Centrosome and spindle pole-associated protein 1

Overview
NameCentrosome and spindle pole-associated protein 1
Smed IDSMED30025849
Length (bp)3319
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Centrosome and spindle pole-associated protein 1 (SMED30025849) t-SNE clustered cells

Violin plots show distribution of expression levels for Centrosome and spindle pole-associated protein 1 (SMED30025849) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Centrosome and spindle pole-associated protein 1 (SMED30025849) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Centrosome and spindle pole-associated protein 1 (SMED30025849) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025849

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025849SMESG000080361.1 SmedASXL_014850SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025849SMESG000080361.1 dd_Smed_v4_13453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025849SMESG000080361.1 dd_Smed_v4_13453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025849SMESG000080361.1 dd_Smed_v4_13453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30025849SMESG000080361.1 dd_Smed_v4_13453_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025849SMESG000080361.1 dd_Smed_v6_13453_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025849SMESG000080361.1 OX_Smed_1.0.09919ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30025849SMESG000080361.1 Contig37573newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025849SMESG000080361.1 Contig37573uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30025849SMESG000080361.1 dd_Smed_v4_13453_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Human
Match: CSPP1 (centrosome and spindle pole associated protein 1 [Source:HGNC Symbol;Acc:HGNC:26193])

HSP 1 Score: 60.4622 bits (145), Expect = 2.007e-8
Identity = 51/172 (29.65%), Postives = 87/172 (50.58%), Query Frame = 1
Query: 1498 PDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPE-------KSIISPDPN------------------ELKT----YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            P  +K    +Y E L++QI ER+ R++ +++ +EEYE +   E+R Y+P+G+GGGGAPL+D +G +I DL  +             R  ++ Y  P+       ++++S DPN                   ++T    +ARG   +FG+  ++    + E YK  L+ QIE
Sbjct:  587 PKPSKQSLQSYQEALQQQIREREERRKKEREEKEEYEAKLEAEMRTYNPWGKGGGGAPLRDAKGNLITDLNRM------------HRQNIDAYHNPDARTYEDKRAVVSLDPNLATSNAENLEDAANKSSGHMQTQSSPFARG--NVFGEPPTELQIKQQELYKNFLRFQIE 744          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Human
Match: CSPP1 (centrosome and spindle pole associated protein 1 [Source:HGNC Symbol;Acc:HGNC:26193])

HSP 1 Score: 54.6842 bits (130), Expect = 9.677e-7
Identity = 42/146 (28.77%), Postives = 75/146 (51.37%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDSNP--YVPSSFNINDQRNINEP---NINQP------KTSIRISHEPDTNKNLKV------------NYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKN 1713
            D  Y++Y SRN    FD +   Y      +     ++ P    + QP      +  ++I+ +   N  L              +Y E L++QI ER+ R++ +++ +EEYE +   E+R Y+P+G+GGGGAPL+D +G +I+ ++ 
Sbjct:  222 DDAYYFYGSRN---TFDPSLAYYGSGMMGVQPAAYVSAPVTHQLAQPVVNTVGQNELKITSDQVINSGLIFEDKPKPSKQSLQSYQEALQQQIREREERRKKEREEKEEYEAKLEAEMRTYNPWGKGGGGAPLRDAKGNLISHMQT 364          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Zebrafish
Match: cspp1b (centrosome and spindle pole associated protein 1b [Source:ZFIN;Acc:ZDB-GENE-070912-619])

HSP 1 Score: 77.7962 bits (190), Expect = 4.292e-14
Identity = 43/136 (31.62%), Postives = 72/136 (52.94%), Query Frame = 1
Query: 1519 KVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            ++ Y EEL+KQIEER  ++  D++ +   E     ++R Y+P+GRGG GAP++D+ G +IADLK +   +         RP +     P+             +ARG   +F Q +S    ++ ++YK  L+ Q+E
Sbjct:  209 RLGYKEELRKQIEERAAQRRADREEKRRLEVELEADMRAYEPWGRGGAGAPIRDSTGNLIADLKQMHLLNAAATVQRPERPSMIETHTPQ-------------FARG--NVFNQMISPQQVLEQDQYKACLRQQME 329          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Zebrafish
Match: cspp1a (centrosome and spindle pole associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-120709-73])

HSP 1 Score: 60.4622 bits (145), Expect = 1.135e-8
Identity = 67/220 (30.45%), Postives = 105/220 (47.73%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDS--NPYVPSSFNINDQRNINEPNINQPKTSIR--ISHE---------PDTNKNLKVN---YAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI------KFDS--KIVIPPLSFR--PQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            D+ Y+YY +RNPL+   +   P V    +I  +   + P +  P   +   ISH           D ++  K N   Y E L++QI+ER+ R+  +K  +E ++ +   E++ Y+P+GR GGGAPL+D+ G +I+DLK +       +DS  +    PLS R  P   Y  +P              + RG   +F    +       EKYK+ LK QIE
Sbjct:  403 DNAYYYYGARNPLDPNLAYYGPVVGQQSHIPPE--AHWPVLQPPSGGLAQPISHAGVVSSGPVISDRSQQPKENAASYQEALRQQIQERQQRRHREKVEKELFDAKIEAEMKAYEPWGRAGGGAPLRDHHGNLISDLKQMHKTNVEAYDSGGRPARIPLSSRTEPAGLYVSQP------------TVHTRG--NLFSDLPTPQQLHDQEKYKDCLKQQIE 606          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Zebrafish
Match: cspp1a (centrosome and spindle pole associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-120709-73])

HSP 1 Score: 60.4622 bits (145), Expect = 1.191e-8
Identity = 67/220 (30.45%), Postives = 105/220 (47.73%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDS--NPYVPSSFNINDQRNINEPNINQPKTSIR--ISHE---------PDTNKNLKVN---YAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI------KFDS--KIVIPPLSFR--PQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            D+ Y+YY +RNPL+   +   P V    +I  +   + P +  P   +   ISH           D ++  K N   Y E L++QI+ER+ R+  +K  +E ++ +   E++ Y+P+GR GGGAPL+D+ G +I+DLK +       +DS  +    PLS R  P   Y  +P              + RG   +F    +       EKYK+ LK QIE
Sbjct:  462 DNAYYYYGARNPLDPNLAYYGPVVGQQSHIPPE--AHWPVLQPPSGGLAQPISHAGVVSSGPVISDRSQQPKENAASYQEALRQQIQERQQRRHREKVEKELFDAKIEAEMKAYEPWGRAGGGAPLRDHHGNLISDLKQMHKTNVEAYDSGGRPARIPLSSRTEPAGLYVSQP------------TVHTRG--NLFSDLPTPQQLHDQEKYKDCLKQQIE 665          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Zebrafish
Match: cspp1a (centrosome and spindle pole associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-120709-73])

