Protein-tyrosine phosphatase

Overview
NameProtein-tyrosine phosphatase
Smed IDSMED30025854
Length (bp)2241
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein-tyrosine phosphatase (SMED30025854) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein-tyrosine phosphatase (SMED30025854) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein-tyrosine phosphatase (SMED30025854) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein-tyrosine phosphatase (SMED30025854) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025854

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025854SMESG000028975.1 SmedASXL_017201SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025854SMESG000028975.1 dd_Smed_v6_13361_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025854SMESG000071273.1 SMESG000028975.1 OX_Smed_1.0.10523ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025854SMESG000028975.1 dd_Smed_v4_13361_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein-tyrosine phosphatase vs. TrEMBL
Match: A0A3R7F057 (Receptor-type tyrosine-protein phosphatase mu (Fragment) OS=Clonorchis sinensis OX=79923 GN=Ptprm PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 1.778e-19
Identity = 155/585 (26.50%), Postives = 240/585 (41.03%), Query Frame = 1
Query:  772 VVTWNPPN--------SMFGFSGYTIFLNSAIKASSLDSSFNT-FNLTNLTEGTSYNITVTSYFGTSFYSASQIGTTFSSIPPS--------NLSWEKSYTYGIIYW-NLTATPPPNYFKISV----------------NDSFQFQSGSETRFYNISSLTEAQSYTIKVSAFYYGGQEVGN------SILVWTRPYKFVSTMPLQ----SITGLTANSFGVTFPSYPNYNGS-INQYYFLLQKTSETS--RQKRDILSCQAVIPGIPGTAQIRFANSTYNKESIVIGSGTLYPPFSCP------------NDKLVSQTNYTLYTVIGSMVNGTTE---------------YTFTSSTIVTLNDSLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNGNDFIGIKGPY--------------EDVKPKSSAYWSSIIDKMQSRKIILDKNN----ILEGL--------TFKDEFDSLPPHPCYEHNALEM----------STLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRK-SYISLQNPVDNKSLSDFWLLVYNENVDQIVMIT--MEGEIVKPNIYSPD 2187
            +VTW PP         S F    + I L     AS L     T + + NL   T+Y + V S FGT   +++ +  +F ++P S         L    S T  I+Y     +  P   F +SV                N SF   S S++  ++ S L  A  Y I +S      QE  +      ++ VWT+P  F ++  L+    +    +++S  V FP+   Y+G  +N +Y +L K    +   Q  ++    +       + Q+ F +     + IVIG+G    P + P            ND L S T Y +Y V  S V+  +E                 F+SS  V   D    G    I++ +L  ++L  +      R  K G+ ++  K PY              + + PKS A+WS  +D  + R +I+D        L G         TF  E+ S+P    Y H A EM          S L + H     K SP   +  + +AS +DGY+R+ +YI+ Q+P D  +  DFWL+V+  NV QIVM+T  +E   +K   Y PD
Sbjct:  294 LVTWLPPETNNGNGALSGFEVQHWPINLTITRTASPLIPPDQTSYAINNLQAETAYGVQVFSIFGTRRVASNIV--SFETLPLSVAQSGITLQLIDRSSSTIRIVYGVQGVSLSPGQQFMLSVSRLQTLLPIVSYFRDKNISF---SSSQSMIHSFSQLPAASQYQISLSIVDPNAQETRSGLDKLATLTVWTKPETFAASSNLEFGEFTWEAESSHSVTVKFPTVLGYSGGPLNGFYVVLTKIPRLTGGHQVENLKGKSSTFISRDSSTQVAFYSRDMPAKPIVIGTGK---PVASPGRPSVLSGYRLSNDPLESNTTYGIYAVTESYVDDVSEDVVSGFLVLHTELVTKAFSSSKRVNKVDKTVLGVSLSILLFMLAVLLLGTVTYCVCSRNGKRGS-YLTSKSPYAQTSARTNTIADEYDRLLPKSYAWWSVPVDVREPRYLIIDPEKGPSSTLVGTWSKKELSDTFVREYASIPLGLKYPHKAGEMRVNKPKNRIQSVLPYDHNRVALKRSPDSGDSDYINASFVDGYMRRRAYIASQSPFDTPTACDFWLMVFQRNVSQIVMLTNLVEDGALKCCQYWPD 869          
