SMED30025844

Overview
NameSMED30025844
Smed IDSMED30025844
Length (bp)1168
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025844

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025844 SmedASXL_016348SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
protonephridiaSMED30025844 dd_Smed_v4_4311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025844 dd_Smed_v4_4311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025844 dd_Smed_v4_4311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30025844 dd_Smed_v4_4311_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025844 dd_Smed_v6_4311_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30025844 Contig43299newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30025844 Contig43299uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30025844 dd_Smed_v4_4311_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025844 dd_Smed_v4_4311_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30025844 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.001934:12880..14259 +5593
Homology
BLAST of SMED30025844 vs. Planmine SMEST
Match: SMESG000067876.1 (SMESG000067876.1)

HSP 1 Score: 58.9214 bits (141), Expect = 3.519e-9
Identity = 52/165 (31.52%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  464 LSTISSAMLASVTSPMSLVSYLPIQPGEFEYIININLKFLNDIFTAAXXXXXXXXYKSYIQNMTSVINQGIRNYGMRTLNILVNSISPGSVVVDFNWNLASNISTSYSTIRNTISNMFQNA-YGSSYNLSGVEVIQGP-TIPSNIITSEVPSTFLNTNAISPTSS 952
            LS+I S+  A  T+P+   S  P + GEFEYI+N  +KF ND F  + SN  S    SY  +      +  +   +R +  L NSI  GSV+++    +ASN+S    ++ +  +N++Q+   G    ++ + + QGP +I ++ +   +PS   +TN   PTS+
Sbjct:  426 LSSIESS--AQSTTPIQPFSDFPTRVGEFEYILNTTVKFSNDTFDLSYSNLKSASSISYFNSKCQRFQKPFQMLNIRLIQCLPNSIKSGSVIIEMILVVASNLSNINVSLTSDFANLYQSQNNGEIIIINELLISQGPYSITASTLKQTIPSVISSTNG--PTST 586          
BLAST of SMED30025844 vs. Planmine SMEST
Match: SMESG000067876.1 (SMESG000067876.1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.102e-9
Identity = 52/165 (31.52%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  464 LSTISSAMLASVTSPMSLVSYLPIQPGEFEYIININLKFLNDIFTAAXXXXXXXXYKSYIQNMTSVINQGIRNYGMRTLNILVNSISPGSVVVDFNWNLASNISTSYSTIRNTISNMFQNA-YGSSYNLSGVEVIQGP-TIPSNIITSEVPSTFLNTNAISPTSS 952
            LS+I S+  A  T+P+   S  P + GEFEYI+N  +KF ND F  + SN  S    SY  +      +  +   +R +  L NSI  GSV+++    +ASN+S    ++ +  +N++Q+   G    ++ + + QGP +I ++ +   +PS   +TN   PTS+
Sbjct:  442 LSSIESS--AQSTTPIQPFSDFPTRVGEFEYILNTTVKFSNDTFDLSYSNLKSASSISYFNSKCQRFQKPFQMLNIRLIQCLPNSIKSGSVIIEMILVVASNLSNINVSLTSDFANLYQSQNNGEIIIINELLISQGPYSITASTLKQTIPSVISSTNG--PTST 602          
BLAST of SMED30025844 vs. Planmine SMEST
Match: SMESG000067876.1 (SMESG000067876.1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.545e-9
Identity = 52/165 (31.52%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  464 LSTISSAMLASVTSPMSLVSYLPIQPGEFEYIININLKFLNDIFTAAXXXXXXXXYKSYIQNMTSVINQGIRNYGMRTLNILVNSISPGSVVVDFNWNLASNISTSYSTIRNTISNMFQNA-YGSSYNLSGVEVIQGP-TIPSNIITSEVPSTFLNTNAISPTSS 952
            LS+I S+  A  T+P+   S  P + GEFEYI+N  +KF ND F  + SN  S    SY  +      +  +   +R +  L NSI  GSV+++    +ASN+S    ++ +  +N++Q+   G    ++ + + QGP +I ++ +   +PS   +TN   PTS+
Sbjct:  468 LSSIESS--AQSTTPIQPFSDFPTRVGEFEYILNTTVKFSNDTFDLSYSNLKSASSISYFNSKCQRFQKPFQMLNIRLIQCLPNSIKSGSVIIEMILVVASNLSNINVSLTSDFANLYQSQNNGEIIIINELLISQGPYSITASTLKQTIPSVISSTNG--PTST 628          
BLAST of SMED30025844 vs. Planmine SMEST
Match: SMESG000067876.1 (SMESG000067876.1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.630e-9
Identity = 52/165 (31.52%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  464 LSTISSAMLASVTSPMSLVSYLPIQPGEFEYIININLKFLNDIFTAAXXXXXXXXYKSYIQNMTSVINQGIRNYGMRTLNILVNSISPGSVVVDFNWNLASNISTSYSTIRNTISNMFQNA-YGSSYNLSGVEVIQGP-TIPSNIITSEVPSTFLNTNAISPTSS 952
            LS+I S+  A  T+P+   S  P + GEFEYI+N  +KF ND F  + SN  S    SY  +      +  +   +R +  L NSI  GSV+++    +ASN+S    ++ +  +N++Q+   G    ++ + + QGP +I ++ +   +PS   +TN   PTS+
Sbjct:  435 LSSIESS--AQSTTPIQPFSDFPTRVGEFEYILNTTVKFSNDTFDLSYSNLKSASSISYFNSKCQRFQKPFQMLNIRLIQCLPNSIKSGSVIIEMILVVASNLSNINVSLTSDFANLYQSQNNGEIIIINELLISQGPYSITASTLKQTIPSVISSTNG--PTST 595          
BLAST of SMED30025844 vs. Planmine SMEST
Match: SMESG000067876.1 (SMESG000067876.1)

