Tigger transposable element-derived protein 1

Overview
NameTigger transposable element-derived protein 1
Smed IDSMED30025841
Length (bp)2425
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tigger transposable element-derived protein 1 (SMED30025841) t-SNE clustered cells

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30025841) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tigger transposable element-derived protein 1 (SMED30025841) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tigger transposable element-derived protein 1 (SMED30025841) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025841

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30025841h1SMcG0012984 dd_Smed_v4_6197_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 97.0561 bits (240), Expect = 4.157e-37
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query: 1006 QASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            + + D  A + F   F + I  ++   +QI+ ADE GLFWK +P R  + K   +  GHK+ ++++TI+ C+NA+G   +K  V+ KAK PRSFK  +  NLPV + + K AW+  ++F  WF
Sbjct:  144 RLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWF 266          

HSP 2 Score: 38.5058 bits (88), Expect = 4.157e-37
Identity = 23/58 (39.66%), Postives = 30/58 (51.72%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSV 1673
            +LP N  SL+QP DQG+IAT K  Y         + LE    L      KK T+LD++
Sbjct:  314 YLPPNVASLIQPSDQGVIATMKRNYRAGLLQ---NNLEEGNDLKSF--WKKLTLLDAL 366          

HSP 3 Score: 38.1206 bits (87), Expect = 4.157e-37
Identity = 19/41 (46.34%), Postives = 28/41 (68.29%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD--LQHENVEVF 1501
            VP V +YL  K L  KA+LLLDN+P HP +  L+ ++ ++F
Sbjct:  271 VPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF 311          

HSP 4 Score: 34.6538 bits (78), Expect = 4.157e-37
Identity = 22/101 (21.78%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRS-MNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKA 896
            KR  ++++ K+ I+ +L +      +   + + E T+R IR+N++ I    ++    S +     ++ S+ E +++A++ W   Q  K  PI      ++A
Sbjct:    6 KRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRA 106          

HSP 5 Score: 28.1054 bits (61), Expect = 4.157e-37
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F  S GW  +FK+RHS+  +
Sbjct:  119 FNPSAGWLTRFKQRHSIREI 138          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 102.064 bits (253), Expect = 1.594e-32
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            SAD  AA+QF   F    A    S +Q++ ADE GLFW+ +P  T    +  +  G K  KD++T+L C+NA+G   +KP+ I K   PR+FKG  I +LPV + A   AWV   +F+DWF++
Sbjct:  156 SADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKG--IQHLPVAYKAQGNAWVDKEIFSDWFHH 273          

HSP 2 Score: 36.965 bits (84), Expect = 1.594e-32
Identity = 25/118 (21.19%), Postives = 57/118 (48.31%), Query Frame = 3
Query:  573 GKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSI-RKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQI 923
            GK   +  KR  ++L+ KI I  RL   E    + + +++  +T+  IR ++  + R   ++   +++     +    +E +++ L  W   +  + +P+    + EKA   YE++Q+
Sbjct:    8 GKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQL 125          

HSP 3 Score: 29.261 bits (64), Expect = 1.594e-32
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGI 1550
            FLP +  SL+QP++QGI
Sbjct:  319 FLPASVASLVQPMEQGI 335          

HSP 4 Score: 28.1054 bits (61), Expect = 1.594e-32
Identity = 16/41 (39.02%), Postives = 24/41 (58.54%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELP--FKALLLLDNAPGHPQDLQHENVEVF 1501
            VP V ++     LP   KA+LLLD++  HPQ+ +  +  VF
Sbjct:  276 VPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVF 316          

HSP 5 Score: 24.6386 bits (52), Expect = 1.594e-32
Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL 991
            +P   S GW  +FK RH +  L
Sbjct:  127 EPCVFSGGWLWRFKARHGIKKL 148          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 102.064 bits (253), Expect = 1.594e-32
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            SAD  AA+QF   F    A    S +Q++ ADE GLFW+ +P  T    +  +  G K  KD++T+L C+NA+G   +KP+ I K   PR+FKG  I +LPV + A   AWV   +F+DWF++
Sbjct:  156 SADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKG--IQHLPVAYKAQGNAWVDKEIFSDWFHH 273          