BLAST of Protein-tyrosine phosphatase vs. TrEMBL
Match: A0A4S2JLW9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_011392 PE=4 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 4.837e-19
Identity = 148/579 (25.56%), Postives = 245/579 (42.31%), Query Frame = 1
Query:  772 VVTWNPPNSMFG---FSGYTI------FLNSAIKASSLDSSFNTFNLTNLTEGTSYNITVTSYFGT--------SF----YSASQIGTTFSSIPPSN-----------LSWEKSYTYGIIYWNL-TATPPPNYFKISVNDSFQFQSGSETRFYNISSLTEAQSYTIKVSAFYYGGQEVGNSILVWTRPYKFVSTMPLQ----SITGLTANSFGVTFPSYPNYNGS-INQYYFLLQKTSETSRQKR--DILSCQAVIPGIPGTAQIRFANSTYNKESIVIGSGTLYPPFSCP------------NDKLVSQTNYTLYTVIGSMVNGTTE-----YTFTSSTIVTLNDSLSPXXXXXXXXXXXXXXXXXXXXXXXXX-------XXXKNG----NDFIGIKGPY--------------EDVKPKSSAYWSSIIDKMQSRKIILDKNN----ILEGL--------TFKDEFDSLPPHPCYEHNALEM----------STLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRK-SYISLQNPVDNKSLSDFWLLVYNENVDQIVMIT--MEGEIVKPNIYSPD 2187
            +VTW PP++  G    SG+ +         + I +S +     +++++NL   T+Y++ V S FGT        SF     S ++ G T   I  S+           +S      + I    L T  P  +YF+   N SF     S+   ++ S L  A  Y I +S     G +   +++VWT+P  F ++  L+    +    +++S  V FP+   Y+G  +N +Y ++ K    + + +  ++    +       + Q+ F +     E IVIG+G    P + P            ND L S T Y +Y V  S V+  +E     +    + +VT   SLS          + + + +L+ ++  LL          +NG      ++  K PY              + + PKS  +WS  +D  + R +I+D        L G         TF  E+ S+P    Y H A EM          S L + H     K SP   +  + +AS +DGY+R+ +YI+ Q+P D  +  DFWL+V+  NV QIVM+T  +E   +K   Y PD
Sbjct:  452 LVTWLPPDTNNGNGILSGFEVQHWPINLTVNRIASSPIPPDQTSYSISNLQAETAYSVQVFSIFGTRRVASKIVSFETLPLSVARSGITLQLIDRSSSTIRIACGVQGVSLSPGQQFVISVSRLQTLLPIVSYFR-DKNISFL---NSQPMIHSFSQLPAASQYQISLSTVDPNGSDKLATLIVWTKPETFAASSNLEFGEFTWEAESSHSVTVKFPTIMGYSGGPLNGFYVVVTKIPRLTGEHKIENLKGKSSAFISRDSSTQVAFYSRDMPAEPIVIGNGK---PVASPGRPSVLSGYRLSNDPLESNTTYGIYAVTESYVDDVSEDVVSGFLVLHTELVTKAFSLSKRVNKVDKTVLGVSLSILLFMLAVLLLGTVTYCVCSRNGLGARGSYLTSKSPYAQTSARTNTLVDEYDRLLPKSYPWWSVPVDVREPRYLIIDPEKGPSSTLVGTWSKKELSDTFVREYASIPLGLKYPHKAGEMRANKPKNRIQSVLPYDHNRVALKRSPDSGDSDYINASFVDGYMRRRAYIASQSPFDTPTACDFWLMVFQRNVSQIVMLTNLVEDGTLKCCQYWPD 1023          
BLAST of Protein-tyrosine phosphatase vs. TrEMBL
Match: G7YEM9 (Receptor-type tyrosine-protein phosphatase kappa (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_106073 PE=4 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 7.252e-16
Identity = 110/412 (26.70%), Postives = 179/412 (43.45%), Query Frame = 1
Query: 1162 YTIKVSAFYYGGQEVGNSILVWTRPYKFVSTMPLQ----SITGLTANSFGVTFPSYPNYNGS-INQYYFLLQKTSETS--RQKRDILSCQAVIPGIPGTAQIRFANSTYNKESIVIGSG---------TLYPPFSCPNDKLVSQTNYTLYTVIGSMVNGTTE---------------YTFTSSTIVTLNDSLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNGNDFIGIKGPY--------------EDVKPKSSAYWSSIIDKMQSRKIILDK----NNILEGL--------TFKDEFDSLPPHPCYEHNALEM----------STLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRK-SYISLQNPVDNKSLSDFWLLVYNENVDQIVMIT--MEGEIVKPNIYSPD 2187
