---RWHRWQD-----HHALRVPVARAMSIP 413          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 193.741 bits (491), Expect = 5.474e-56
Identity = 133/381 (34.91%), Postives = 204/381 (53.54%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC--------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHR-QSVP 1228
            ++C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA R NY  C         K   H  +   +  +G+ +S+++L +AF++F   +S+RCLRN+IH NLI +FI+R I W     I       ++ + + ++ +     ++    NFFWMFVEG YL   IV TY  E ++ W F  IGW +P  +  AW +  +  EN + W G      +  I   P++L+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ +VF   N+ L S QGF+VS+ YCFFNGEVR  LR    +  R+Q+     H    +P  R  S+P
Sbjct:   38 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVT----NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRK---RWHRWQD-----HHALRVPVARAMSIP 394          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Mouse
Match: Crhr2 (corticotropin releasing hormone receptor 2 [Source:MGI Symbol;Acc:MGI:894312])

HSP 1 Score: 193.741 bits (491), Expect = 7.377e-56
Identity = 133/381 (34.91%), Postives = 204/381 (53.54%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC--------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHR-QSVP 1228
            ++C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA R NY  C         K   H  +   +  +G+ +S+++L +AF++F   +S+RCLRN+IH NLI +FI+R I W     I       ++ + + ++ +     ++    NFFWMFVEG YL   IV TY  E ++ W F  IGW +P  +  AW +  +  EN + W G      +  I   P++L+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ +VF   N+ L S QGF+VS+ YCFFNGEVR  LR    +  R+Q+     H    +P  R  S+P
Sbjct:   58 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVT----NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRK---RWHRWQD-----HHALRVPVARAMSIP 414          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Mouse
Match: Crhr1 (corticotropin releasing hormone receptor 1 [Source:MGI Symbol;Acc:MGI:88498])

HSP 1 Score: 188.734 bits (478), Expect = 4.100e-54
Identity = 133/377 (35.28%), Postives = 205/377 (54.38%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  +  G++ + PCP  F G  YN   N  + CL N +WA R NY  C ++         H  +   +  +G+ +SL++L  AFV+F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV +   +++      + NFFWMF EG YL   IV TY  ++++ W F  IGW VP  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQ---SNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRK---RWRRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. UniProt/SwissProt
Match: sp|P47866|CRFR2_RAT (Corticotropin-releasing factor receptor 2 OS=Rattus norvegicus OX=10116 GN=Crhr2 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 3.173e-55
Identity = 137/381 (35.96%), Postives = 204/381 (53.54%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC--------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHR-QSVP 1228
            S+C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA R NY  C         K   H  +   +  +G+ +S+++L +AF++F   +S+RCLRN+IH NLI +FI+R I W     I       ++ + + V+ +     ++    NFFWMFVEG YL   IV TY  E ++ W F  IGW +P  +  AW +  +  EN + W G      +  I   PIIL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ +VF   N+ L S QGF+VS+ YCFFNGEVR  LR    +  R+Q+     H    +P  R  S+P
Sbjct:   38 SYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIINYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNITWFLLQLIDHEVHEGNEVWCRCVTTIFNYFVVT----NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIVAWAVGKLYYENEQCWFGKEPGDLVDYIYQGPIILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRSALRK---RWHRWQD-----HHALRVPVARAMSIP 394          
BLAST of Corticotropin releasing hormone receptor 2 vs. UniProt/SwissProt
Match: sp|Q60748|CRFR2_MOUSE (Corticotropin-releasing factor receptor 2 OS=Mus musculus OX=10090 GN=Crhr2 PE=1 SV=2)

HSP 1 Score: 193.741 bits (491), Expect = 3.829e-55
Identity = 133/381 (34.91%), Postives = 204/381 (53.54%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC--------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGK--MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHR-QSVP 1228
            ++C    D +  CW  +  G +   PCP  F+G  YN   NA + CL N TWA R NY  C         K   H  +   +  +G+ +S+++L +AF++F   +S+RCLRN+IH NLI +FI+R I W     I       ++ + + ++ +     ++    NFFWMFVEG YL   IV TY  E ++ W F  IGW +P  +  AW +  +  EN + W G      +  I   P++L+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  L+ +VF   N+ L S QGF+VS+ YCFFNGEVR  LR    +  R+Q+     H    +P  R  S+P
Sbjct:   38 TYCNTTLDQIGTCWPQSAPGALVERPCPEYFNGIKYNTTRNAYRECLENGTWASRVNYSHCEPILDDKQRKYDLHYRIALIVNYLGHCVSVVALVAAFLLFLVLRSIRCLRNVIHWNLITTFILRNIAWFLLQLIDHEVHEGNEVWCRCITTIFNYFVVT----NFFWMFVEGCYLHTAIVMTYSTEHLRKWLFLFIGWCIPCPIIIAWAVGKLYYENEQCWFGKEAGDLVDYIYQGPVMLVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDLSQIVFIYFNSFLQSFQGFFVSVFYCFFNGEVRAALRK---RWHRWQD-----HHALRVPVARAMSIP 394          
BLAST of Corticotropin releasing hormone receptor 2 vs. UniProt/SwissProt
Match: sp|O42603|CRFR2_XENLA (Corticotropin-releasing factor receptor 2 OS=Xenopus laevis OX=8355 GN=crhr2 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 4.611e-54
Identity = 131/368 (35.60%), Postives = 200/368 (54.35%), Query Frame = 2
Query:  104 HFNTTYFFKNQNISFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCY-------KLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMV------SNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            H  ++ FF  +   +C A  D +  CW  +  G +   PCP+ F+G  YN   N  + C  N TWA   NY  C        K + H  +   +  +G+ +S+++L  AF++F   +S+RCLRNIIH NLI +FI+R I+W  +          QM+      SN ++   I++      + NFFWMFVEG YL   IV TY  +K++ W F  IGW +P+ +   W I  +  EN + W+G   GK +  I    +IL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGEVR   R
Sbjct:   29 HSESSSFFGFEG-PYCSATIDQIGTCWPRSLAGELVERPCPDSFNGIRYNTTRNVYRECFENGTWASWMNYSQCVPILDNKRKYALHYKIALIINYLGHCISILALVIAFLLFLCLRSIRCLRNIIHWNLITTFILRNIMWFLL----------QMIDHNIHESNEVWCRCITTIYNYFVVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPSPIIVTWAICKLFYENEQCWIGKEPGKYIDYIYQGRVILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDVSQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAAR 373          
BLAST of Corticotropin releasing hormone receptor 2 vs. UniProt/SwissProt
Match: sp|P35353|CRFR1_RAT (Corticotropin-releasing factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Crhr1 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 2.354e-53
Identity = 134/377 (35.54%), Postives = 205/377 (54.38%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  +  G++ + PCP  F G  YN   N  + CL N +WA R NY  C ++         H  V   +  +G+ +SL++L  AFV+F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV +   +++      + NFFWMF EG YL   IV TY  ++++ W F  IGW VP  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHVAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQ---SNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLHYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRK---RWRRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. UniProt/SwissProt
Match: sp|P35347|CRFR1_MOUSE (Corticotropin-releasing factor receptor 1 OS=Mus musculus OX=10090 GN=Crhr1 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.868e-53
Identity = 133/377 (35.28%), Postives = 205/377 (54.38%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            C A  D +  CW  +  G++ + PCP  F G  YN   N  + CL N +WA R NY  C ++         H  +   +  +G+ +SL++L  AFV+F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV +   +++      + NFFWMF EG YL   IV TY  ++++ W F  IGW VP  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ VVF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   44 CNASVDLIGTCWPRSPAGQLVVRPCPAFFYGVRYNTTNNGYRECLANGSWAARVNYSECQEILNEEKKSKVHYHIAVIINYLGHCISLVALLVAFVLFLRLRSIRCLRNIIHWNLISAFILRNATWFVVQLTVSPEVHQ---SNVAWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDRLRKWMFVCIGWGVPFPIIVAWAIGKLYYDNEKCWFGKRPGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSRVVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAIRK---RWRRWQD----KHSIRARVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. TrEMBL
Match: X2BBW7 (Uncharacterized protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 221.861 bits (564), Expect = 4.704e-63
Identity = 149/433 (34.41%), Postives = 227/433 (52.42%), Query Frame = 2
Query:  122 FFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQ-------HNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISI------YASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYR-GKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTV-VFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQN--NIRTRHTICNIPSHRQSVPL---------FNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENR 1339
             F +    +C + +D V CW  T  G++A+  CP  F     +   NA + C PN TW  R++Y+ C  ++        HN +   +Y +G+  S+++L  A  IF YF+SLRCLRN IHC+LI++FI + ILW+ +                Q V  ++ AL    Q+ANFFWM VEGLYL  +IVW + IE+++ W++ ++GW  PAL+  AW IV    EN   W+         I   PI+ +L+VN I L  IV  LI KL+A+   Q              +Y+KA+++T++L PLLG ++++FI  P +  L    F   NAIL S QG  +++ YCF NGEVR T+R    + +R+Q   +I TR+T  +I ++ + + L          N Q S +      +N+   +   Q+    K S NR
Sbjct:    1 MFTDAGQLYCNSTWDTVSCWPTTPAGQLAVLTCPPRFEEVLLDPNGNATRMCYPNGTWQFRSDYDHCKPITMVNKEEDIHNFITRVIYYVGFTTSIVALIVALCIFLYFRSLRCLRNTIHCHLIVTFIFKYILWLIMNNVLPKLTDDDHNEIHQWVCKIIVALYNYIQVANFFWMLVEGLYLHTMIVWAFSIERIRFWYYAVLGWCGPALVVLAWAIVKAKFENRRCWLPMENSSYDYIYITPILGVLLVNVIFLGSIVWVLITKLRASNTLQ------------ARQYRKAVRATLILFPLLGVTYVVFISPPNDGALAKRAFVYFNAILQSLQGLAIAVFYCFLNGEVRSTIRG---RVSRWQEGRSIATRYTRASIATNAEQISLRASFTRDNTCNGQTSSSLGKTLFKNNN--LDAQQQHSNGKTSPNR 416          
BLAST of Corticotropin releasing hormone receptor 2 vs. TrEMBL
Match: A0A1B6GNH4 (Uncharacterized protein OS=Cuerna arida OX=1464854 GN=g.35062 PE=3 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 4.168e-58
Identity = 135/380 (35.53%), Postives = 197/380 (51.84%), Query Frame = 2
Query:  143 SFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCY----------KLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQ---LANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV---------------------------MVTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHL 1147
             +CP V+DYVLCW PT    IA  PC  E +G  Y+  +NA + C  N TW    ++ +C           KL     +   LYI GY LSL++L +A  IF YFK LRCLRN IH NL+ ++I+   +W     I +Y S+      Q  +  +  LNI      L NFFWMFVEGLYL +++V T+  + +K+  +  IGW  P ++   W+ V                           ++   + DW+ Y+G M        + +L++N I L  I+  LI KL+A  N +            T +Y+KA K+ +VL+PLLG ++I+FI +P E  L  V++   A+L S+QGF V+L+YCF N EV+ T R+HL
Sbjct:   38 GYCPRVWDYVLCWPPTPVATIAHIPCFPELNGIKYDTTKNATRLCHSNGTWDDYTDFSACAAFPAVESSLPKLLSPVEITTILYITGYTLSLVALSAAVFIFIYFKDLRCLRNTIHTNLMATYILSDTVWMITHPIQMYQSN-EGSLGQECTIAILTLNIILHYLYLTNFFWMFVEGLYLYMLVVKTFARQNLKLRGYASIGWGAPLIVMVIWIFVKSFFTNKVNSETRLEARLISSMMPQCTLLMPGVYDWI-YQGPM--------LFVLLLNIIFLSSIMWVLITKLRAATNAE------------TQQYRKATKALLVLIPLLGVTYILFIDAPTEDHLASVYHNVRAVLLSTQGFLVALLYCFLNSEVQNTFRHHL 395          
BLAST of Corticotropin releasing hormone receptor 2 vs. TrEMBL
Match: W8C899 (Diuretic hormone receptor OS=Ceratitis capitata OX=7213 GN=DIHR PE=2 SV=1)