HSP 1 Score: 60.077 bits (144), Expect = 1.485e-8
Identity = 67/220 (30.45%), Postives = 105/220 (47.73%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDS--NPYVPSSFNINDQRNINEPNINQPKTSIR--ISHE---------PDTNKNLKVN---YAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI------KFDS--KIVIPPLSFR--PQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            D+ Y+YY +RNPL+   +   P V    +I  +   + P +  P   +   ISH           D ++  K N   Y E L++QI+ER+ R+  +K  +E ++ +   E++ Y+P+GR GGGAPL+D+ G +I+DLK +       +DS  +    PLS R  P   Y  +P              + RG   +F    +       EKYK+ LK QIE
Sbjct:  462 DNAYYYYGARNPLDPNLAYYGPVVGQQSHIPPE--AHWPVLQPPSGGLAQPISHAGVVSSGPVISDRSQQPKENAASYQEALRQQIQERQQRRHREKVEKELFDAKIEAEMKAYEPWGRAGGGAPLRDHHGNLISDLKQMHKTNVEAYDSGGRPARIPLSSRTEPAGLYVSQP------------TVHTRG--NLFSDLPTPQQLHDQEKYKDCLKQQIE 665          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Xenopus
Match: CSPP1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:779552])

HSP 1 Score: 77.7962 bits (190), Expect = 8.267e-14
Identity = 45/145 (31.03%), Postives = 78/145 (53.79%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNI----NQPKTSIRISHE-----------------PDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI 1716
            D  Y++Y +RNPL+   +  Y P +  +   + ++ P      NQ +    ++ +                 P  +K   ++Y EEL++QI E+  ++  +K+  E YE + + E+RNY+P+G+GGGGAPLKD +G +I DLK +
Sbjct:  564 DDAYYFYGARNPLDPSIAY-YPPGAVGLQPVQGVSIPVTQILQNQSEDQFYVNKQGAAGGRGTSLGFLPEEKPRQSKAAAMSYQEELERQILEKNEKRRKEKEEHERYEAKLDAEMRNYNPWGKGGGGAPLKDAKGNLITDLKKM 707          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Xenopus
Match: CSPP1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:779552])

HSP 1 Score: 77.7962 bits (190), Expect = 8.564e-14
Identity = 45/145 (31.03%), Postives = 78/145 (53.79%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNI----NQPKTSIRISHE-----------------PDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI 1716
            D  Y++Y +RNPL+   +  Y P +  +   + ++ P      NQ +    ++ +                 P  +K   ++Y EEL++QI E+  ++  +K+  E YE + + E+RNY+P+G+GGGGAPLKD +G +I DLK +
Sbjct:  569 DDAYYFYGARNPLDPSIAY-YPPGAVGLQPVQGVSIPVTQILQNQSEDQFYVNKQGAAGGRGTSLGFLPEEKPRQSKAAAMSYQEELERQILEKNEKRRKEKEEHERYEAKLDAEMRNYNPWGKGGGGAPLKDAKGNLITDLKKM 712          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Mouse
Match: Cspp1 (centrosome and spindle pole associated protein 1 [Source:MGI Symbol;Acc:MGI:2681832])

HSP 1 Score: 69.707 bits (169), Expect = 2.241e-11
Identity = 67/250 (26.80%), Postives = 116/250 (46.40%), Query Frame = 1
Query: 1333 VPHQDSDYFYYASRNPLEE----FDSN-------PYV---------PSSFNI---NDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPE-------KSIISPDPN------------------ELKT----YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
             P+ D+ Y++Y +RN L+     + S        P+V         P + N    N+Q+ +++   N   + +    +P  +     +Y E L++QI ER+ R++ ++  +EEYE +   E+R Y+P+G+GGGGAPL+D +G +I DL  +             R  ++ Y  P+       ++++S D N                   L+T    +ARG    FG+ LS+    + E YK  L+ QIE
Sbjct:  489 TPYDDA-YYFYGARNTLDPNIVYYGSGMIGGQPAPHVSAPVTHQVAPPAVNTVGQNEQKVLSDGLRN---SGLVFEDKPKPSTQSLQSYQEALQEQIREREARRKKERLEKEEYEAKLEAEMRIYNPWGKGGGGAPLRDAKGNLITDLNRM------------HRQNIDAYHNPDARTYEDKRAVVSIDQNLATSNAENLEDSANKNSGPLQTQSSPFARG--NTFGEPLSELQIKQQELYKNFLRFQIE 720          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Mouse
Match: Cspp1 (centrosome and spindle pole associated protein 1 [Source:MGI Symbol;Acc:MGI:2681832])

HSP 1 Score: 65.4698 bits (158), Expect = 3.626e-10
Identity = 58/220 (26.36%), Postives = 91/220 (41.36%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNINQPKT--------------------------SIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            D  Y++Y +RN L   D N     S  I  Q     P+++ P T                           +    +P  +     +Y E L++QI ER+ R++ ++  +EEYE +   E+R Y+P+G+GGGGAPL+D +G                                  ++ISP   +   +ARG    FG+ LS+    + E YK  L+ QIE
Sbjct:  488 DDAYYFYGARNTL---DPNIVYYGSGMIGGQ---PAPHVSAPVTHQVAPPAVNTVGQNEQKVLSDGLRNSGLVFEDKPKPSTQSLQSYQEALQEQIREREARRKKERLEKEEYEAKLEAEMRIYNPWGKGGGGAPLRDAKG----------------------------------NLISPLQTQSSPFARG--NTFGEPLSELQIKQQELYKNFLRFQIE 665          
BLAST of Centrosome and spindle pole-associated protein 1 vs. UniProt/SwissProt
Match: sp|B2RX88|CSPP1_MOUSE (Centrosome and spindle pole associated protein 1 OS=Mus musculus OX=10090 GN=Cspp1 PE=1 SV=2)