            Y I +S     G +   ++ VWT+P  F ++  L+    +    +++S  V FP+   Y+G  +N +Y +L K    +   Q  ++    +       + Q+ F +     + IVIG+G         ++   +   ND L S T Y +Y V  S V+  +E                 F+SS  V   D    G    I++ +L  ++L  +      R  K G+ ++  K PY              + + PKS A+WS  +D  + R +I+D     ++ L G         TF  E+ S+P    Y H A EM          S L + H     K SP   +  + +AS +DGY+R+ +YI+ Q+P D  +  DFWL+V+  NV QIVM+T  +E   +K   Y PD
Sbjct:  426 YQISLSIVDPNGLDKLATLTVWTKPETFAASSNLEFGEFTWEAESSHSVTVKFPTVLGYSGGPLNGFYVVLTKIPRLTVGHQVENLKGKSSTFISRDSSTQVAFYSRDMPAKPIVIGTGKPVASPGRPSVLSGYRLSNDPLESNTTYGIYAVTESYVDDVSEDVVSGFLVLHTELVTKAFSSSKRVNKVDKTVLGVSLSILLFMLAVLLLGTVTYCVCSRNGKRGS-YLTSKSPYAQTSARTNTIADEYDRLLPKSYAWWSVPVDVREPRYLIIDPEKGPSSTLVGTWSKKELSDTFVREYASIPLGLKYPHKAGEMRANKPKNRIQSVLPYDHNRVALKRSPDSGDSDYINASFVDGYMRRRAYIASQSPFDTPTACDFWLMVFQRNVSQIVMLTNLVEDGALKCCQYWPD 836          
BLAST of Protein-tyrosine phosphatase vs. TrEMBL
Match: A0A074ZE16 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_07038 PE=4 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.783e-12
Identity = 57/164 (34.76%), Postives = 84/164 (51.22%), Query Frame = 1
Query: 1771 YEDVKPKSSAYWSSIIDKMQSRKIILDK----NNILEGL--------TFKDEFDSLPPHPCYEHNALEM----------STLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRK-SYISLQNPVDNKSLSDFWLLVYNENVDQIVMIT--MEGEIVKPNIYSPD 2187
            Y+ + PKS A+WS  +D  + R +I+D     ++ L G         TF  E+ S+P    Y H A EM          S L + H     K SP   +  + +AS +DGY+R+ +YI+ Q+P D  +  DFWL+V+  NV QIVM+T  +E   +K   Y PD
Sbjct:  749 YDRLLPKSYAWWSVPVDVREPRYLIIDPEKGPSSTLVGTWSKKELSDTFVREYASIPLGLKYPHKAGEMRANKPKNRIQSVLPYDHNRVALKRSPDSGDSDYINASFVDGYMRRRAYIASQSPFDTPTACDFWLMVFQRNVSQIVMLTNLVEDGTLKCCQYWPD 912          
BLAST of Protein-tyrosine phosphatase vs. TrEMBL
Match: A0A1S8X3N0 (Protein-tyrosine phosphatase OS=Opisthorchis viverrini OX=6198 GN=X801_02802 PE=4 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 1.326e-11
Identity = 57/164 (34.76%), Postives = 84/164 (51.22%), Query Frame = 1
Query: 1771 YEDVKPKSSAYWSSIIDKMQSRKIILDK----NNILEGL--------TFKDEFDSLPPHPCYEHNALEM----------STLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRK-SYISLQNPVDNKSLSDFWLLVYNENVDQIVMIT--MEGEIVKPNIYSPD 2187
            Y+ + PKS A+WS  +D  + R +I+D     ++ L G         TF  E+ S+P    Y H A EM          S L + H     K SP   +  + +AS +DGY+R+ +YI+ Q+P D  +  DFWL+V+  NV QIVM+T  +E   +K   Y PD
Sbjct:  263 YDRLLPKSYAWWSVPVDVREPRYLIIDPEKGPSSTLVGTWSKKELSDTFVREYASIPLGLKYPHKAGEMRANKPKNRIQSVLPYDHNRVALKRSPDSGDSDYINASFVDGYMRRRAYIASQSPFDTPTACDFWLMVFQRNVSQIVMLTNLVEDGTLKCCQYWPD 426          
BLAST of Protein-tyrosine phosphatase vs. Ensembl Cavefish