HSP 1 Score: 209.534 bits (532), Expect = 1.351e-57
Identity = 143/420 (34.05%), Postives = 219/420 (52.14%), Query Frame = 2
Query:   98 KTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVLFW---------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVI---VMVTENIE--------------DWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESK-LTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSD-TAATNPI 1273
            + H +TT +      ++C   +D +LCW  T RG  A  PC +EF G  Y++ +NA +YC PN TW +  NY+ C  L   ++V  +         +Y IGY +SL+SL  A ++F+YFK LRCLRN IH NL  ++I+  +LWI   +   S         VL  L     L NFFWM VEGLYL +++V T+  + ++   + IIGW  PA     WVI   +  + ++E              DW+ ++G +          +L++N I LL I+  LI KL++    +            T +Y+KA K+ +VL+PL G ++++ +  P ES  ++ +F +  A+L S+QGF VSL YCF N EVR TLR+H+    R + NI+         S R +   F++  S  T +T P+
Sbjct:   54 QQHIDTTTY--GNESAYCLTHFDSILCWPRTPRGTWAALPCLHEFQGIQYDSSQNATRYCFPNGTWEKYTNYDLCMHLPAPSTVPEFEPIIELPTIIYYIGYTISLVSLTLAIIVFAYFKELRCLRNSIHANLFFTYIMSALLWILTLSVQISIRTGLGGCVVLVTLFHFFTLTNFFWMLVEGLYLYMLVVKTFSGDNIRFNIYAIIGWGGPAAFVVIWVIAKGLTTSYDVEKFDISCPWMRESHVDWI-FQGPV--------CAVLIMNLIFLLRIMWVLITKLRSANTVE------------TRQYRKAAKALLVLIPLFGITYLVVLAGPSESGVMSHMFAVVRALLLSTQGFSVSLFYCFLNSEVRNTLRHHI-STWRDERNIQLNQ------SRRYTTKSFSKDCSPRTESTRPL 443          
BLAST of Corticotropin releasing hormone receptor 2 vs. TrEMBL
Match: K7IQB3 (Uncharacterized protein OS=Nasonia vitripennis OX=7425 PE=3 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.871e-57
Identity = 121/348 (34.77%), Postives = 190/348 (54.60%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL--------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGK--------MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNH 1144
            CP  +D +LCW  T+ G +A++PC +EF+G  Y+  +NA ++C PN TW    NY  C +L        S    +   LY+IGYGLSL +L  A +I+ Y++ LRC+RNIIH NL+ ++I+   LWI +  S  S      +  + +++    QL N+FWMFVEGLYL +++V T+  + VK+     IGW +P ++   W I+          G   +        M    +  +  +  +  + +  I + +I  +  TK +  N+       P T +Y+KA K+ +VL+PLLG ++I+ I  P E ++  +F  + A+L SSQG  V+L YCF N EVR  LR+H
Sbjct:   41 CPVGWDTLLCWPKTKAGSMAVQPCFDEFNGIRYDVKQNATRWCWPNGTWNGYTNYTQCRELYVPELPVDSSGVEITTNLYLIGYGLSLSTLIIAVIIYLYYRELRCVRNIIHTNLMFTYILANFLWILMIVSQVSLEKNIPICIIFYSMYHYFQLTNYFWMFVEGLYLYVLVVKTFSGDIVKLKTCLFIGWGIPLIVVLVWGIIKALAENSAAAGSPVRALSNHCPWMIPHPYDWLYQVPAILVLCVNVIFLFMIMWVLITKLRSANT-------PETQQYRKAAKALLVLIPLLGVTYILMIAGPTEGQVANLFAYSRAVLLSSQGLLVALFYCFLNSEVRNALRHH 381          
BLAST of Corticotropin releasing hormone receptor 2 vs. TrEMBL
Match: A0A1I8Q273 (Uncharacterized protein OS=Stomoxys calcitrans OX=35570 GN=106088923 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 2.332e-57
Identity = 132/379 (34.83%), Postives = 197/379 (51.98%), Query Frame = 2
Query:   98 KTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVLFW---------LYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-------MVTENIE------------DWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESK-LTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHL 1147
            + H +TT F    + ++C   +D +LCW  + RG +A  PC +EF G  Y++ +NA +YC  N TW Q  NY++C  L++  ++  +         +Y IGY +SL+SL  A  +F YFK LRCLRN IH NL  ++I+  +LWI   +   S         +L  L     L NFFWM VEGLYL I++V T+  +  +   + IIGW  PA+    W I           E IE            DW+ ++G +          +L++N   LL I+  LI KL++    +            T +Y+KA K+ +VL+PL G ++++ +  P E   ++ +F I  AIL S+QGF VSL YCF N EVR  LR+H+
Sbjct:   69 QEHMDTTTF--GNSSAYCLTQFDSILCWPRSPRGTLAALPCLDEFQGIQYDSSQNATRYCHANGTWDQYTNYDACMHLTEPATISEFEPIIELPTIIYYIGYTISLVSLTLAIAVFVYFKELRCLRNSIHANLFFTYIMSGLLWILTLSVQISLHTGLAGCIILVTLFHFFTLTNFFWMLVEGLYLYILVVKTFSGDNTRFMVYAIIGWGGPAVFVVIWSIAKGLTMSSATNEQIEIEGCPWMQETYVDWI-FQGPV--------CAVLIINLTFLLRIMWVLITKLRSANTLE------------TRQYRKAAKALLVLIPLFGITYLVVLAGPNEGGVMSHMFAIVRAILLSTQGFSVSLFYCFLNSEVRNALRHHI 424          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000045916.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 193.356 bits (490), Expect = 4.884e-56
Identity = 135/393 (34.35%), Postives = 215/393 (54.71%), Query Frame = 2
Query:  122 FFKNQNIS-------FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            F++N +++       +C A  D +  CW  +  GRI   PCP   +G  YN   +A + CL N TWA + NY SC        K   H  +   +  +G+ +S+ +L  AF++F   +S+RCLRN+IH NLI +FI+R ++W     I       ++P+ ++++ +     ++    NFFWMFVEG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  EN + W G   GK +  I   P+I++L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGE+R   R    +  R+Q+N    HT+    +   S+P
Sbjct:   29 FYQNSSLTLMSLDGLYCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTWAFKINYSSCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVT----NFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNENEQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARK---RWHRWQDN----HTLRVRVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000058121.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 192.586 bits (488), Expect = 1.236e-55
Identity = 133/378 (35.19%), Postives = 208/378 (55.03%), Query Frame = 2
Query:  146 FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVI-VMVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            +C A  D +  CW  +  GRI   PCP   +G  YN   +A + CL N TWA + NY SC        K   H  +   +  +G+ +S+ +L  AF++F   +S+RCLRN+IH NLI +FI+R ++W     I       ++P+ ++++ +     ++    NFFWMFVEG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  EN + W G   GK +  I   P+I++L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGE+R   R    +  R+Q+N    HT+    +   S+P
Sbjct:   44 YCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTWAFKINYSSCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVT----NFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNENEQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARK---RWHRWQDN----HTLRVRVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000034852.1 (corticotropin-releasing factor receptor 2-like [Source:NCBI gene;Acc:107197140])