HSP 1 Score: 69.707 bits (169), Expect = 1.598e-10
Identity = 67/250 (26.80%), Postives = 116/250 (46.40%), Query Frame = 1
Query: 1333 VPHQDSDYFYYASRNPLEE----FDSN-------PYV---------PSSFNI---NDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPE-------KSIISPDPN------------------ELKT----YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
             P+ D+ Y++Y +RN L+     + S        P+V         P + N    N+Q+ +++   N   + +    +P  +     +Y E L++QI ER+ R++ ++  +EEYE +   E+R Y+P+G+GGGGAPL+D +G +I DL  +             R  ++ Y  P+       ++++S D N                   L+T    +ARG    FG+ LS+    + E YK  L+ QIE
Sbjct:  497 TPYDDA-YYFYGARNTLDPNIVYYGSGMIGGQPAPHVSAPVTHQVAPPAVNTVGQNEQKVLSDGLRN---SGLVFEDKPKPSTQSLQSYQEALQEQIREREARRKKERLEKEEYEAKLEAEMRIYNPWGKGGGGAPLRDAKGNLITDLNRM------------HRQNIDAYHNPDARTYEDKRAVVSIDQNLATSNAENLEDSANKNSGPLQTQSSPFARG--NTFGEPLSELQIKQQELYKNFLRFQIE 728          
BLAST of Centrosome and spindle pole-associated protein 1 vs. UniProt/SwissProt
Match: sp|Q1MSJ5|CSPP1_HUMAN (Centrosome and spindle pole-associated protein 1 OS=Homo sapiens OX=9606 GN=CSPP1 PE=1 SV=4)

HSP 1 Score: 60.077 bits (144), Expect = 1.200e-7
Identity = 65/250 (26.00%), Postives = 115/250 (46.00%), Query Frame = 1
Query: 1333 VPHQDSDYFYYASRNPLEEFDSNP--YVPSSFNINDQRNINEP---NINQP------KTSIRISHE------------PDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPE-------KSIISPDPN------------------ELKT----YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
             P+ D+ Y++Y SRN    FD +   Y      +     ++ P    + QP      +  ++I+ +            P  +K    +Y E L++QI ER+ R++ +++ +EEYE +   E+R Y+P+G+GGGGAPL+D +G +I DL  +             R  ++ Y  P+       ++++S DPN                   ++T    +ARG   +FG+  ++    + E YK  L+ QIE
Sbjct:  548 TPYDDA-YYFYGSRN---TFDPSLAYYGSGMMGVQPAAYVSAPVTHQLAQPVVNTVGQNELKITSDQVINSGLIFEDKPKPSKQSLQSYQEALQQQIREREERRKKEREEKEEYEAKLEAEMRTYNPWGKGGGGAPLRDAKGNLITDLNRM------------HRQNIDAYHNPDARTYEDKRAVVSLDPNLATSNAENLEDAANKSSGHMQTQSSPFARG--NVFGEPPTELQIKQQELYKNFLRFQIE 779          
BLAST of Centrosome and spindle pole-associated protein 1 vs. TrEMBL
Match: K1QHK8 (Centrosome and spindle pole-associated protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10005467 PE=4 SV=1)

HSP 1 Score: 120.168 bits (300), Expect = 1.310e-23
Identity = 59/146 (40.41%), Postives = 100/146 (68.49%), Query Frame = 1
Query: 1507 NKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFD---SKIVIPPLSFRPQVEYYKEPEKSIISPDPNELK-----TYARGGHGIFGQALSDDDKIKAEKYKEDLKVQ 1920
            ++N K +Y EEL +QI+E++ RK+ +K+ QE YE++ ++EIRNY+PFG+GGGGAPL+DN+G ++ADL+ +  D   ++         P+      P   +I+P P+++      T+ARGGHGIFGQ  ++ +K ++++YK++L+ Q
Sbjct:  672 SQNDKRSYQEELDRQIQEKRYRKQREKEEQERYEKKLDDEIRNYNPFGKGGGGAPLRDNQGNIVADLRAMHQDPETARSTARATHESPRFRAPSSPRDDLIAPPPDQIDASGDVTHARGGHGIFGQPKTEQEKTQSDRYKDELRRQ 817          
BLAST of Centrosome and spindle pole-associated protein 1 vs. TrEMBL
Match: A0A433TIH0 (Uncharacterized protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_010885 PE=4 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 1.675e-23
Identity = 120/369 (32.52%), Postives = 195/369 (52.85%), Query Frame = 1
Query: 1528 YAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDS----------KIVIPPLSFRPQVEY----------------YKEPEKSIISPDPNEL-----KTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIELNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHIQKLEEHRLAAQENRKTKERLEYKAEEPKSSSPNQFRIRENS---IAKSPIVARNRTSLENKPKTPTEIKINPTPLAKNHDNEEMTNNFYSLKAKLGHEMALLEKEIAHQNDGVEIYDPRLEASRHLDKQIHSIGYESDMVFDAVLQKKGPLSVRR 2532
            Y EEL++Q+ E+ ++KE DK+ +E YER+  EE R YDPFG+GGGGAP++D  G VI+DL+ ++ D+          +   PP S+ P+++                 Y++    +I P P +       ++ARGGHGIFG   ++ +K +A++YK +LK QIE  K  +  +KE +R+ EE+E+   ++++  +Q E E E+   + KE E  +K EE   AA+E +   ER   +A++ +     + R RE      A SP V   RT    K  TP +      P      + ++ N   +++A+L +E   ++  +  Q D VEIYDPR +  R     I +   E D VF+  +  + P++VRR
Sbjct:  445 YREELERQMVEKNMKKERDKQEKERYERKMEEEARTYDPFGKGGGGAPMRDQHGNVISDLRQMRSDNLNRGNDEYTPRFQPPPASYSPELQLSARGGIGGNATRAANSYRD---DLIGPPPVQTTAEGETSHARGGHGIFGMPKTEAEKTQADRYKSELKKQIEEKKMEELRKKELQRQEEEREQRILDEQRAKMQQEYEMEQAKMKAKEEEARKKNEEMMKAAEEKKLELERKRREADDERQRQLREDRDREQQERHRAVSPPVPATRT----KTVTPDQGSRLANPSYDRPPSSDVLNQLANMRAQLQNERRRVQTMLDDQQDEVEIYDPR-QVQRPPPGPIINSRPEID-VFETAM-TRNPVAVRR 803          
BLAST of Centrosome and spindle pole-associated protein 1 vs. TrEMBL
Match: A0A0B6ZQS8 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF76141 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 1.180e-20
Identity = 76/244 (31.15%), Postives = 122/244 (50.00%), Query Frame = 1
Query: 1345 DSDYFYYASRNPLEEFDSNPYVPSSFNINDQR---NINEPNIN--------------------QPKTSIRISHEPDTNKNLKVN-------YAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDS---------------KIVIPPLSFRPQVEYYKEPEKSIISPDPNELK-----TYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            D  Y +YAS NPL+++ S+  VPS           ++  P+++                    +P+ +  +     +N+  K N       Y EEL++Q+ E+  +K  DKK+QE YE++  EE +NYDPFG+GGGGAP++D  G VI DL+ ++ D+                +     + R    Y  +    +I P P +       ++ARGGHGIFG   +D +K++A+KYK +LK Q+E
Sbjct:   81 DEAYNFYASHNPLDQYISD--VPSGVGRGGTELGGDVPVPSLDLSRVARDGGPASRVHFRDASRPQEAPAVGMTFASNEERKQNQRQQQSAYREELERQMYEKNAKKVQDKKAQERYEQKMEEEAKNYDPFGKGGGGAPMRDQYGNVITDLRQMRHDNLNRDNKFTPRGYEGESVGHAGNTTRAAASYSDD----LIGPPPAQTTADGETSFARGGHGIFGMPKTDAEKMQADKYKIELKRQME 318          
BLAST of Centrosome and spindle pole-associated protein 1 vs. TrEMBL
Match: R7TLU2 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_225871 PE=4 SV=1)