Match: ENSAMXT00000042113.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:17434140:17476287:-1 gene:ENSAMXG00000021796.2 transcript:ENSAMXT00000042113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.447 bits (119), Expect = 8.687e-6
Identity = 34/101 (33.66%), Postives = 59/101 (58.42%), Query Frame = 1
Query: 1867 EGLTFKDEFDSLPP--HPCYEHNALEMSTLNHSHE----YDGDKVSPYKLECSHY-HASVIDGYLRK-SYISLQNPVDNKSLSDFWLLVYNENVDQIVMIT 2145
            E L F  E++S+ P     +EH+ LE++   + +     YD  +V     + S Y +A+ IDGY R+ +YI+ Q P+  +++SDFW +V+ ++   I+MIT
Sbjct:  933 ENLRFSQEYESIDPGQQFSWEHSNLEINKPKNRYANVIAYDHTRVVLSNNDGSDYINANFIDGYRRQGAYIATQGPMP-ETISDFWRMVWEQHTANIIMIT 1032          
BLAST of Protein-tyrosine phosphatase vs. Ensembl Medaka
Match: ptpe (protein tyrosine phosphatase e [Source:NCBI gene;Acc:100125807])

HSP 1 Score: 51.6026 bits (122), Expect = 2.997e-6
Identity = 37/108 (34.26%), Postives = 60/108 (55.56%), Query Frame = 1
Query: 1867 EGLTFKDEFDSLPPHPCY-EHNALEMSTLNHSHE---------YDGDKVSPYKLE---CSHY-HASVIDGYLRKS-YISLQNPVDNKSLSDFWLLVYNENVDQIVMIT 2145
            +G  F++EF+SLP   CY  H + E ++  ++ E         YD  +V    L+   CS Y +AS IDG+  K+ +I+ Q P   ++L+DFW +V+ +    IVM+T
Sbjct:  115 DGKLFREEFNSLP---CYFRHGSFEEASREYNREKNRYPNILPYDHSRVVLSHLDGHLCSDYINASYIDGFKEKNKFIAAQGP-KPETLADFWRMVWEQKTTTIVMLT 218          
BLAST of Protein-tyrosine phosphatase vs. Ensembl Medaka
Match: ptpe (protein tyrosine phosphatase e [Source:NCBI gene;Acc:100125807])

HSP 1 Score: 51.2174 bits (121), Expect = 3.330e-6
Identity = 37/108 (34.26%), Postives = 60/108 (55.56%), Query Frame = 1
Query: 1867 EGLTFKDEFDSLPPHPCY-EHNALEMSTLNHSHE---------YDGDKVSPYKLE---CSHY-HASVIDGYLRKS-YISLQNPVDNKSLSDFWLLVYNENVDQIVMIT 2145
            +G  F++EF+SLP   CY  H + E ++  ++ E         YD  +V    L+   CS Y +AS IDG+  K+ +I+ Q P   ++L+DFW +V+ +    IVM+T
Sbjct:  115 DGKLFREEFNSLP---CYFRHGSFEEASREYNREKNRYPNILPYDHSRVVLSHLDGHLCSDYINASYIDGFKEKNKFIAAQGP-KPETLADFWRMVWEQKTTTIVMLT 218          
BLAST of Protein-tyrosine phosphatase vs. Planmine SMEST
Match: SMESG000028975.1 (SMESG000028975.1)

HSP 1 Score: 1308.12 bits (3384), Expect = 0.000e+0
Identity = 694/706 (98.30%), Postives = 696/706 (98.58%), Query Frame = 1
Query:   73 MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCIQYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDINPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAYFRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIPXXXXXXXXXXXXXXXXXXXXXXXAIQSNLTVQRMSSTANFTFIVVTWNPPNSMFGFSGYTIFLNSAIKASSLDSSFNTFNLTNLTEGTSYNITVTSYFGTSFYSASQIGTTFSSIPPSNLSWEKSYTYGIIYWNLTATPPPNYFKISVNDSFQFQSGSETRFYNISSLTEAQSYTIKVSAFYYGGQEVGNSILVWTRPYKFVSTMPLQSITGLTANSFGVTFPSYPNYNGSINQYYFLLQKTSETSRQKRDILSCQAVIPGIPGTAQIRFANSTYNKESIVIGSGTLYPPFSCPNDKLVSQTNYTLYTVIGSMVNGTTEYTFTSSTIVTLNDSLSPXXXXXXXXXXXXXXXXXXXXXXXXXXXXKNGNDFIGIKGPYEDVKPKSSAYWSSIIDKMQSRKIILDKNNILEGLTFKDEFDSLPPHPCYEHNALEMSTLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRKSYISLQNPVDNKSLSDFWLLVYNENVDQIVMITMEGEIVKPNIYSPDT 2190
            MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCIQYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDINPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAYFRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIPTSTTTTTT TT T  T  T T  AIQSN TVQRMSSTANFTFIVVTWNPPNSMFGFSGYTIFLNSAIKASSLDSSFNTFNLTNLTEGTSYNITVTSYFGTSFYSASQIGTTFSSIPPSNLSWEKSYTYGIIYWNLTATPPPNYFKISVNDSFQFQSGSETRFYNISSLTEAQSYTIKVSAFYYGGQEVGNSILVWTRPYKFVSTMPLQSITGLTANSFGVTFPSYPNYNGSINQYYFLLQKTSETSRQKRDILSCQAVIPGIPGTAQIRFANSTYNKESIVIGSGTLYPPFSCPNDKLVSQTNYTLYTVIGSMVNGTTEYTFTSST+VTLNDSLSPGAIAGIVIAVLLFIILLVLLVYFLLRYRKNGNDFIGIKGPYED+KPKSSAYWSSIIDKMQSRKIILDKNNILEGLTFKDEFDSLPPHPCYEHNALEMSTLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRKSYISLQNPVDNKSLSDFWLLVYNENVDQIVMITMEGEIVKPNIYSPDT
Sbjct:    1 MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCIQYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDINPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAYFRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIPTSTTTTTTTTTPTTITTKTTT--AIQSNFTVQRMSSTANFTFIVVTWNPPNSMFGFSGYTIFLNSAIKASSLDSSFNTFNLTNLTEGTSYNITVTSYFGTSFYSASQIGTTFSSIPPSNLSWEKSYTYGIIYWNLTATPPPNYFKISVNDSFQFQSGSETRFYNISSLTEAQSYTIKVSAFYYGGQEVGNSILVWTRPYKFVSTMPLQSITGLTANSFGVTFPSYPNYNGSINQYYFLLQKTSETSRQKRDILSCQAVIPGIPGTAQIRFANSTYNKESIVIGSGTLYPPFSCPNDKLVSQTNYTLYTVIGSMVNGTTEYTFTSSTMVTLNDSLSPGAIAGIVIAVLLFIILLVLLVYFLLRYRKNGNDFIGIKGPYEDIKPKSSAYWSSIIDKMQSRKIILDKNNILEGLTFKDEFDSLPPHPCYEHNALEMSTLNHSHEYDGDKVSPYKLECSHYHASVIDGYLRKSYISLQNPVDNKSLSDFWLLVYNENVDQIVMITMEGEIVKPNIYSPDT 704          
BLAST of Protein-tyrosine phosphatase vs. Planmine SMEST
Match: SMESG000028975.1 (SMESG000028975.1)

HSP 1 Score: 389.423 bits (999), Expect = 2.611e-131
Identity = 190/190 (100.00%), Postives = 190/190 (100.00%), Query Frame = 1
Query:   73 MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCIQYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDINPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAYFRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIP 642
            MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCIQYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDINPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAYFRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIP
Sbjct:    1 MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCIQYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDINPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAYFRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIP 190          
The following BLAST results are available for this feature:
BLAST of Protein-tyrosine phosphatase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7F0571.778e-1926.50Receptor-type tyrosine-protein phosphatase mu (Fra... [more]
A0A4S2JLW94.837e-1925.56Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YEM97.252e-1626.70Receptor-type tyrosine-protein phosphatase kappa (... [more]