HSP 1 Score: 192.586 bits (488), Expect = 1.236e-55
Identity = 133/378 (35.19%), Postives = 208/378 (55.03%), Query Frame = 2
Query:  146 FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVI-VMVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
            +C A  D +  CW  +  GRI   PCP   +G  YN   +A + CL N TWA + NY SC        K   H  +   +  +G+ +S+ +L  AF++F   +S+RCLRN+IH NLI +FI+R ++W     I       ++P+ ++++ +     ++    NFFWMFVEG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  EN + W G   GK +  I   P+I++L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGE+R   R    +  R+Q+N    HT+    +   S+P
Sbjct:   44 YCNATTDEIGTCWPRSSSGRIVERPCPEYINGVKYNTTRSAYRECLENGTWAFKINYSSCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFILFLCLRSIRCLRNVIHWNLITTFILRNVMWFLLQLIDHNIHERNEPWCRLITTIYNYFVVT----NFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVAWAIGKLYNENEQCWFGKEPGKYIDYIYQGPVIVVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEIRSAARK---RWHRWQDN----HTLRVRVARAMSIP 398          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Cavefish
Match: crhr1 (corticotropin-releasing factor receptor 1-like [Source:NCBI gene;Acc:103028117])

HSP 1 Score: 189.504 bits (480), Expect = 1.937e-54
Identity = 137/393 (34.86%), Postives = 212/393 (53.94%), Query Frame = 2
Query:  107 FNTTYFFKNQNISFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCY---------KLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVP 1228
             N T    N    FC    D +  CW  +  G +   PCP+ F G  YN+  N  + CL N TWA++A+Y  C          KL  H +V+  +  +G+ +SL +L  AF++F   +S+RCLRNIIH NLI +FI+R   W  +  +   + +    SNV++   +++      + NFFWMF EG YL   IV TY  +K++ W F  IGW +P  +  AW I  +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ +VF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+    +H+I    +   S+P
Sbjct:   43 LNETSSSTNSTGLFCNIYTDAIGTCWPKSSVGEVISRPCPDTFHGVRYNSTNNVYRECLDNGTWARKADYSQCLEILNEEKKSKLHYHIAVI--INYLGHCISLGALLVAFILFMRLRSIRCLRNIIHWNLITAFILRNATWFVVQLTMNPEVHE---SNVIWCRLVTAAYNYFHVTNFFWMFGEGCYLHTAIVLTYSTDKLRKWMFICIGWCIPFPIIVAWAIGKLYYDNEKCWFGKRAGVYTDYIYQGPMILVLLINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQIVFIYFNSFLESFQGFFVSVFYCFLNSEVRSAVRK---RWHRWQD----KHSIRARVARAMSIP 411          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Cavefish
Match: ENSAMXT00000037591.1 (corticotropin releasing hormone receptor 1 [Source:NCBI gene;Acc:103036295])

HSP 1 Score: 180.259 bits (456), Expect = 5.958e-51
Identity = 132/371 (35.58%), Postives = 196/371 (52.83%), Query Frame = 2
Query:  131 NQNISFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISS-----QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKM--KXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQN--NIRTR 1186
            N +  FC    D +  CW  +  G +   PCP    G  YN      + CL N TWA + NY  C        K   H  +   +  +G+ LSL +L  AF +F   +S+RCLRNIIH NLI +FI+R   W  +  +     +    SNV +   +++      +ANFFWMF EG YL   IV TY  +++K W F  IGW +P  +  AW    +  +N + W G R  +    I   P+IL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ +VF   N+ L S QGF+VS+ YCF N EVR  +R    +  R+Q+  +IRTR
Sbjct:   50 NSSGVFCRTSIDGIGTCWPRSMAGEMVSRPCPELLYGVRYNTTNKIFRKCLANGTWASKGNYSQCKAILNVQRKSKLHYRIAVIINYMGHCLSLFTLLIAFTLFLRLRSIRCLRNIIHWNLISAFILRNATWFIVQLTMSPDVHE---SNVPWCRLVTTLYNYFHMANFFWMFGEGCYLHTAIVLTYSTDRLKKWMFICIGWCIPLPIIVAWAFGKLYYDNEKCWFGKRAGVYTDYIYQGPMILVLMINFIFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEVSQIVFIYFNSFLQSFQGFFVSVFYCFLNSEVRSAVRK---RWHRWQDKHSIRTR 402          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004899.1 (pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-1 gene:ENSPMAG00000004402.1 transcript:ENSPMAT00000004899.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 191.045 bits (484), Expect = 7.215e-56
Identity = 139/383 (36.29%), Postives = 209/383 (54.57%), Query Frame = 2
Query:  128 KNQNISFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL-------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVG-YRGK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEY-KKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR---NHLFKCARFQNNIRTRHTICNIPSH 1213
            K  +++ C A  D +  CW  +E GR    PCP  F+G  Y++ ++  + CL N TWAQR+NY  C  +       SQH  +   +  +G+ +SL +L +AF  F + +S+RCLRN IH +L+ +FI+R   W     I +     ++P+ ++V  V        Q+ NFFWMFVEG YL   IV TY  +K++   F  IGW +PA +   W +V +  E+ + W G   GK +  I   PIIL+L+VN I L  IV  L+ KL+A+   +            T +Y +KA+K+T+VL+PLLG ++++F  +P E  ++ V+F   N+ L S QGF+VS+ YCF NGEVR  LR   N      R Q  +    +I   P+ 
Sbjct:   35 KLHSLACCNATRDEIGTCWPESEAGRTVATPCPERFNGVRYDSSKSVIRECLANGTWAQRSNYSLCKPIIDAKKPNSQHYKIALIVNYLGHCISLAALITAFGFFWWLRSIRCLRNAIHWHLVTTFILRNAAWLLLQIIDLSTQERNEPWCRVVITVFNYF----QVTNFFWMFVEGCYLHTAIVMTYSTDKLRKSIFVCIGWCIPAPIIIVWAMVKLFYEDEKCWFGKTEGKYIDYIYQGPIILVLLVNFIFLFNIVRILMTKLRASTTSE------------TIQYSRKAVKATLVLLPLLGITYMLFFVNPGEDPVSQVIFIYVNSFLMSFQGFFVSVFYCFLNGEVRSALRKRWNRWMDNHRLQARVTRAMSIPTSPTR 401          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009958.1 (pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 gene:ENSPMAG00000008983.1 transcript:ENSPMAT00000009958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.422 bits (472), Expect = 2.441e-54
Identity = 131/350 (37.43%), Postives = 199/350 (56.86%), Query Frame = 2
Query:  146 FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKL------SQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW-----ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGK-----MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRN 1141
            FC A  D +  CW  +E  R+ I PCP+ F+G  Y+  ++  + C+ +ATWA+R+NY  C  +      SQH  V   +  +G+ +SL++L +AF IF   +S+RCLRN IH NL+ +FI+R   W     I +     ++P+  ++  +        Q+ NFFWMFVEG YL   IV TY  +K++ W F  IGW +PA +       MV  + ED   + GK     +  I   PIIL+L++N I L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E +++ V+F   N+ L S QGF+VS+ YCF NGEVR  +R 
Sbjct:   12 FCNATRDEIGTCWPSSEASRVVIRPCPDRFNGVQYDTSKSVYRECMADATWARRSNYSLCEAIILSKRNSQHYKVALVVNYLGHCVSLLALMTAFTIFWCLRSIRCLRNAIHWNLMTTFILRNATWFLLQLIDLSTQERNEPWCCIIITIFNYF----QVTNFFWMFVEGCYLHTAIVMTYSTDKLRKWIFICIGWVIPAPIIII--WAMVKLHFEDEKCWFGKTPGKYIDYIYQGPIILVLLINFIFLFNIVTILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDEISQVIFLYVNSFLMSFQGFFVSVFYCFLNGEVRSAIRK 343          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Sea Lamprey
Match: pth1r (parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZDB-GENE-991123-8])