HSP 2 Score: 36.965 bits (84), Expect = 1.594e-32
Identity = 25/118 (21.19%), Postives = 57/118 (48.31%), Query Frame = 3
Query:  573 GKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSI-RKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQI 923
            GK   +  KR  ++L+ KI I  RL   E    + + +++  +T+  IR ++  + R   ++   +++     +    +E +++ L  W   +  + +P+    + EKA   YE++Q+
Sbjct:    8 GKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQL 125          

HSP 3 Score: 29.261 bits (64), Expect = 1.594e-32
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGI 1550
            FLP +  SL+QP++QGI
Sbjct:  319 FLPASVASLVQPMEQGI 335          

HSP 4 Score: 28.1054 bits (61), Expect = 1.594e-32
Identity = 16/41 (39.02%), Postives = 24/41 (58.54%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELP--FKALLLLDNAPGHPQDLQHENVEVF 1501
            VP V ++     LP   KA+LLLD++  HPQ+ +  +  VF
Sbjct:  276 VPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVF 316          

HSP 5 Score: 24.6386 bits (52), Expect = 1.594e-32
Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL 991
            +P   S GW  +FK RH +  L
Sbjct:  127 EPCVFSGGWLWRFKARHGIKKL 148          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 102.064 bits (253), Expect = 2.063e-32
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            SAD  AA+QF   F    A    S +Q++ ADE GLFW+ +P  T    +  +  G K  KD++T+L C+NA+G   +KP+ I K   PR+FKG  I +LPV + A   AWV   +F+DWF++
Sbjct:  156 SADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKG--IQHLPVAYKAQGNAWVDKEIFSDWFHH 273          

HSP 2 Score: 36.965 bits (84), Expect = 2.063e-32
Identity = 25/118 (21.19%), Postives = 57/118 (48.31%), Query Frame = 3
Query:  573 GKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSI-RKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQI 923
            GK   +  KR  ++L+ KI I  RL   E    + + +++  +T+  IR ++  + R   ++   +++     +    +E +++ L  W   +  + +P+    + EKA   YE++Q+
Sbjct:    8 GKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQL 125          

HSP 3 Score: 29.261 bits (64), Expect = 2.063e-32
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGI 1550
            FLP +  SL+QP++QGI
Sbjct:  319 FLPASVASLVQPMEQGI 335          

HSP 4 Score: 27.7202 bits (60), Expect = 2.063e-32
Identity = 16/41 (39.02%), Postives = 24/41 (58.54%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELP--FKALLLLDNAPGHPQDLQHENVEVF 1501
            VP V ++     LP   KA+LLLD++  HPQ+ +  +  VF
Sbjct:  276 VPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVF 316          

HSP 5 Score: 24.6386 bits (52), Expect = 2.063e-32
Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL 991
            +P   S GW  +FK RH +  L
Sbjct:  127 EPCVFSGGWLWRFKARHGIKKL 148          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Match: JRK (Jrk helix-turn-helix protein [Source:HGNC Symbol;Acc:HGNC:6199])

HSP 1 Score: 102.064 bits (253), Expect = 2.063e-32
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            SAD  AA+QF   F    A    S +Q++ ADE GLFW+ +P  T    +  +  G K  KD++T+L C+NA+G   +KP+ I K   PR+FKG  I +LPV + A   AWV   +F+DWF++
Sbjct:  156 SADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKG--IQHLPVAYKAQGNAWVDKEIFSDWFHH 273          

HSP 2 Score: 36.965 bits (84), Expect = 2.063e-32
Identity = 25/118 (21.19%), Postives = 57/118 (48.31%), Query Frame = 3
Query:  573 GKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSI-RKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQI 923
            GK   +  KR  ++L+ KI I  RL   E    + + +++  +T+  IR ++  + R   ++   +++     +    +E +++ L  W   +  + +P+    + EKA   YE++Q+
Sbjct:    8 GKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQL 125          