HSP 1 Score: 106.686 bits (265), Expect = 2.268e-19
Identity = 79/225 (35.11%), Postives = 113/225 (50.22%), Query Frame = 1
Query: 1342 QDSDYFYYASRNPLEEFDS----------NPYVP-------SSFNINDQRNINEPNINQPKTSIRISHEPDTN------KNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI--KFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPN-----ELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            QD  Y YY   NPL+              N Y P       S    +DQR         P+ S+   + P  N       + K  Y +ELK+Q+EE K +KE +K  +E YE + ++EIR+Y+PFGRGGGGAP++DN+G ++ DL+ I    +   V P     P++     P  S+   D       E  ++ RGGHGIFG+ L+D  K    KY+++LK QIE
Sbjct:  752 QDEAYHYYGLHNPLDAGAPPLNDVPRQPLNNYSPPPQQAQNSRVTFSDQR---------PERSVAQGYPPGNNYPSGNKGDTKAEYQQELKRQMEESKRKKEQEKLEKERYEAKLDQEIRDYNPFGRGGGGAPMRDNQGNIVTDLRTIHNTNEQTAVYPETRPSPRM-----PPTSVNFQDAEQRGKPEDDSHTRGGHGIFGEGLTDGQKTTQAKYQDELKRQIE 962          
BLAST of Centrosome and spindle pole-associated protein 1 vs. TrEMBL
Match: V3ZZM8 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_234696 PE=4 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 2.239e-18
Identity = 58/139 (41.73%), Postives = 89/139 (64.03%), Query Frame = 1
Query: 1537 ELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADL--KNIKFDSKI--VIPPLSFRPQVEYYKEPEKSIISPDPNEL-----KTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            EL++Q+EE+K+++ I K+ +E YE++  ++IRNY+PFGRGG GAP+KD  G V+ADL  KN  +  +   +  P    P+      P+  +I   P +       TYARGGHGIFG   ++ +K +A++YKE+LK QI+
Sbjct:  648 ELERQMEEKKLKQAIAKEEKERYEQKLEDDIRNYNPFGRGGAGAPMKDEYGNVVADLRAKNKGYSPRYEPMSSPTRGGPRP---ASPKDDLIKTPPAQTTAEGESTYARGGHGIFGHPKTEAEKSQADRYKEELKRQID 783          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Cavefish
Match: cspp1a (centrosome and spindle pole associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-120709-73])

HSP 1 Score: 56.225 bits (134), Expect = 2.148e-7
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 1
Query: 1522 VNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI-KFDSKIVIPP-----LSFRPQVEYYKEPEK-------------SIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            ++Y E LK QI ER+  ++ +++ +E  + +   E++ Y+P+G+ GGGAPL+D+RG +I+DLK + + + +  I P         P V     P               SI  P P     YARG   +F    +     + EKYKE LK QIE
Sbjct:  604 LSYKEALKLQIVERQEMRQREREERERSDAKLKAEMKAYEPWGKAGGGAPLRDDRGNLISDLKRMHRTNEEAYINPEPRGRRVMEPMVHVGISPTDKDKDSSTHIVSGFSITQPSP-----YARG--NVFSDLPTPQQIHEQEKYKESLKQQIE 750          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Cavefish
Match: cspp1a (centrosome and spindle pole associated protein 1a [Source:ZFIN;Acc:ZDB-GENE-120709-73])

HSP 1 Score: 55.8398 bits (133), Expect = 2.414e-7
Identity = 50/154 (32.47%), Postives = 77/154 (50.00%), Query Frame = 1
Query: 1522 VNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI-KFDSKIVIPP-----LSFRPQVEYYKEPEK-------------SIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
            ++Y E LK QI ER+  ++ +++ +E  + +   E++ Y+P+G+ GGGAPL+D+RG +I+DLK + + + +  I P         P V     P               SI  P P     YARG   +F    +     + EKYKE LK QIE
Sbjct:  598 LSYKEALKLQIVERQEMRQREREERERSDAKLKAEMKAYEPWGKAGGGAPLRDDRGNLISDLKRMHRTNEEAYINPEPRGRRVMEPMVHVGISPTDKDKDSSTHIVSGFSITQPSP-----YARG--NVFSDLPTPQQIHEQEKYKESLKQQIE 744          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Nematostella
Match: EDO39703 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G9])

HSP 1 Score: 58.151 bits (139), Expect = 1.892e-8
Identity = 47/139 (33.81%), Postives = 80/139 (57.55%), Query Frame = 1
Query: 1534 EELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIK---FDSKIVIP--PLSFRPQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQ--ALSDDDKIKAEKYKEDLKVQIEL 1929
            +EL++Q++E   +KE +K  +E YER+   EI  Y+P+G+GGGGAPL+D  G ++ DLK +     + KIV P  P   +  + +   PE + ISP+P     Y     G  G+  +    D +K ++ ++D+K++ +L
Sbjct:  735 DELERQMKEHAQKKEKEKIEKERYERKMEAEIEAYNPWGKGGGGAPLRDQTGHLVTDLKKMHQYNQEGKIVSPRDPPPAK-DIRFELPPEVNKISPEP----AYPDQSGGDMGRTSSFGRSDPLKTKQPQDDIKMKAKL 868          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000040468.1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:101155610])