HSP 1 Score: 143.665 bits (361), Expect = 3.607e-38
Identity = 120/385 (31.17%), Postives = 182/385 (47.27%), Query Frame = 2
Query:   98 KTHFNTTYFFKNQNIS--FCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATW----AQR--ANYESCYKL-------SQHNSV--LFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVI--------------LWISIYASSFSKPYPQMVSN--VLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNIT---NAILSSSQGFWVSLIYCFFNGEVRMTLRN 1141
            KTH   T    N + +   C A +D ++CW     G +  E CP+    +++N + +A + C  N TW    A R  ANY  C +         +  S+  L  LY IGY +SL SL  A  I + F+ L C RN IH +L +SF++R                L ++    S     P + +   V+  L +     ++FW+ VEGLYL  +I  T+     ++W F +IGW  P +    W     T  N + W    G +K I   PI+  + VN +  + IV  L  KL+ T   +Q SR+         +Y+K LKST+VLMPL G  +++F   P    + + + I        +S QGF+V++IYCF NGEVR  ++ 
Sbjct:   29 KTHCEKTIHSTNASSADTHCTAEWDGLICWPWGLPGSMVREKCPSYI--YDFNAHGHAYRKCESNGTWKMSTANRLWANYSECTEFLNPHVQAKEKESIHRLSILYTIGYSVSLASLAIALCILTVFRRLHCTRNYIHMHLFVSFMLRAASIFVKDGVLYSDNELRLATPGPSPPAEAPHIFAGCRVVVTLFLYCLATSYFWVLVEGLYLYSLIFLTFSASG-RLWTFALIGWGFPVVFVFVWAAARATLANSQCWDLSAGWLKWIYQAPILAAVAVNFVLFVNIVRVLATKLRETNAARQESRQ---------QYRKLLKSTLVLMPLFGVHYVLFAAMPYTDVIGLAWQIQMYYEMTFNSFQGFFVAIIYCFCNGEVRGEMKK 401          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000542.1 (pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1 gene:ENSPMAG00000000476.1 transcript:ENSPMAT00000000542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 7.831e-31
Identity = 117/408 (28.68%), Postives = 192/408 (47.06%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-------ANYESCYKLSQHNSV----LFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFII-RVILWISIYASS------FSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWA---VPALLTTAWVIVMVTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSP--PESKLTVVFNITNAILSSS--QGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVS 1297
            C   +D  LCW  T  G +A++ CP+ F  F+    E   K C  +  W +        +NY  C   +         LF+L + G+G+S++ L  +  IF YFKSL C R  +H NL +S+I+  +I  I + A +       SKP   +   VL   +      N+FWM  EG+YL  +IV     EK  ++ + ++GW    VPAL+      +   +N   W+     +  I+H P++  L+VN   LL IV  L+ KLK T   +            T+ Y KA+++T++L+PLLG   I F+  P  PE  +  +++    I  +   QGF V+ I+CF NGEV+  L+ +     R  +  R ++ + +          +   +++    N  E+H ++ S
Sbjct:   41 CNRTWDGWLCWGDTMAGDVAVQHCPDYFPDFDLQ--EKVTKICNTDGQWFRHPDSNRTWSNYTLCNAFTADKLKMAVNLFYLAVTGHGVSILVLLVSLTIFFYFKSLSCQRITLHKNLFMSYILNSIITIIQLTAVANNQELVASKP---VWCKVLQFFHQYMMGCNYFWMLCEGIYLHTLIVVAVFAEKQHLFWYYLLGWGFPIVPALMHAVARTIYYDDNC--WISSATHLLYIIHGPVVAALLVNLFFLLNIVRVLVTKLKVTHRAE------------TSMYMKAVRATLILVPLLG---IQFVLVPWKPERFVGEIYDYIMQIFPTHLIQGFLVATIFCFCNGEVQAALKRYWILYLRMGHERRDQYFMASTS--------YTASVTELPCPNGGEHHGRMAS 418          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003797.1 (pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 gene:ENSPMAG00000003461.1 transcript:ENSPMAT00000003797.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 3.098e-30
Identity = 68/198 (34.34%), Postives = 106/198 (53.54%), Query Frame = 2
Query:  149 CPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQ---------HNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSF-----SKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGW 697
            C +  D +  CW  T  G++   PCP  F+G  Y  +    + CL N TWA  +NY  C  + +         H  V   +  +G+ +SL +L  AF++F   +S+RCLRNIIH NLI +FI+R  ++ ++    F     ++P+ ++VS +    +++    NFFWMF EG YL   IV TY  +K++ W F  +GW
Sbjct:   44 CNSTLDEIETCWPSTPVGQVVSRPCPEFFNGVRYEIHRTVYRECLENGTWALISNYSECKPIVENKEVQTESFHYEVALIINYLGHCISLAALVIAFLLFMGLRSIRCLRNIIHWNLISTFILRNSMFYTLQLIDFRTQEANEPWCRVVSTIYNYFHVT----NFFWMFGEGCYLHTAIVMTYSTDKLRKWVFLCLGW 237          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Nematostella
Match: EDO34537 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP31])

HSP 1 Score: 81.6481 bits (200), Expect = 2.874e-17
Identity = 81/265 (30.57%), Postives = 127/265 (47.92%), Query Frame = 2
Query:  368 IGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIED---------WVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTL 1135
            IG G+S ++L    VIF   +SL   R+ IH NL+L+  +  IL++S   ++ +K   Q+V+  L      +    F WM  EG++L + +V  +RIE V++ H+ I GW  PA      VIV ++  I+          W+            P+  I+ +N + L+ +V T++      KN      R              +K  +VLMPLLG S I  + +   +K TV F    AI +S QGF + L++  FN EVR+ L
Sbjct:   51 IGCGISSVALLITLVIFLSIESLSTERHRIHLNLVLALFLAQILFLSGINATGNKIGCQVVAAFLHYFYTVA----FTWMLNEGVHLYLKVVKVFRIENVRLLHYYIFGWGFPA------VIVGISAAIKPNSYGTESICWLSLSDDFVWAFIGPVTFIIAINCLILIVVVKTIVNSASTVKNSDHAHIR------------AGVKGALVLMPLLGVSWISGLLAV--NKDTVFFQYVFAITNSFQGFLIFLLHVVFNTEVRINL 291          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Nematostella
Match: EDO45211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTG7])