HSP 3 Score: 29.261 bits (64), Expect = 2.063e-32
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGI 1550
            FLP +  SL+QP++QGI
Sbjct:  319 FLPASVASLVQPMEQGI 335          

HSP 4 Score: 27.7202 bits (60), Expect = 2.063e-32
Identity = 16/41 (39.02%), Postives = 24/41 (58.54%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELP--FKALLLLDNAPGHPQDLQHENVEVF 1501
            VP V ++     LP   KA+LLLD++  HPQ+ +  +  VF
Sbjct:  276 VPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVF 316          

HSP 5 Score: 24.6386 bits (52), Expect = 2.063e-32
Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL 991
            +P   S GW  +FK RH +  L
Sbjct:  127 EPCVFSGGWLWRFKARHGIKKL 148          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: ENSXETT00000046714.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460367.1:582927:585046:-1 gene:ENSXETG00000018570.1 transcript:ENSXETT00000046714.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 6.157e-23
Identity = 51/147 (34.69%), Postives = 74/147 (50.34%), Query Frame = 1
Query: 1072 KSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRKIFSQKRAAFQGSSFIGQCSRSPSRLAA*KCRSFFYQK 1512
            + Y    IF  DE GLF+  +P +TF  +  +   G K +K ++T+LF +NA G   +KP+VI K+  PR F  KN+N LP  + AN KAW+T  LF +  +    R R    QK        F+ +C   P  L     +  F+ K
Sbjct:  164 EGYELKNIFNTDETGLFFNVLPGKTFCFR-GEDCHGGKLSKLRLTVLFTTNADGSEKLKPLVIGKSVKPRCF--KNVNTLPTNYTANTKAWMTTKLFEEQMHLLDNRMR---LQKHKILL---FLDRCPAHPPSLHLHNVKLVFFSK 301          

HSP 2 Score: 36.965 bits (84), Expect = 6.157e-23
Identity = 35/114 (30.70%), Postives = 50/114 (43.86%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERV-IDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTT-SHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIRNL 932
            KRK +SLE KI IL R  +     + + +   +  +T+ TI +   S   S  A  C        +V  S  E MEK L  W    +   +PI    + EKA+ I  +L I N 
Sbjct:    7 KRKSLSLEEKIAILDRADSYHGTRVALAKELGIPVSTLGTIIKQRASTEGS--ADKCGPQAKKRKYVTQSKYEQMEKLLQEWFAGLHASNVPISGIMLREKAVHIATRLGIDNF 118          

HSP 3 Score: 29.6462 bits (65), Expect = 6.157e-23
Identity = 10/17 (58.82%), Postives = 16/17 (94.12%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSL 982
            FTAS+GW ++FKKR+++
Sbjct:  118 FTASNGWIDRFKKRYNV 134          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: kif6 (kinesin family member 6 [Source:Xenbase;Acc:XB-GENE-1014042])

HSP 1 Score: 95.5153 bits (236), Expect = 3.824e-20
Identity = 45/128 (35.16%), Postives = 80/128 (62.50%), Query Frame = 1
Query:  997 NLYQASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            N  +AS + + A  F +K ++ ++ +  S +Q++ A +  LFW+ +P++   T Q   +SG +  K+++T+L CSNA+G    + +VI K+++PR+FKG  +   PV + ANK+A +T  +F DWF N
Sbjct:  318 NGEKASEEYNVADNFVKKLNKLVSDEHLSAEQVYNAAKASLFWRHLPQKLVATAQKPPSSGLEDPKERLTVLACSNAAGTHKARLLVIGKSRNPRAFKGVRV--FPVTYTANKQAGITREIFQDWFEN 443          