HSP 1 Score: 73.9442 bits (180), Expect = 7.440e-13
Identity = 73/269 (27.14%), Postives = 124/269 (46.10%), Query Frame = 1
Query: 1270 FGQPANKPITNKVASARADISVPHQD----------SDYFYYASRNPLE---EFDSNPYVPSS------FNI---------------------NDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI-KFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNE-------LKT--YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
             GQPA     + +   R  + VPH              Y +Y +RNP +    +  +P  PS+      +N+                        R  N+  ++ P  S  +     + K+  +NY E LK+QI+E++ RK ++++  E +E R   E+R Y P+G+GGGGAPL+D+ G +IADL  + K + +  I P  ++ +    +   ++  S DPNE       ++T  +ARG   +F    ++    + ++YK  LK QIE
Sbjct:  214 CGQPAAPFYPSSMDIPRNPLFVPHPPLSGVYRNPYIEPYQFYGTRNPPDPNMAYYGHPSAPSAGFPVTCWNVPPATAVPNQFSNHSQHTEPPTTSSRPTNDTVVDSPAGSFPLVR---STKDRTLNYGEALKQQIQEQQQRKRVEREEDERFEARLEVEMRTYQPWGKGGGGAPLRDSSGNLIADLHQMHKLNEEAYINPEQWQRRATAGRTVHQTGQS-DPNERVSGFTRIQTPQFARG--NVFTNQPTEQQLKEQDQYKAFLKQQIE 476          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000035499.1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:101155610])

HSP 1 Score: 73.9442 bits (180), Expect = 7.784e-13
Identity = 73/269 (27.14%), Postives = 124/269 (46.10%), Query Frame = 1
Query: 1270 FGQPANKPITNKVASARADISVPHQD----------SDYFYYASRNPLE---EFDSNPYVPSS------FNI---------------------NDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI-KFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNE-------LKT--YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
             GQPA     + +   R  + VPH              Y +Y +RNP +    +  +P  PS+      +N+                        R  N+  ++ P  S  +     + K+  +NY E LK+QI+E++ RK ++++  E +E R   E+R Y P+G+GGGGAPL+D+ G +IADL  + K + +  I P  ++ +    +   ++  S DPNE       ++T  +ARG   +F    ++    + ++YK  LK QIE
Sbjct:  250 CGQPAAPFYPSSMDIPRNPLFVPHPPLSGVYRNPYIEPYQFYGTRNPPDPNMAYYGHPSAPSAGFPVTCWNVPPATAVPNQFSNHSQHTEPPTTSSRPTNDTVVDSPAGSFPLVR---STKDRTLNYGEALKQQIQEQQQRKRVEREEDERFEARLEVEMRTYQPWGKGGGGAPLRDSSGNLIADLHQMHKLNEEAYINPEQWQRRATAGRTVHQTGQS-DPNERVSGFTRIQTPQFARG--NVFTNQPTEQQLKEQDQYKAFLKQQIE 512          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000034758.1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:101155610])

HSP 1 Score: 73.559 bits (179), Expect = 1.064e-12
Identity = 73/279 (26.16%), Postives = 125/279 (44.80%), Query Frame = 1
Query: 1270 FGQPANKPITNKVASARADISVPHQD----------SDYFYYASRNPLE---EFDSNPYVPSS------FNI-----------NDQRNINEPNINQPKTSIRISHEPD-------TNKNLKVNYAEELKKQ-------------IEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNI-KFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNE-------LKT--YARGGHGIFGQALSDDDKIKAEKYKEDLKVQIE 1926
             GQPA     + +   R  + VPH              Y +Y +RNP +    +  +P  PS+      +N+           N  ++   P  +   T+  +   P        + K+  +NY E LK+Q             I+E++ RK ++++  E +E R   E+R Y P+G+GGGGAPL+D+ G +IADL  + K + +  I P  ++ +    +   ++  S DPNE       ++T  +ARG   +F    ++    + ++YK  LK QIE
Sbjct:  250 CGQPAAPFYPSSMDIPRNPLFVPHPPLSGVYRNPYIEPYQFYGTRNPPDPNMAYYGHPSAPSAGFPVTCWNVPPATAVPNQFSNHSQHTEPPTTSSRPTNDTVVDSPAGSFPLVRSTKDRTLNYGEALKQQEASTRGSIDLYSKIQEQQQRKRVEREEDERFEARLEVEMRTYQPWGKGGGGAPLRDSSGNLIADLHQMHKLNEEAYINPEQWQRRATAGRTVHQTGQS-DPNERVSGFTRIQTPQFARG--NVFTNQPTEQQLKEQDQYKAFLKQQIE 525          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000047124.1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:101171708])

HSP 1 Score: 63.929 bits (154), Expect = 9.210e-10
Identity = 45/144 (31.25%), Postives = 75/144 (52.08%), Query Frame = 1
Query: 1330 SVPHQDSDYFYYASRNPLEEFDSNPY-----VPSSFNI-NDQRNINE---PNIN---------QPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADL 1707
            ++P+ D  + YY + N    F  +P      +PS+  + ND  +I+    P +N          P   + ++  P    N  VNY E L++QI+ER+  K  +K+  E  + +   E+ ++ P+GRGGGGAP+KD  G +I+DL
Sbjct:  438 TIPY-DGAHLYYGNGN--YPFHLHPVRNQNDLPSNVEVQNDMNDISPKRLPPLNAHDCIDSPPSPTEGLHVNKSPLRRDN-AVNYQEALRQQIKERESHKRREKEENERCDLKLQAEMNSFSPWGRGGGGAPIKDQNGNLISDL 577          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Medaka
Match: ENSORLT00000037450.1 (centrosome and spindle pole associated protein 1 [Source:NCBI gene;Acc:101171708])