HSP 1 Score: 55.0694 bits (131), Expect = 5.600e-8
Identity = 78/348 (22.41%), Postives = 151/348 (43.39%), Query Frame = 2
Query:  311 YESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNI----IHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIED---WVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSE 1333
            Y+      +H   L  + +IG G++L+   +A + F      R  R      IH +  ++ I  + L++  Y    +    ++   V+  L+ S  LA F WM +EG  L   +V  + +   ++  + ++GW  PA++      V   E I D   W+ Y  K   +   P+  I+++N + L+  +  +I + +   N        N    +  E + A K+T++LMPLLG +  +   +  +S  ++V     AI++S QG +  + +C ++ +V     N   +         + HT  +  S          + ++ A +  IE+   I   + KL+  KD+E
Sbjct:  518 YDDGTIPKEHRFALQLVSLIGCGVALLCFVAALLAFHITGKDRHRRKTETMTIHKHFAIAQIFALTLFLVAY---VAVDIYELCYAVVVMLHYSF-LAVFLWMLIEGFNLHRGLVQVF-LTSSRMKAYCLLGWLTPAVVVAITAGVTQGEYIRDDFCWISY--KYIWVFAGPVAAIILINFVILVIAIRVMIRRSRYKINHMVE----NTMSEMEKELRIAFKTTIILMPLLGLTWCLGFFAAHDSVGSLVIQYAFAIINSLQGLYFFIAHCLYDEDVIRAANNTSVRVKTMFRRTLSHHTASSNVSGSNESKRVKAEYNEGAFSPRIEHFDGIAPDL-KLENIKDTE 853          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Nematostella
Match: EDO44368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW06])

HSP 1 Score: 51.6026 bits (122), Expect = 1.513e-7
Identity = 48/154 (31.17%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  302 RANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEG--LYLLIVIVW-TYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENI 754
            + + ++  K   H   L  +  IG  LS+++LC A + F  F+ L+  R  +H NL +S I+  +L++       +K   ++V  ++ AL     LA+F WM +EG  LYL++V V+ T  I   K   F   GW +PA      V+V V+  I
Sbjct:   48 KGDMDAILK-GDHRLALSLITYIGIVLSVVTLCIALLTFITFRFLKSSRTFLHKNLSISLILAQLLFLF----GVNKTEIKLVCQIIAALLHYLWLASFAWMALEGVMLYLMLVKVFGTKTITNKKRAVFLTFGWGLPA------VVVGVSAGI 190          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Medaka
Match: CRHR2 (corticotropin-releasing factor receptor 2 [Source:NCBI gene;Acc:101157488])

HSP 1 Score: 192.586 bits (488), Expect = 4.497e-55
Identity = 137/383 (35.77%), Postives = 213/383 (55.61%), Query Frame = 2
Query:  122 FFKNQNIS-------FCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESC-------YKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWI-------SIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYR-GK-MKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLT-VVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNN--IRTR 1186
            F +N ++S       +C A  D +  CW  +  GRI   PCP   +G  YN   +A + C+ N TWA + NY +C        K   H  +   +  +G+ +S+ +L  AFV+F   +S+RCLRNIIH NLI +FI+R ++W        +I+ S+  +P+ ++++ +     ++    NFFWMFVEG YL   IV TY  +K++ W F  IGW +P  +   W I  +  EN + W G   GK M  I   P+IL+L++N + L  IV  L+ KL+A+   +            T +Y+KA+K+T+VL+PLLG ++++F  +P E  ++ +VF   N+ L S QGF+VS+ YCF NGEVR  +R    +  R+Q+N  +R R
Sbjct:   89 FLENASLSLLSADGLYCNATVDEIGTCWPRSSTGRIVERPCPAYINGVKYNATRSAYRECMDNGTWALKINYSNCEPILEEKRKYPMHYKIALIINYLGHCISVGALVVAFVLFLCLRSIRCLRNIIHWNLITTFILRNVMWFLLQLIDHNIHESN--EPWCRLITTIYNYFVVT----NFFWMFVEGCYLHTAIVMTYSTDKLRKWVFLFIGWCIPCPIIVTWAIGKLYFENEKCWFGKEPGKYMDYIYQGPVILVLLINFVFLFNIVRILMTKLRASTTSE------------TIQYRKAVKATLVLLPLLGITYMLFFVNPGEDDISQIVFIYFNSFLQSFQGFFVSVFYCFLNGEVRSAVRK---RWHRWQDNHALRVR 450          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Medaka
Match: pth1r (parathyroid hormone 1 receptor [Source:NCBI gene;Acc:101155466])

HSP 1 Score: 157.147 bits (396), Expect = 1.422e-41
Identity = 144/499 (28.86%), Postives = 227/499 (45.49%), Query Frame = 2
Query:   26 IFFPIHFIVMMNYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR------ANYESCYKLSQHNS---------VLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW----ISIYASSFSKPYPQMVSNVLFALNISSQL--------------------ANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNIT---NAILSSSQGFWVSLIYCFFNGEV---------RMTLRNHLFKCARFQNNIRT-----RHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENRINTN 1351
            +F  +H   ++   E +++ +  + T  N           FC A +D ++CW     G++    CP     FN+     A + C  N TW Q       ANY  C K   H +          L+ +Y +GY +SL SL  A VI  YF+ L C RN IH +L +S+++R I      + +Y+ S  +   ++  + L ++ I+  +                     N++W+ VEGLYL  +I  T+  ++  +W FT+IGW VPA+  + W  V  T  + E W    G +K I  +PI++ +VVN I  L I+  L  KL+ T   + ++R+         +Y+K LKST+VLMPL G  +IIF   P      + + I      + +S QGF V++IYCF NGEV         R TL     + AR  +N  +      HT     + R  + L    ++      P+  H+   SL   +K    SEN I ++
Sbjct:   20 VFCLVHSDDVLTKEEQITQLVIAKHTCENNIASRSKIPNGFCSAEWDGIVCWPEGPPGKLVSTACPEYIYDFNHKGL--AYRRCDNNGTWEQASANKTWANYNECAKFLYHYNHSHEKEVFHRLYLIYTVGYSVSLGSLMVAVVILGYFRRLHCTRNYIHMHLFVSYMLRAISIFVKDVVLYSESPLENMERVTLDDLKSITIAPPVNKTQFIACKVVVTLFMYFLATNYYWILVEGLYLHSLIFMTFFSDRKYLWGFTLIGWGVPAVFVSIWATVRATFADTECWDLSAGNLKWIYQVPILMAVVVNFILFLNIIRVLATKLRETNAGRCDTRQ---------QYRKLLKSTLVLMPLFGVHYIIFNAMPYTEVSGIPWLIQMHYEMLFNSFQGFLVAIIYCFCNGEVQAEIKKSWNRRTLALDFKRKARSGSNTYSYGPMVSHTSVTNVTARGPLAL---HLTTRLGPAPVNGHR---SLPGYVKNGSVSENSIPSS 501          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Medaka
Match: calcr (calcitonin receptor [Source:NCBI gene;Acc:101174680])

HSP 1 Score: 138.658 bits (348), Expect = 1.172e-35
Identity = 116/370 (31.35%), Postives = 179/370 (48.38%), Query Frame = 2
Query:   89 KC-RKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYE---SCYKLSQHNS--------VLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVS------NVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIED--WVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            KC  K H +  Y   N++  FC   +D  LCW+ T  G  A + CPN F  F+    E A KYC  +  W +  +     S Y L   N+        +LF++ I+G+ LS+ SL  +  IF YF+SL C R  +H NL  S+++   L I    +  +   P++V+       VL   ++     N+FWM  EG+YL  +IV     E+  +  + ++GW  P L+  +   V   +  +D  W+     +   VH PI+  L+VN   LL I+  L+ KL+ T   +            +N Y KA+++T++L+PLLG   +IF   P       V+     IL   QG  V+ I+CFFNGEV+  L+
Sbjct:   27 KCFEKMHRDPPY---NKSGPFCSRNWDGWLCWEDTPAGTFAAQNCPNYFDDFDPT--EKATKYCGEDGQWFRHPDTNRTWSNYTLCNENTKAKLKSAYILFYMAIVGHALSIASLLISLAIFFYFRSLSCQRITLHKNLFFSYVLNSALTIIYLVTVVNN--PEVVARNPVGCKVLHFFHMYMLGCNYFWMLCEGIYLHTLIVVAVFAEEQHLHWYYLLGWGFP-LVPVSIHAVARKKYFDDNCWMSVETHLLYAVHGPIVAALLVNLFFLLNIIRVLVTKLRDTHRAE------------SNMYMKAVRATLILVPLLGIQFVIFPWRPENRLAGEVYEYVMHILMHYQGLLVATIFCFFNGEVQGALK 376          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Medaka
Match: pth2ra (parathyroid hormone 2 receptor [Source:NCBI gene;Acc:101167084])