HSP 1 Score: 58.9214 bits (141), Expect = 4.657e-9
Identity = 52/165 (31.52%), Postives = 88/165 (53.33%), Query Frame = 2
Query:  464 LSTISSAMLASVTSPMSLVSYLPIQPGEFEYIININLKFLNDIFTAAXXXXXXXXYKSYIQNMTSVINQGIRNYGMRTLNILVNSISPGSVVVDFNWNLASNISTSYSTIRNTISNMFQNA-YGSSYNLSGVEVIQGP-TIPSNIITSEVPSTFLNTNAISPTSS 952
            LS+I S+  A  T+P+   S  P + GEFEYI+N  +KF ND F  + SN  S    SY  +      +  +   +R +  L NSI  GSV+++    +ASN+S    ++ +  +N++Q+   G    ++ + + QGP +I ++ +   +PS   +TN   PTS+
Sbjct:  459 LSSIESS--AQSTTPIQPFSDFPTRVGEFEYILNTTVKFSNDTFDLSYSNLKSASSISYFNSKCQRFQKPFQMLNIRLIQCLPNSIKSGSVIIEMILVVASNLSNINVSLTSDFANLYQSQNNGEIIIINELLISQGPYSITASTLKQTIPSVISSTNG--PTST 619          
The following BLAST results are available for this feature:
BLAST of SMED30025844 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30025844 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067876.13.519e-931.52SMESG000067876.1[more]
SMESG000067876.14.102e-931.52SMESG000067876.1[more]
SMESG000067876.14.545e-931.52SMESG000067876.1[more]
SMESG000067876.14.630e-931.52SMESG000067876.1[more]
SMESG000067876.14.657e-931.52SMESG000067876.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025844 ID=SMED30025844|Name=SMED30025844|organism=Schmidtea mediterranea sexual|type=transcript|length=1168bp
AAATACTTCACCTAATACTCCACAGTTTACAAATTCACAATCTCCATCAA
CGTTATACTTTGCATCAATCACTACTACAGATATAACTCCATCAATCCCA
TTAAACAGTTCTCCTTTACATATTTTATCTGGTCAATCTACAAACAGTTT
CATAACATCAAGTCAATCAGCTTTCTCAGACAGTTCATCATTCTCCAACT
CTAAATTTCAGTCTGCTCCCATATATTCAACAGATACTCCGTTTTCACCT
AATCCATCCGCAATGACCAATTCACTGTTTCCTTCAAATATACCAATTCA
ATCTACTCCAATTCCTTCAATAAGCTATACTCCACAATCTAGTAACGTAC
CATTTTTAACAAATTCCTCAAACACTTCATCAACATCATCTTCTCCTACG
TCTGTCTCTGTGACTAACCTTCCAAGTAATTCATCAACATCGGGAGCATC
AGCAGATATGGTACTATCAACAATTTCTAGTGCAATGTTAGCATCAGTAA
CTTCACCTATGTCTTTGGTCAGCTACCTGCCAATTCAACCCGGAGAATTC
GAATATATTATTAATATAAATCTGAAATTCCTCAACGATATCTTCACCGC
TGCCGTCAGCAATTCGAGTTCCGTTGTGTACAAATCCTATATTCAAAATA
TGACGTCCGTTATCAATCAAGGGATCAGAAATTATGGGATGAGGACGCTG
AATATTTTAGTTAATTCCATTAGTCCTGGAAGTGTTGTCGTAGACTTCAA
TTGGAATCTTGCTTCGAATATTTCAACTAGTTATTCAACCATAAGAAATA
CAATATCAAATATGTTTCAGAATGCCTATGGCAGTTCATATAATTTATCA
GGAGTTGAAGTTATACAAGGACCAACAATCCCGTCAAACATAATAACATC
AGAAGTCCCATCAACATTTTTGAATACGAATGCTATTTCACCAACATCAT
CCGTGGGAAATATTCAGTCTCAATCAACTTCTTTCTTAAATATAAGTTCA
GTTATAACGCAATCGTCTTTATCAGTTACTGCGCCTGTAACATCAGCCGC
GCCAGTGTTCAACAGTTCTCTTTCTATTATTTCTACTGACCCTGTGACAA
CAAATATAAGTTCGACAAATGCGGTGTCTACATCTTTAACTAATACAATT
ACAACTACACCAGTGTTG
back to top

protein sequence of SMED30025844-orf-1

>SMED30025844-orf-1 ID=SMED30025844-orf-1|Name=SMED30025844-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=389bp
NTSPNTPQFTNSQSPSTLYFASITTTDITPSIPLNSSPLHILSGQSTNSF
ITSSQSAFSDSSSFSNSKFQSAPIYSTDTPFSPNPSAMTNSLFPSNIPIQ
STPIPSISYTPQSSNVPFLTNSSNTSSTSSSPTSVSVTNLPSNSSTSGAS
ADMVLSTISSAMLASVTSPMSLVSYLPIQPGEFEYIININLKFLNDIFTA
AVSNSSSVVYKSYIQNMTSVINQGIRNYGMRTLNILVNSISPGSVVVDFN
WNLASNISTSYSTIRNTISNMFQNAYGSSYNLSGVEVIQGPTIPSNIITS
EVPSTFLNTNAISPTSSVGNIQSQSTSFLNISSVITQSSLSVTAPVTSAA
PVFNSSLSIISTDPVTTNISSTNAVSTSLTNTITTTPVL
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000082SEA_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000082SEA domainPFAMPF01390SEAcoord: 187..278
e-value: 3.7E-7
score: 30.2
IPR000082SEA domainPROSITEPS50024SEAcoord: 183..299
score: 10.627
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 120..142