HSP 1 Score: 63.5438 bits (153), Expect = 1.122e-9
Identity = 45/144 (31.25%), Postives = 75/144 (52.08%), Query Frame = 1
Query: 1330 SVPHQDSDYFYYASRNPLEEFDSNPY-----VPSSFNI-NDQRNINE---PNIN---------QPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADL 1707
            ++P+ D  + YY + N    F  +P      +PS+  + ND  +I+    P +N          P   + ++  P    N  VNY E L++QI+ER+  K  +K+  E  + +   E+ ++ P+GRGGGGAP+KD  G +I+DL
Sbjct:  438 TIPY-DGAHLYYGNGN--YPFHLHPVRNQNDLPSNVEVQNDMNDISPKRLPPLNAHDCIDSPPSPTEGLHVNKSPLRRDN-AVNYQEALRQQIKERESHKRREKEENERCDLKLQAEMNSFSPWGRGGGGAPIKDQNGNLISDL 577          
BLAST of Centrosome and spindle pole-associated protein 1 vs. Planmine SMEST
Match: SMESG000080361.1 (SMESG000080361.1)

HSP 1 Score: 1815.05 bits (4700), Expect = 0.000e+0
Identity = 953/953 (100.00%), Postives = 953/953 (100.00%), Query Frame = 1
Query:  154 MDVDIDSFIREQKSKIATERQYLSNQNLSVKTPDYNAYEKSNKKNSENFDNFVFKMKEGENMKNKYKQELRNDYANVKEFNKHLDLSSRREKETDKPNTNGLLPGLGYSNSATKKKELIRNHEYNEFKKIEAENFKNRFQNKKVLSNREGNNSHLTRNPITSDFNAKENLISTSGRQTQKLHSFSPTINDSSQDRNRSFESKVDILEKKVDELRKFRIQNNDFDYENPKEQQFNFGYEPSFVPIKSSKSLRSLEETDKKLREIDEKYELSKANFMNTRRIGKKKINFILDDETILDNQSFQRPLSDIGTHERPITNSEPSIIPIGRNDEETRRRLKQEQYRKDLENQMKEKSKSQKRIANSISNENISFFDRFGQPANKPITNKVASARADISVPHQDSDYFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIELNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHIQKLEEHRLAAQENRKTKERLEYKAEEPKSSSPNQFRIRENSIAKSPIVARNRTSLENKPKTPTEIKINPTPLAKNHDNEEMTNNFYSLKAKLGHEMALLEKEIAHQNDGVEIYDPRLEASRHLDKQIHSIGYESDMVFDAVLQKKGPLSVRRGYFKPKRNRQNSAITTEMDLDEHLKQQEKVLQRMHQNNFSRYELNMPDMNPVDLSIRPTSQMSNQLESDTKFIDFQQSRDFNVKSSLSSISNKEYDFFKPLSPKPLRTNPEFGSNTSLNIDEITRKNQQRLRKLQKIQIENEKSQTTEEILNKFMSSQDL 3012
            MDVDIDSFIREQKSKIATERQYLSNQNLSVKTPDYNAYEKSNKKNSENFDNFVFKMKEGENMKNKYKQELRNDYANVKEFNKHLDLSSRREKETDKPNTNGLLPGLGYSNSATKKKELIRNHEYNEFKKIEAENFKNRFQNKKVLSNREGNNSHLTRNPITSDFNAKENLISTSGRQTQKLHSFSPTINDSSQDRNRSFESKVDILEKKVDELRKFRIQNNDFDYENPKEQQFNFGYEPSFVPIKSSKSLRSLEETDKKLREIDEKYELSKANFMNTRRIGKKKINFILDDETILDNQSFQRPLSDIGTHERPITNSEPSIIPIGRNDEETRRRLKQEQYRKDLENQMKEKSKSQKRIANSISNENISFFDRFGQPANKPITNKVASARADISVPHQDSDYFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIELNKRHKEIEKENERKREEKEREKFEKEQKLIQLELENEKKLQRQKELEHIQKLEEHRLAAQENRKTKERLEYKAEEPKSSSPNQFRIRENSIAKSPIVARNRTSLENKPKTPTEIKINPTPLAKNHDNEEMTNNFYSLKAKLGHEMALLEKEIAHQNDGVEIYDPRLEASRHLDKQIHSIGYESDMVFDAVLQKKGPLSVRRGYFKPKRNRQNSAITTEMDLDEHLKQQEKVLQRMHQNNFSRYELNMPDMNPVDLSIRPTSQMSNQLESDTKFIDFQQSRDFNVKSSLSSISNKEYDFFKPLSPKPLRTNPEFGSNTSLNIDEITRKNQQRLRKLQKIQIENEKSQTTEEILNKFMSSQDL
Sbjct:    1 MDVDIDSFIREQKSKIATERQYLSNQNLSVKTPDYNAYEKSNKKNSENFDNFVFKMKEGENMKNKYKQELRNDYANVKEFNKHLDLSSRREKETDKPNTNGLLPGLGYSNSATKKKELIRNHEYNEFKKIEAENFKNRFQNKKVLSNREGNNSHLTRNPITSDFNAKENLISTSGRQTQKLHSFSPTINDSSQDRNRSFESKVDILEKKVDELRKFRIQNNDFDYENPKEQQFNFGYEPSFVPIKSSKSLRSLEETDKKLREIDEKYELSKANFMNTRRIGKKKINFILDDETILDNQSFQRPLSDIGTHERPITNSEPSIIPIGRNDEETRRRLKQEQYRKDLENQMKEKSKSQKRIANSISNENISFFDRFGQPANKPITNKVASARADISVPHQDSDYFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNINQPKTSIRISHEPDTNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGRGGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPEKSIISPDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIELNKRHKEIEKENERKREEKEREKFEKEQKLIQLELENEKKLQRQKELEHIQKLEEHRLAAQENRKTKERLEYKAEEPKSSSPNQFRIRENSIAKSPIVARNRTSLENKPKTPTEIKINPTPLAKNHDNEEMTNNFYSLKAKLGHEMALLEKEIAHQNDGVEIYDPRLEASRHLDKQIHSIGYESDMVFDAVLQKKGPLSVRRGYFKPKRNRQNSAITTEMDLDEHLKQQEKVLQRMHQNNFSRYELNMPDMNPVDLSIRPTSQMSNQLESDTKFIDFQQSRDFNVKSSLSSISNKEYDFFKPLSPKPLRTNPEFGSNTSLNIDEITRKNQQRLRKLQKIQIENEKSQTTEEILNKFMSSQDL 953          
The following BLAST results are available for this feature:
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CSPP12.007e-829.65centrosome and spindle pole associated protein 1 [... [more]
CSPP19.677e-728.77centrosome and spindle pole associated protein 1 [... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cspp1b4.292e-1431.62centrosome and spindle pole associated protein 1b ... [more]
cspp1a1.135e-830.45centrosome and spindle pole associated protein 1a ... [more]
cspp1a1.191e-830.45centrosome and spindle pole associated protein 1a ... [more]
cspp1a1.485e-830.45centrosome and spindle pole associated protein 1a ... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CSPP18.267e-1431.03centrosome and spindle pole associated protein 1 [... [more]
CSPP18.564e-1431.03centrosome and spindle pole associated protein 1 [... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Cspp12.241e-1126.80centrosome and spindle pole associated protein 1 [... [more]
Cspp13.626e-1026.36centrosome and spindle pole associated protein 1 [... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B2RX88|CSPP1_MOUSE1.598e-1026.80Centrosome and spindle pole associated protein 1 O... [more]
sp|Q1MSJ5|CSPP1_HUMAN1.200e-726.00Centrosome and spindle pole-associated protein 1 O... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QHK81.310e-2340.41Centrosome and spindle pole-associated protein 1 O... [more]