HSP 1 Score: 138.658 bits (348), Expect = 5.568e-35
Identity = 108/376 (28.72%), Postives = 180/376 (47.87%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWA-------QRANYESCYKLSQ----------HNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVI-LWIS---IYASSFSKPYPQMVSNVLFALNISS-------------------QLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSP-----PESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            CP  +D ++CW     G++   PCP+    FN+  +  A + C  N +W           NY  C    Q              L+ +Y  GY +S  SL  A +I  YF+ L C RN IH +L +SF++R + +++    +Y+S+  + +   + + L  ++I+S                      N++W+ VEGLYL  +I   +R +   +W F  IGW VPA+    W IV  T  +   W    G +K I  +PI+  + +N I  + IV  L  K++ T   + ++R+         +Y+K  KST+VL+ + G  +IIF+  P     P  ++ + F +     +S QGF+VS+IYC+ NGEV+  ++
Sbjct:   74 CPPDWDGLICWPHGSPGQVTEVPCPSYIYDFNHKGH--AYRKCDVNGSWVFVEQWNKTWTNYSECLSFLQPFKDEEARQDFFERLYVMYTTGYAVSFSSLLVAIMIIGYFRRLHCTRNYIHMHLFVSFMLRAVSIFVKDKVVYSSAGLQDFDSALLDNLKTVSIASVDKSHYIGCKMTVVLFIYFLATNYYWILVEGLYLHSLIFMAFRSDSKYLWGFIFIGWGVPAVFVAIWAIVRATLADARCWELSAGNVKWIYQVPILTAIGLNFILFVNIVRVLATKIRETNAGRYDTRK---------QYRKLAKSTLVLVLVFGIHYIIFVGMPHTFQGPSWEMRMYFEL---FFNSFQGFFVSIIYCYCNGEVQTEIK 435          
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Medaka
Match: pth3r (parathyroid hormone/parathyroid hormone-related peptide receptor [Source:NCBI gene;Acc:101173747])

HSP 1 Score: 137.502 bits (345), Expect = 1.239e-34
Identity = 113/382 (29.58%), Postives = 175/382 (45.81%), Query Frame = 2
Query:   89 KCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYE--------NAEKYCLPNATWAQRANYESC--YKLSQHNSV-------LFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVI---LWISIYASSFSKPYPQMVSNVLFALNISSQL--------ANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVT-ENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNIT---NAILSSSQGFWVSLIYCFFNGEVRMTLR 1138
            +C ++    T   K  +   C   +D ++CW  +  G++   PCP     FN+            N E     N TWA   NY  C  Y  S H S+       L  +Y +GY +SL SL  A  I  YFK L C RN IH +L  SFI R +   +  S+  S       +  +   +     + +         N +W+  EGLYL  +I      +K  +W  TI+GW +PA+  + WV    +  + + W    G +K I  +PI+  + VN +  + I+  L  KL  T   + N R+         +Y+K L+ST+VLMPL G  +I+F+  P      +++ +        +SSQGF+V+ IYCF NGEV+  ++
Sbjct:   44 RCERSIQTQTAIIKEGD---CVPEWDGIICWPQSRAGQLVSVPCPEYIYDFNHRGRAYRQCDVTGNWELVTSNNHTWA---NYTECTRYLTSNHRSLQEKVFKRLHLMYTVGYSISLSSLLVAVSILCYFKRLHCTRNYIHIHLFTSFICRAVSIFVKDSVLYSITDDSKAEFPAERQYTAGCKAAVTFFLYFLATNHYWILAEGLYLHSLIFMALLSDKNYLWVLTIMGWGIPAVFVSVWVSARASLADTQCWDISAGNLKWIYQVPILAGIFVNFLLFINIIRVLASKLWETNTGKLNPRQ---------QYRKLLRSTLVLMPLFGVHYIVFMAIPYTEVNGLLWQVQMHYEMFFNSSQGFFVAFIYCFCNGEVQAEVK 410          
BLAST of Corticotropin releasing hormone receptor 2 vs. Planmine SMEST
Match: SMESG000064388.1 (SMESG000064388.1)

HSP 1 Score: 610.142 bits (1572), Expect = 0.000e+0
Identity = 327/333 (98.20%), Postives = 327/333 (98.20%), Query Frame = 2
Query:  407 FVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENRINTNRRVRSQINIRDSSDISLM 1405
            F      KSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGKMKLIVHLPIILILVVNAIALLFIVITLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENRINTNRRVRSQINIRDSSDISLM
Sbjct:   97 FPALRLVKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGKMKLIVHLPIILILVVNAIALLFIVITLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENRINTNRRVRSQINIRDSSDISLM 429          
BLAST of Corticotropin releasing hormone receptor 2 vs. Planmine SMEST
Match: SMESG000064393.1 (SMESG000064393.1)

HSP 1 Score: 267.7 bits (683), Expect = 3.722e-88
Identity = 126/126 (100.00%), Postives = 126/126 (100.00%), Query Frame = 2
Query:   53 MMNYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFK 430
            MMNYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFK
Sbjct:    1 MMNYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFK 126          
BLAST of Corticotropin releasing hormone receptor 2 vs. Planmine SMEST
Match: SMESG000051050.1 (SMESG000051050.1)

HSP 1 Score: 227.639 bits (579), Expect = 7.915e-69
Identity = 151/419 (36.04%), Postives = 231/419 (55.13%), Query Frame = 2
Query:  149 CPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLS---QHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSK-PYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVI-VMVTENI-EDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLI----EKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCAR--FQNNIRTRHTICNIPSHRQSVPLFNQQMSDTAATNPIENHKQIVSLMQKLKQTKDSENRINTNRRVRSQ 1369
            CP  YD    W  T    +A + CP +     YN+ EN  + CL N  WA+++NY+ C  +    +++ +  W   +GY +S I+L  A ++F YF+SLRC+RN IHCNLI+S+I+RV  W  I     +   +P  + N+   + + SQ +N+ WMFVEG YLLI+IVWTY I+K+K+WH+++IGW  P LL++   I + +TEN  E W     K K +    I + ++++ IA +F++  +I    +KLK TK     +RR++     + EY+KA+K+  VL+PLLG +H +F+      K    + I  AIL+S+QGF+V+LIYCF N EVR  L+   ++  R    +  RTR TI +                   +T P+       S  + LKQ  D +N +   R  RSQ
Sbjct:   30 CPPSYDGFRNWTYTISNTVATQKCPGKSLKPYYNDKENITRMCLANGVWAKKSNYDRCIMMPNKIEYHVIATWF--VGYTISTIALWIALILFRYFRSLRCIRNDIHCNLIVSYIVRVFTWYLIIVPQITTTDWPITIVNITTIIILFSQASNYLWMFVEGFYLLIIIVWTYGIDKLKMWHYSLIGWGFPTLLSSILAISIALTENFNESWFN-SSKAKPLKLYIIHIPILISIIANVFVLAVIIYTVFKKLKQTKIPV--TRRSSKLSLFSTEYRKAIKAAAVLIPLLGIAHCLFMFESKSLKYQDAYKILTAILTSTQGFFVALIYCFLNREVRFVLKAK-YRSFRGYLPSASRTRQTIDD-------------------STGPVRRGN---SAFRPLKQ--DYDNNVFKCRSYRSQ 418          
BLAST of Corticotropin releasing hormone receptor 2 vs. Planmine SMEST
Match: SMESG000049048.1 (SMESG000049048.1)