A0A074ZE168.783e-1234.76Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A1S8X3N01.326e-1134.76Protein-tyrosine phosphatase OS=Opisthorchis viver... [more]
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSAMXT00000042113.18.687e-633.66pep primary_assembly:Astyanax_mexicanus-2.0:21:174... [more]
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein-tyrosine phosphatase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ptpe2.997e-634.26protein tyrosine phosphatase e [Source:NCBI gene;A... [more]
ptpe3.330e-634.26protein tyrosine phosphatase e [Source:NCBI gene;A... [more]
back to top
BLAST of Protein-tyrosine phosphatase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000028975.10.000e+098.30SMESG000028975.1[more]
SMESG000028975.12.611e-131100.00SMESG000028975.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025854 ID=SMED30025854|Name=Protein-tyrosine phosphatase|organism=Schmidtea mediterranea sexual|type=transcript|length=2241bp
CACTTGTTTAAATCATTTGATATATTAGCAACCGTTTAGTAGTTTTGTAT
GATTCGAAATTAAAATCCTGAGATGCTATTTTTTCTATACTTATTTTTTA
CCAGTTTTTGCTTAATTTCAACACAAACAAATCAAACTTGTCCCAATTGT
TTGAGTGGATGTGACGAAAGTGGGTCTTGTTGGAATTCTACCTGTAAATT
ATGCCCTGATTCCACATGCATACAGTATTATGGAAATAATTGCAATAAAA
TAGCCCCACTAGCATTAAGCACGATATCAATGTCATTTACCAACAATCTT
ACATCAGATGGATTTTGCACAGCACTTATTTCGATACCTCCATTTAATAC
AACTCCAAATTTTCCAGACATTAATCCTTTAAATTATTACCTGCTTAATG
AATCTAGTGGAACATTTAATAATTCTGATATTAAAATAAATTATTTAACT
CAAATCCCGATGATTCTAAACAACAACAATAAAAATTATGAATACTTAAC
TCGGTTTAATCAAGCTGCTTATTTTCGATTTGCAATTTATTTCACATTTG
AAGACATCAAAGTTTACGGAAACTTCAATAGTTCAATTTCCAACAGTTTC
AAAACTTTTCTCAGCCCGTCAAATTGTTCGGGTGTAATACCAACCAGTAC
AACGACAACAACAACAAGAACAACAACAACACCAACAACAATAACAACAA
AAACAACAACAGCAATTCAATCAAATTTAACAGTCCAAAGGATGAGTTCT
ACAGCAAATTTCACTTTTATTGTAGTAACTTGGAATCCACCAAATTCAAT
GTTTGGGTTTTCGGGTTACACAATATTTTTGAATTCAGCAATCAAAGCTT
CATCTTTGGATTCTTCGTTTAACACCTTTAACTTAACAAATCTTACTGAA
GGCACTTCATATAATATTACAGTTACATCATATTTTGGGACCAGTTTCTA
TTCAGCATCTCAAATCGGAACCACATTCAGTTCAATTCCGCCTTCTAATC
TTAGTTGGGAAAAATCGTATACCTATGGAATTATTTATTGGAATTTGACA
GCTACTCCTCCCCCTAATTATTTTAAGATTTCTGTAAATGATAGTTTTCA
ATTCCAATCTGGTTCTGAAACTCGATTTTATAATATCTCTTCGTTGACTG
AAGCTCAATCATATACAATCAAAGTGTCAGCATTTTACTATGGTGGACAG
GAAGTCGGTAATAGTATATTGGTCTGGACAAGACCATATAAGTTCGTTTC
TACAATGCCTCTTCAGTCTATTACTGGACTTACAGCTAATTCATTTGGTG
TTACTTTTCCATCTTATCCAAATTATAATGGAAGTATAAATCAATATTAT
TTTCTTCTTCAGAAGACATCAGAGACTTCTCGACAGAAAAGAGATATATT
AAGTTGCCAAGCGGTGATACCTGGAATTCCTGGTACAGCCCAAATTCGTT
TTGCAAACAGTACTTATAATAAGGAATCTATTGTCATTGGCTCAGGAACT
CTGTATCCTCCATTTTCATGCCCTAATGACAAACTGGTTAGCCAGACAAA
TTACACTCTTTATACAGTAATTGGCAGCATGGTAAATGGCACTACTGAAT
ACACATTTACCAGTAGTACAATTGTCACTTTAAATGACTCCTTGTCGCCG
GGAGCAATCGCAGGAATCGTAATCGCAGTTCTATTGTTTATAATTTTGCT
TGTTTTACTTGTTTATTTCCTTTTGAGATACAGAAAGAACGGAAATGATT
TCATCGGAATCAAGGGTCCATATGAAGATGTAAAACCAAAAAGTAGTGCC
TATTGGAGTAGCATTATTGATAAAATGCAATCAAGAAAGATCATATTAGA