A0A433TIH01.675e-2332.52Uncharacterized protein (Fragment) OS=Elysia chlor... [more]
A0A0B6ZQS81.180e-2031.15Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
R7TLU22.268e-1935.11Uncharacterized protein OS=Capitella teleta OX=283... [more]
V3ZZM82.239e-1841.73Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cspp1a2.148e-732.47centrosome and spindle pole associated protein 1a ... [more]
cspp1a2.414e-732.47centrosome and spindle pole associated protein 1a ... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO397031.892e-833.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000040468.17.440e-1327.14centrosome and spindle pole associated protein 1 [... [more]
ENSORLT00000035499.17.784e-1327.14centrosome and spindle pole associated protein 1 [... [more]
ENSORLT00000034758.11.064e-1226.16centrosome and spindle pole associated protein 1 [... [more]
ENSORLT00000047124.19.210e-1031.25centrosome and spindle pole associated protein 1 [... [more]
ENSORLT00000037450.11.122e-931.25centrosome and spindle pole associated protein 1 [... [more]
back to top
BLAST of Centrosome and spindle pole-associated protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000080361.10.000e+0100.00SMESG000080361.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025849 ID=SMED30025849|Name=Centrosome and spindle pole-associated protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3319bp
ATCTTGTAGTTTTGAAATTTATTTCATCTGATATTTTCAAACTGAATTTA
ATTATTATTTCTGAATTCAAATCTGCATAAATTGAGGAGATTTATAAATA
TTTTGCTGTAGCTGATTCATTGTTGCATTTAAAATTTAAGGAAATATTTT
AATATGGATGTTGACATTGATAGTTTTATAAGGGAACAGAAGTCAAAAAT
TGCTACTGAAAGACAATATCTTTCTAATCAAAATCTTTCTGTAAAAACTC
CTGATTATAATGCTTATGAAAAATCTAATAAAAAAAATTCGGAAAATTTT
GACAATTTCGTATTCAAAATGAAAGAAGGAGAAAATATGAAAAACAAATA
CAAACAAGAACTTCGAAATGATTATGCAAATGTTAAAGAATTTAATAAAC
ATTTAGATTTATCTTCAAGAAGGGAAAAAGAAACCGATAAACCTAACACA
AATGGTTTGCTACCTGGATTGGGATATTCTAATTCAGCAACAAAGAAAAA
AGAACTCATTCGAAATCACGAATACAACGAGTTCAAAAAAATAGAAGCAG
AAAATTTCAAAAATCGATTTCAAAATAAAAAAGTTTTATCGAACAGAGAA
GGGAATAATTCTCATTTGACAAGAAATCCAATAACATCCGATTTCAATGC
AAAAGAAAATCTAATATCGACCTCTGGCCGACAAACGCAAAAACTTCATT
CGTTTTCACCCACAATCAATGATTCCAGTCAAGATCGTAACAGATCCTTT
GAGAGCAAAGTCGACATTTTGGAGAAAAAAGTTGACGAATTACGAAAATT
CCGAATCCAAAACAATGATTTTGATTACGAAAATCCAAAAGAACAACAGT
TCAATTTTGGATACGAGCCGAGCTTTGTACCGATTAAATCCAGCAAAAGT
CTCCGATCATTGGAGGAAACTGACAAGAAACTGAGAGAAATCGATGAGAA
ATACGAGTTGTCGAAAGCGAACTTTATGAATACTCGAAGAATCGGAAAAA
AGAAAATCAATTTTATTTTGGATGATGAAACGATTTTAGACAATCAGTCG
TTTCAACGACCTCTGTCCGATATCGGAACTCATGAGCGACCAATCACCAA
TAGCGAACCTTCGATCATTCCTATTGGTCGAAACGACGAAGAAACCCGAA
GACGACTGAAGCAAGAACAATATCGTAAGGATCTGGAAAATCAAATGAAA
GAAAAGTCTAAATCCCAAAAAAGAATCGCTAATTCAATTTCCAATGAAAA
CATTTCATTTTTTGACCGATTTGGACAGCCTGCCAACAAACCAATCACCA
ATAAGGTTGCAAGTGCAAGGGCAGACATTTCTGTTCCACATCAAGATTCG
GATTATTTCTATTACGCTTCTCGTAATCCTTTGGAGGAATTCGATTCAAA
TCCATACGTTCCGTCATCATTCAATATCAATGATCAACGAAACATAAACG
AACCGAATATAAATCAACCGAAAACATCCATTAGAATAAGCCATGAACCG
GACACGAATAAAAATCTCAAAGTAAATTATGCAGAAGAACTTAAAAAACA
AATTGAAGAAAGAAAAGTCCGTAAAGAAATCGATAAAAAGAGTCAAGAGG
AATATGAAAGACGAAAAAATGAAGAAATCAGAAATTACGATCCATTCGGT
CGAGGAGGCGGTGGAGCGCCATTGAAAGACAATCGCGGTGAAGTAATTGC
CGATCTGAAAAATATAAAATTCGATTCGAAAATCGTCATTCCACCGCTTT
CATTTCGCCCTCAAGTCGAATATTATAAAGAACCGGAAAAATCGATTATT
TCTCCAGATCCCAACGAGTTGAAAACATACGCTCGAGGAGGGCATGGAAT
ATTTGGACAGGCGTTGTCGGATGATGACAAAATCAAAGCGGAGAAATACA
AAGAAGACCTTAAAGTACAAATTGAGCTTAACAAACGACACAAAGAAATC
GAGAAAGAAAACGAAAGAAAAAGAGAAGAAAAAGAAAGAGAAAAATTTGA
AAAGGAACAAAAACTAATTCAATTAGAATTAGAGAATGAGAAAAAACTTC
AAAGACAAAAAGAACTGGAACATATTCAAAAATTAGAAGAGCACCGTTTA
GCAGCTCAGGAAAATAGAAAGACAAAAGAACGCTTGGAATATAAAGCCGA
AGAACCGAAATCCTCTTCGCCGAATCAGTTTCGAATAAGAGAAAATTCAA
TAGCAAAGTCTCCAATAGTCGCTAGAAATCGGACTTCTTTGGAAAATAAA
CCCAAAACACCAACAGAAATCAAAATAAATCCAACTCCGTTAGCAAAAAA
TCATGACAACGAAGAAATGACTAACAATTTCTATTCGCTCAAAGCGAAAT
TAGGACACGAAATGGCTCTTTTGGAAAAGGAAATAGCCCATCAAAATGAT
GGAGTTGAAATCTATGATCCACGCCTCGAGGCAAGCCGGCATTTAGATAA
ACAAATCCACAGCATCGGTTACGAATCTGACATGGTATTCGATGCTGTCC
TCCAGAAAAAAGGTCCATTATCTGTGCGTCGAGGCTACTTTAAACCGAAA
CGAAACCGCCAAAACTCCGCAATAACCACCGAAATGGATCTCGATGAACA
TTTGAAACAACAAGAAAAGGTTTTACAGCGAATGCATCAAAACAATTTCA
GCCGATACGAGCTCAATATGCCGGACATGAATCCGGTAGATTTGTCCATT
CGGCCGACCAGTCAAATGTCCAATCAATTGGAGTCGGACACGAAATTCAT
CGACTTTCAGCAAAGTCGAGATTTCAATGTCAAAAGTAGTCTGTCTAGTA
TTTCGAATAAGGAGTACGACTTCTTTAAGCCGCTGTCTCCGAAACCCCTG
AGAACGAATCCGGAATTCGGTTCGAATACCAGTCTGAATATCGATGAAAT
CACAAGGAAAAACCAGCAGCGTTTGAGGAAACTGCAAAAAATTCAAATCG
AGAATGAGAAATCCCAAACAACAGAAGAGATTTTAAATAAGTTTATGAGT
TCACAAGATCTATAAATTGTGATATTCTGTACACTGAAACTTGTCAGGTC
TTTTGATTCGTTTAGACTGTATGAAATGAGAATATATATGCATAAATTTG
AGGAATTCCTTCTTGTTTTCTCTTTATCATTCTTCTTTCTCGCAAACTTT
TACTATCTTCATATAATTTATTGGTTTTTTATGTTACGACCGTTCTACCT
GTTTGAGAAGGGAATTGCATGGAAATCTTCCATAACTCCTTTATCCACTA
GTCATACGGCTTTTTTGTTAAATATTTCTAGGGATTTCCGTTTTAAATGA
GAAAACAATTTTTCAGGAC
back to top