HSP 1 Score: 218.779 bits (556), Expect = 2.678e-65
Identity = 137/369 (37.13%), Postives = 210/369 (56.91%), Query Frame = 2
Query:  146 FCPAVYDYVLCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATW-AQRANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKN------------QQQNS-------RRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRHT 1192
            +C A++D V+CW PT  G  AI PCP+ F GF Y++ +NA + C  + +W A ++NY SC         L  ++I GY LS+I LCSA  +F +FK+L+C RN IHC+L  +FI+R   ++ ++  + S  +P  +  ++  ++  + LA F WM +EGLYL  +I WTY + +++  HF IIGW  P  LT+A  +  +  +  D   +  ++     +PII IL++N+I +LFI+  L+ KL+A +               Q+S       R +        EY+KA+K+T+VLMPLLGF +IIFI +    K+  +F   NA+ +S+QGF V+LIYCF N EVR  +R  L       NN +  H 
Sbjct:   25 YCEAIFDGVMCWPPTRAGEQAILPCPHTFDGFEYDSNDNATRQCSTDGSWTANKSNYNSCVNGRHEEINLVGVFISGYALSIICLCSALFLFCHFKALKCTRNFIHCHLFSAFILRSASFLVLFIITPSG-HPLRILQIVLMISRLAHLAIFHWMLIEGLYLFKLIYWTYGLRRLRTRHFAIIGWGFPMALTSANTLYNIFTSPHDL--WMRQLDYFTDIPIITILIMNSIIMLFIIHALVVKLRARRPLGIQKSVKRFELPHQDSSGCNKTHRMSYQLSRFPVEYRKAMKATLVLMPLLGFYYIIFI-THYHPKVKFLFTYLNAMFTSTQGFMVALIYCFQNIEVRKLVRGRLIAWREGYNNPKLSHV 389          
BLAST of Corticotropin releasing hormone receptor 2 vs. Planmine SMEST
Match: SMESG000023013.1 (SMESG000023013.1)

HSP 1 Score: 152.525 bits (384), Expect = 4.242e-41
Identity = 117/361 (32.41%), Postives = 183/361 (50.69%), Query Frame = 2
Query:  143 SFCPAVYDYV-LCWKPTERGRIAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQR-------ANYESCYKLSQHNSVLFWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILWISIYASSFSKPYPQ---MVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTYRIEKVKIWHFTIIGWAVPALLTTAWVIV-MVTENIEDWVGYRGKMKXXXXXXXXXXXXXXXXXXXXXXXTLIEKLKATKNQQQNSRRNNAFGPLTNEYKKALKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIYCFFNGEVRMTLRNHLFKCARFQNNIRTRH 1189
            S+C A  D +  CW  T+ G IA  PCP +  GFN+N    A K C  N TW          +NY  C + ++ N  L +++  GY LS++ L  +  IF  FK LRC R  +H NL +  +I  I+WI+ Y    +    Q   +   +LF +     +  +FWMF EG+YL ++++ T+    + +    + GW +P +LT+ +VI   + E  E       KM LI+ +P ++ L  N + LLFI+ TL+ KL    N+++             ++ K  K+  +L+PLLG  +IIF   P   ++ ++ + + A+LSS QG  VS I CFFN EVR  +R    + +  Q    TR 
Sbjct:   21 SYCNATKDKLGTCWNYTKAGEIAFAPCP-KLPGFNWN--AEASKKCEINGTWYFSIEENNYWSNYSKCLQ-NKPNVSLVYVFFAGYSLSVLCLSISLFIFFVFKQLRCDRVTLHKNLFMCHLINAIIWINFYVVISNGDVMQRNPIHCQILFVIATYFSVGTYFWMFSEGIYLAVILILTFHKGPILLTICIVTGWGLPLILTSIYVISRYLMEKPEKCWTEPSKMYLILAIPNVVALGANLLILLFILKTLVTKLSHPTNREET------------QWSKTAKAVFILIPLLGLQNIIFFIYPDNQEVRLIQDYSTAVLSSFQGVLVSFILCFFNHEVRTIIRRRACQHSLLQPLKTTRR 365          
The following BLAST results are available for this feature:
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRHR18.419e-5435.54corticotropin releasing hormone receptor 1 [Source... [more]
CRHR18.419e-5435.54corticotropin releasing hormone receptor 1 [Source... [more]
CRHR18.419e-5435.54corticotropin releasing hormone receptor 1 [Source... [more]
CRHR26.599e-5336.18corticotropin releasing hormone receptor 2 [Source... [more]
CRHR21.379e-5236.29corticotropin releasing hormone receptor 2 [Source... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdfr-11.146e-2427.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.146e-2427.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.190e-2427.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.190e-2427.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
pdfr-11.190e-2427.78Calcitonin receptor-like protein 1 [Source:UniPro... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dh44-R24.298e-5434.91gene:FBgn0033744 transcript:FBtr0087936[more]
Dh44-R21.272e-5334.76gene:FBgn0033744 transcript:FBtr0113075[more]
Dh44-R13.953e-5234.35gene:FBgn0033932 transcript:FBtr0087485[more]
Pdfr3.566e-2928.50gene:FBgn0260753 transcript:FBtr0070436[more]
hec3.194e-2227.99gene:FBgn0030437 transcript:FBtr0343652[more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crhr15.671e-5435.26corticotropin releasing hormone receptor 1 [Source... [more]
CRHR22.095e-4536.28corticotropin-releasing factor receptor 2 [Source:... [more]
pth1r5.558e-4232.62parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth1r9.871e-4232.62parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
pth3r9.005e-3730.71parathyroid hormone 3 receptor [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yif1b1.290e-5334.57Yip1 interacting factor homolog B, membrane traffi... [more]
yif1b2.537e-5332.76Yip1 interacting factor homolog B, membrane traffi... [more]
yif1b2.979e-5334.48Yip1 interacting factor homolog B, membrane traffi... [more]
slc17a93.122e-5335.54solute carrier family 17 member 9 [Source:Xenbase;... [more]
slc17a95.141e-5335.88solute carrier family 17 member 9 [Source:Xenbase;... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Crhr24.116e-5635.00corticotropin releasing hormone receptor 2 [Source... [more]
Crhr24.901e-5635.00corticotropin releasing hormone receptor 2 [Source... [more]
Crhr25.474e-5634.91corticotropin releasing hormone receptor 2 [Source... [more]
Crhr27.377e-5634.91corticotropin releasing hormone receptor 2 [Source... [more]
Crhr14.100e-5435.28corticotropin releasing hormone receptor 1 [Source... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P47866|CRFR2_RAT3.173e-5535.96Corticotropin-releasing factor receptor 2 OS=Rattu... [more]
sp|Q60748|CRFR2_MOUSE3.829e-5534.91Corticotropin-releasing factor receptor 2 OS=Mus m... [more]
sp|O42603|CRFR2_XENLA4.611e-5435.60Corticotropin-releasing factor receptor 2 OS=Xenop... [more]
sp|P35353|CRFR1_RAT2.354e-5335.54Corticotropin-releasing factor receptor 1 OS=Rattu... [more]
sp|P35347|CRFR1_MOUSE2.868e-5335.28Corticotropin-releasing factor receptor 1 OS=Mus m... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
X2BBW74.704e-6334.41Uncharacterized protein OS=Capitella teleta OX=283... [more]
A0A1B6GNH44.168e-5835.53Uncharacterized protein OS=Cuerna arida OX=1464854... [more]
W8C8991.351e-5734.05Diuretic hormone receptor OS=Ceratitis capitata OX... [more]
K7IQB31.871e-5734.77Uncharacterized protein OS=Nasonia vitripennis OX=... [more]
A0A1I8Q2732.332e-5734.83Uncharacterized protein OS=Stomoxys calcitrans OX=... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045916.14.884e-5634.35corticotropin-releasing factor receptor 2-like [So... [more]
ENSAMXT00000058121.11.236e-5535.19corticotropin-releasing factor receptor 2-like [So... [more]
ENSAMXT00000034852.11.236e-5535.19corticotropin-releasing factor receptor 2-like [So... [more]
crhr11.937e-5434.86corticotropin-releasing factor receptor 1-like [So... [more]
ENSAMXT00000037591.15.958e-5135.58corticotropin releasing hormone receptor 1 [Source... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004899.17.215e-5636.29pep scaffold:Pmarinus_7.0:GL476767:721819:758871:-... [more]
ENSPMAT00000009958.12.441e-5437.43pep scaffold:Pmarinus_7.0:GL477206:37870:64312:-1 ... [more]
pth1r3.607e-3831.17parathyroid hormone 1 receptor [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000000542.17.831e-3128.68pep scaffold:Pmarinus_7.0:GL476735:164228:192153:1... [more]
ENSPMAT00000003797.13.098e-3034.34pep scaffold:Pmarinus_7.0:GL477934:1164:14009:-1 g... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO345372.874e-1730.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452115.600e-822.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443681.513e-731.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CRHR24.497e-5535.77corticotropin-releasing factor receptor 2 [Source:... [more]
pth1r1.422e-4128.86parathyroid hormone 1 receptor [Source:NCBI gene;A... [more]
calcr1.172e-3531.35calcitonin receptor [Source:NCBI gene;Acc:10117468... [more]
pth2ra5.568e-3528.72parathyroid hormone 2 receptor [Source:NCBI gene;A... [more]
pth3r1.239e-3429.58parathyroid hormone/parathyroid hormone-related pe... [more]
back to top
BLAST of Corticotropin releasing hormone receptor 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064388.10.000e+098.20SMESG000064388.1[more]
SMESG000064393.13.722e-88100.00SMESG000064393.1[more]
SMESG000051050.17.915e-6936.04SMESG000051050.1[more]
SMESG000049048.12.678e-6537.13SMESG000049048.1[more]
SMESG000023013.14.242e-4132.41SMESG000023013.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025870 ID=SMED30025870|Name=Corticotropin releasing hormone receptor 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1529bp
TTTTATTTTTACTCTTTAAAAACGTATTTTTTTCCCTATTCATTTTATAG
TCATGATGAATTATACGGAATTCGTATCTAAATTCATAAAATGTCGAAAA
ACGCATTTTAATACAACATACTTTTTTAAAAATCAGAATATCAGTTTCTG
TCCAGCGGTTTACGATTACGTTTTATGCTGGAAACCGACCGAACGTGGCC
GAATAGCTATTGAACCGTGTCCAAACGAATTTTCAGGATTCAATTATAAT
AATTACGAAAATGCAGAAAAATACTGTTTACCTAACGCTACTTGGGCACA
GAGAGCCAACTACGAATCATGCTATAAATTAAGCCAGCATAATTCCGTCC
TTTTCTGGTTGTACATTATCGGATATGGTTTATCGTTGATCAGTTTGTGC
TCGGCGTTCGTGATTTTCAGTTATTTTAAAAGTCTGAGATGTCTAAGAAA
CATTATTCACTGTAATCTTATCCTTTCATTCATCATTCGAGTCATTCTAT
GGATATCGATTTATGCCTCAAGTTTTTCAAAGCCTTATCCTCAAATGGTC
AGTAATGTTCTGTTCGCTTTAAACATTTCTTCACAACTCGCCAACTTTTT
CTGGATGTTTGTTGAGGGTCTTTATTTACTAATTGTTATTGTCTGGACAT
ATCGAATTGAAAAGGTGAAAATATGGCACTTTACAATAATAGGATGGGCT
GTTCCTGCATTATTAACAACTGCTTGGGTCATCGTAATGGTCACGGAAAA
TATAGAAGACTGGGTAGGATATCGAGGGAAAATGAAACTTATTGTACACT
TGCCAATCATTCTTATTTTAGTGGTCAATGCGATTGCCCTGCTGTTTATT
GTAATTACACTTATTGAAAAACTGAAAGCAACAAAGAATCAGCAGCAAAA
CTCCCGAAGAAACAATGCTTTTGGACCTCTTACTAATGAATATAAAAAAG
CGCTCAAATCAACAGTTGTGCTAATGCCATTATTAGGATTTTCTCATATC
ATTTTCATATGCAGTCCTCCAGAATCAAAATTGACTGTAGTCTTCAATAT
AACTAATGCCATTCTGAGTTCGTCTCAAGGATTCTGGGTATCGTTAATTT
ATTGTTTTTTTAATGGAGAAGTTAGAATGACATTAAGAAATCATTTGTTT
AAATGTGCAAGATTCCAGAACAACATTAGAACACGGCATACAATTTGCAA
CATTCCCAGCCATCGACAAAGCGTTCCATTGTTCAATCAGCAGATGTCCG
ATACTGCTGCAACAAATCCCATTGAAAATCACAAACAAATTGTGTCGCTA
ATGCAGAAATTAAAACAAACAAAAGATTCCGAAAACCGAATTAACACTAA
TCGACGAGTTCGATCTCAAATCAACATTCGTGATTCAAGTGACATCTCTT
TGATGTAAAGGTGCTGTTTTCCGATATGGTCTGTTTTGTATATACAATTC
TTGAAGGATTACAAAGAATCTATTGTTATTTGTAGAATAATATGATGTTG
CTGATTTCGTTTTGATATTATGGCTCCCC
back to top