HSP 2 Score: 24.2534 bits (51), Expect = 3.824e-20
Identity = 14/47 (29.79%), Postives = 18/47 (38.30%), Query Frame = 2
Query: 1430 KALLLLDNAPGHPQDLQHENVEVFFTKKHNFFVTTFGPRDNCHIQGI 1570
            K +L+LD+ P HP           F  K N F     P     IQ +
Sbjct:  463 KVMLILDHCPTHPS--------AEFLVKDNVFAVCLPPDCTSFIQPL 501          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Match: apmapl (adipocyte plasma membrane associated protein LIKE [Source:Xenbase;Acc:XB-GENE-5754317])

HSP 1 Score: 57.3806 bits (137), Expect = 5.853e-8
Identity = 41/184 (22.28%), Postives = 72/184 (39.13%), Query Frame = 1
Query: 1063 IASKSYSYDQIFYADEC------GLFWK---------------------KIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRKIFSQKRAAFQGSS--FIGQCSRSPS----RLAA*KCRSFFYQKT 1515
            I +++ ++ +  Y DEC      G FW+                     ++       +Q  +        D++T+L  +N +G   +KP+V+ K + P S +  N +  P  ++ ++ AWVT  L  +WF        K +  KR   Q  +   + QC   P     + A    R  F  KT
Sbjct:  103 IQAQAEAFAKQIYGDECTFKASHGWFWRWQKRHGISSQRIYGESEVRQTEMDPVIIFPEQPNTPVADSGYGDEVTVLLAANLTGSHKLKPLVVGKLRDPPSLRHHNQDKFPAVYHYSRNAWVTQELLREWFLEEFVPAVKRY-LKRCCLQQKAVLLVNQCPGKPPEEDLQTADGNIRVLFLSKT 285          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrkl (Jrk-like [Source:MGI Symbol;Acc:MGI:1924782])

HSP 1 Score: 95.9005 bits (237), Expect = 1.476e-36
Identity = 46/123 (37.40%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1006 QASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            + + D  A + F   F + I  ++   +QI+ ADE GLFWK +P RT + K   +  GH   +++IT++ C+NA+G   +K  V+ KA+ PRSFK  +  NLPV + + K AW+  ++F  WF
Sbjct:  144 RLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWF 266          

HSP 2 Score: 38.1206 bits (87), Expect = 1.476e-36
Identity = 19/41 (46.34%), Postives = 28/41 (68.29%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD--LQHENVEVF 1501
            VP V +YL  K L  KA+LLLDN+P HP +  L+ ++ ++F
Sbjct:  271 VPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF 311          

HSP 3 Score: 36.1946 bits (82), Expect = 1.476e-36
Identity = 22/58 (37.93%), Postives = 30/58 (51.72%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSV 1673
            +LP N  SL+QPL QG+IA  K  Y       + + LE    L      KK T+LD++
Sbjct:  314 YLPPNVASLIQPLGQGVIAAMKRNYRAG---LLHNNLEEGNDLKSF--WKKLTLLDAL 366          

HSP 4 Score: 35.8094 bits (81), Expect = 1.476e-36
Identity = 23/101 (22.77%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRS-MNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKA 896
            KR  ++++ K+ I+ +L +      +   + + E T+R IR+N++ I    ++    S +     ++ S+ E ++KA++ W   Q  K  PI      ++A
Sbjct:    6 KRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRA 106          

HSP 5 Score: 28.1054 bits (61), Expect = 1.476e-36
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F  S GW  +FK+RHS+  +
Sbjct:  119 FNPSAGWLTRFKQRHSIREI 138          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd2 (tigger transposable element derived 2 [Source:MGI Symbol;Acc:MGI:1915390])