protein sequence of SMED30025849-orf-1

>SMED30025849-orf-1 ID=SMED30025849-orf-1|Name=SMED30025849-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=954bp
MDVDIDSFIREQKSKIATERQYLSNQNLSVKTPDYNAYEKSNKKNSENFD
NFVFKMKEGENMKNKYKQELRNDYANVKEFNKHLDLSSRREKETDKPNTN
GLLPGLGYSNSATKKKELIRNHEYNEFKKIEAENFKNRFQNKKVLSNREG
NNSHLTRNPITSDFNAKENLISTSGRQTQKLHSFSPTINDSSQDRNRSFE
SKVDILEKKVDELRKFRIQNNDFDYENPKEQQFNFGYEPSFVPIKSSKSL
RSLEETDKKLREIDEKYELSKANFMNTRRIGKKKINFILDDETILDNQSF
QRPLSDIGTHERPITNSEPSIIPIGRNDEETRRRLKQEQYRKDLENQMKE
KSKSQKRIANSISNENISFFDRFGQPANKPITNKVASARADISVPHQDSD
YFYYASRNPLEEFDSNPYVPSSFNINDQRNINEPNINQPKTSIRISHEPD
TNKNLKVNYAEELKKQIEERKVRKEIDKKSQEEYERRKNEEIRNYDPFGR
GGGGAPLKDNRGEVIADLKNIKFDSKIVIPPLSFRPQVEYYKEPEKSIIS
PDPNELKTYARGGHGIFGQALSDDDKIKAEKYKEDLKVQIELNKRHKEIE
KENERKREEKEREKFEKEQKLIQLELENEKKLQRQKELEHIQKLEEHRLA
AQENRKTKERLEYKAEEPKSSSPNQFRIRENSIAKSPIVARNRTSLENKP
KTPTEIKINPTPLAKNHDNEEMTNNFYSLKAKLGHEMALLEKEIAHQNDG
VEIYDPRLEASRHLDKQIHSIGYESDMVFDAVLQKKGPLSVRRGYFKPKR
NRQNSAITTEMDLDEHLKQQEKVLQRMHQNNFSRYELNMPDMNPVDLSIR
PTSQMSNQLESDTKFIDFQQSRDFNVKSSLSSISNKEYDFFKPLSPKPLR
TNPEFGSNTSLNIDEITRKNQQRLRKLQKIQIENEKSQTTEEILNKFMSS
QDL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR026708CSPP1
IPR019774Aromatic-AA_hydroxylase_C
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0032467positive regulation of cytokinesis
Vocabulary: cellular component
TermDefinition
GO:0000922spindle pole
GO:0005813centrosome
GO:0005874microtubule
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 327..357
NoneNo IPR availableCOILSCoilCoilcoord: 589..661
NoneNo IPR availableCOILSCoilCoilcoord: 913..933
NoneNo IPR availableCOILSCoilCoilcoord: 189..209
NoneNo IPR availableCOILSCoilCoilcoord: 253..273
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 648..674
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 174..196
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 174..194
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 477..495
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 648..667
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 477..506
NoneNo IPR availablePANTHERPTHR21616:SF2CENTROSOME AND SPINDLE POLE-ASSOCIATED PROTEIN 1coord: 8..951
IPR026708Centrosome and spindle pole associated protein 1PANTHERPTHR21616CENTROSOME SPINDLE POLE ASSOCIATED PROTEINcoord: 8..951