protein sequence of SMED30025870-orf-1

>SMED30025870-orf-1 ID=SMED30025870-orf-1|Name=SMED30025870-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=452bp
MMNYTEFVSKFIKCRKTHFNTTYFFKNQNISFCPAVYDYVLCWKPTERGR
IAIEPCPNEFSGFNYNNYENAEKYCLPNATWAQRANYESCYKLSQHNSVL
FWLYIIGYGLSLISLCSAFVIFSYFKSLRCLRNIIHCNLILSFIIRVILW
ISIYASSFSKPYPQMVSNVLFALNISSQLANFFWMFVEGLYLLIVIVWTY
RIEKVKIWHFTIIGWAVPALLTTAWVIVMVTENIEDWVGYRGKMKLIVHL
PIILILVVNAIALLFIVITLIEKLKATKNQQQNSRRNNAFGPLTNEYKKA
LKSTVVLMPLLGFSHIIFICSPPESKLTVVFNITNAILSSSQGFWVSLIY
CFFNGEVRMTLRNHLFKCARFQNNIRTRHTICNIPSHRQSVPLFNQQMSD
TAATNPIENHKQIVSLMQKLKQTKDSENRINTNRRVRSQINIRDSSDISL
M*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036445GPCR_2_extracell_dom_sf
IPR000832GPCR_2_secretin-like
IPR002001GPCR_2_diuretic_rcpt
IPR001879GPCR_2_extracellular_dom
IPR017983GPCR_2_secretin-like_CS
IPR017981GPCR_2-like
IPR013809ENTH
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007166cell surface receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0008036diuretic hormone receptor activity
GO:0004888transmembrane signaling receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
GO:0005886plasma membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000832GPCR, family 2, secretin-likePRINTSPR00249GPCRSECRETINcoord: 246..271
score: 33.7
coord: 134..158
score: 31.59
coord: 300..320
score: 43.1
coord: 169..192
score: 40.82
coord: 332..353
score: 43.07
coord: 207..232
score: 31.23
coord: 102..126
score: 37.76
IPR000832GPCR, family 2, secretin-likePFAMPF000027tm_2coord: 100..346
e-value: 4.9E-49
score: 166.8
IPR002001GPCR, family 2, diuretic hormone receptorPRINTSPR01127DIUHORMONERcoord: 79..103
score: 22.0
coord: 56..75
score: 35.0
coord: 195..210
score: 31.25
coord: 312..325
score: 21.43
IPR001879GPCR, family 2, extracellular hormone receptor domainSMARTSM00008HormR_1coord: 29..99
e-value: 1.4E-11
score: 54.5
IPR001879GPCR, family 2, extracellular hormone receptor domainPFAMPF02793HRMcoord: 31..92
e-value: 3.2E-14
score: 53.0
IPR001879GPCR, family 2, extracellular hormone receptor domainPROSITEPS50227G_PROTEIN_RECEP_F2_3coord: 13..94
score: 15.526
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilyGENE3DG3DSA:4.10.1240.10coord: 12..88
e-value: 2.9E-19
score: 70.7
IPR036445GPCR family 2, extracellular hormone receptor domain superfamilySUPERFAMILYSSF111418Hormone receptor domaincoord: 12..108
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 89..383
e-value: 4.5E-60
score: 205.2
NoneNo IPR availablePANTHERPTHR45620:SF15DIURETIC HORMONE 44 RECEPTOR 2, ISOFORM Bcoord: 22..429
NoneNo IPR availablePANTHERPTHR45620FAMILY NOT NAMEDcoord: 22..429
NoneNo IPR availableCDDcd152647tmB1_CRF-Rcoord: 103..364
e-value: 4.88942E-74
score: 231.537
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 67..383
NoneNo IPR availableTMHMMTMhelixcoord: 178..200
NoneNo IPR availableTMHMMTMhelixcoord: 331..353
NoneNo IPR availableTMHMMTMhelixcoord: 134..156
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 304..321
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 249..271
IPR017983GPCR, family 2, secretin-like, conserved sitePROSITEPS00649G_PROTEIN_RECEP_F2_1coord: 33..57
IPR017981GPCR, family 2-likePROSITEPS50261G_PROTEIN_RECEP_F2_4coord: 100..354
score: 32.2