CAAAAATAACATTTTGGAAGGGTTGACCTTCAAAGATGAATTCGATAGCT
TACCCCCTCATCCGTGCTATGAGCACAACGCACTCGAAATGAGCACATTG
AATCATAGTCATGAATATGATGGCGATAAGGTCTCACCTTATAAACTGGA
ATGTTCCCATTATCACGCTAGCGTTATTGATGGTTATTTGAGAAAATCAT
ATATATCCCTACAAAACCCCGTTGATAACAAATCCCTGTCTGATTTTTGG
TTATTAGTCTATAATGAGAACGTCGATCAAATTGTAATGATAACTATGGA
AGGAGAAATAGTGAAACCGAATATTTACTCACCGGATACAGTGATTTTTA
TTTTTCTCTTTTACTTTTTATTTTGTTGAATACCAATAGCC
back to top

protein sequence of SMED30025854-orf-1

>SMED30025854-orf-1 ID=SMED30025854-orf-1|Name=SMED30025854-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=719bp
MLFFLYLFFTSFCLISTQTNQTCPNCLSGCDESGSCWNSTCKLCPDSTCI
QYYGNNCNKIAPLALSTISMSFTNNLTSDGFCTALISIPPFNTTPNFPDI
NPLNYYLLNESSGTFNNSDIKINYLTQIPMILNNNNKNYEYLTRFNQAAY
FRFAIYFTFEDIKVYGNFNSSISNSFKTFLSPSNCSGVIPTSTTTTTTRT
TTTPTTITTKTTTAIQSNLTVQRMSSTANFTFIVVTWNPPNSMFGFSGYT
IFLNSAIKASSLDSSFNTFNLTNLTEGTSYNITVTSYFGTSFYSASQIGT
TFSSIPPSNLSWEKSYTYGIIYWNLTATPPPNYFKISVNDSFQFQSGSET
RFYNISSLTEAQSYTIKVSAFYYGGQEVGNSILVWTRPYKFVSTMPLQSI
TGLTANSFGVTFPSYPNYNGSINQYYFLLQKTSETSRQKRDILSCQAVIP
GIPGTAQIRFANSTYNKESIVIGSGTLYPPFSCPNDKLVSQTNYTLYTVI
GSMVNGTTEYTFTSSTIVTLNDSLSPGAIAGIVIAVLLFIILLVLLVYFL
LRYRKNGNDFIGIKGPYEDVKPKSSAYWSSIIDKMQSRKIILDKNNILEG
LTFKDEFDSLPPHPCYEHNALEMSTLNHSHEYDGDKVSPYKLECSHYHAS
VIDGYLRKSYISLQNPVDNKSLSDFWLLVYNENVDQIVMITMEGEIVKPN
IYSPDTVIFIFLFYFLFC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036116FN3_sf
IPR003961FN3_dom
IPR000242PTPase_domain
IPR013783Ig-like_fold
IPR029021Prot-tyrosine_phosphatase-like
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004725protein tyrosine phosphatase activity
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
GO:0016791phosphatase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
GO:0016311dephosphorylation
GO:0035335peptidyl-tyrosine dephosphorylation
GO:0060027convergent extension involved in gastrulation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 302..375
e-value: 7.8
score: 12.4
coord: 210..289
e-value: 0.0065
score: 25.7
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 213..306
score: 11.046
IPR003961Fibronectin type IIICDDcd00063FN3coord: 215..299
e-value: 7.28424E-7
score: 45.9503
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 215..303
e-value: 1.2E-7
score: 33.8
IPR000242PTP type protein phosphatasePFAMPF00102Y_phosphatasecoord: 612..696
e-value: 2.9E-9
score: 36.8
IPR000242PTP type protein phosphatasePROSITEPS50055TYR_PHOSPHATASE_PTPcoord: 602..703
score: 11.266
IPR029021Protein-tyrosine phosphatase-likeGENE3DG3DSA:3.90.190.10coord: 600..706
e-value: 2.6E-10
score: 42.0
IPR029021Protein-tyrosine phosphatase-likeSUPERFAMILYSSF52799(Phosphotyrosine protein) phosphatases IIcoord: 608..704
NoneNo IPR availableCDDcd14543PTPc-N9coord: 612..702
e-value: 9.59559E-10
score: 58.1446
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.764
NoneNo IPR availableTMHMMTMhelixcoord: 527..549
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 225..376