HSP 1 Score: 95.5153 bits (236), Expect = 3.160e-29
Identity = 43/120 (35.83%), Postives = 73/120 (60.83%), Query Frame = 1
Query: 1015 ADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
             D  AA +F   F E +  ++   +QI+ AD+ GLFWK +P RT     ++S   ++ ++++I I+ C+NA+G   +   V+ KAK PR+FKG +++NLPV + + K AW+  ++   WF
Sbjct:  147 GDETAASEFCGNFQEFVERENLLPEQIYGADQTGLFWKCLPTRTLAFDTDQSTCEYRTSRERIIIMCCANATGSHKLNLCVVGKAKRPRAFKGTDLSNLPVTYFSQKSAWIEPSVLKQWF 266          

HSP 2 Score: 36.1946 bits (82), Expect = 3.160e-29
Identity = 18/58 (31.03%), Postives = 30/58 (51.72%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSV 1673
            +LP N TSL+QP+ QG++ T K  Y        +D+  +  +       K  T+LD++
Sbjct:  314 YLPPNVTSLIQPMSQGVLTTVKRYYRAGLIQKYMDEGNDPKTFW-----KNLTVLDAI 366          

HSP 3 Score: 28.8758 bits (63), Expect = 3.160e-29
Identity = 15/30 (50.00%), Postives = 19/30 (63.33%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD 1474
            VP V+K+L  K L  KA+LLLD    HP +
Sbjct:  271 VPQVQKHLKSKGLREKAVLLLDFPAAHPAE 300          

HSP 4 Score: 28.4906 bits (62), Expect = 3.160e-29
Identity = 9/17 (52.94%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSL 982
            F AS GW  +FK+RH +
Sbjct:  119 FNASSGWLTRFKQRHGI 135          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Jrk (jerky [Source:MGI Symbol;Acc:MGI:106214])

HSP 1 Score: 91.6633 bits (226), Expect = 7.263e-29
Identity = 45/123 (36.59%), Postives = 70/123 (56.91%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            +AD  AA+QF   F    A    S +Q++ ADE GL W+ +P        + +    K  KD++T+L C+NA+G   +KP+ I K   PR+F+G  I +LP+ + A   AWV   +F+DWF++
Sbjct:  156 AADHQAAEQFCGFFRSLAAEHGLSPEQVYSADETGLVWRCLPNSA---PDDGTVPHFKQGKDRLTVLMCANATGSHRIKPLAIGKGGGPRAFRG--IQHLPIAYKAQGNAWVDKEIFSDWFHH 273          

HSP 2 Score: 34.2686 bits (77), Expect = 7.263e-29
Identity = 15/26 (57.69%), Postives = 18/26 (69.23%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYI 1577
            FLP + TSLLQP +QGI   F  L+I
Sbjct:  319 FLPSSVTSLLQPTEQGIRRAFMRLFI 344          

HSP 3 Score: 31.187 bits (69), Expect = 7.263e-29
Identity = 25/120 (20.83%), Postives = 58/120 (48.33%), Query Frame = 3
Query:  567 GKGKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCR-SMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQI 923
             KGK  K+  KR  ++L+ KI I  RL   E    + + +++  +T+  I+ ++  + +   +   R ++     +    +E +++ L  W   +  + IP+    + EKA   Y+++++
Sbjct:    8 AKGKGEKR--KRVVLTLKEKIDICTRLERGESRKALMQEYNVGMSTLYDIKAHKAQLLRFFASSDSRQALEQRRTLHTPKLEHLDRVLYEWFLVKRAEGIPVSGPMLIEKAKDFYKQMRL 125          

HSP 4 Score: 25.7942 bits (55), Expect = 7.263e-29
Identity = 18/44 (40.91%), Postives = 24/44 (54.55%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELP--FKALLLLDNAPGHPQ--DLQHENVEVFF 1504
            VP V ++     LP   KA+LLLD++  H Q  +L  ENV   F
Sbjct:  276 VPSVREHFRTIGLPEDSKAILLLDHSRAHSQESELVSENVFTIF 319          

HSP 5 Score: 24.2534 bits (51), Expect = 7.263e-29
Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL 991
            +P   S GW  +FK RH +  L
Sbjct:  127 EPCVFSGGWLWRFKARHGIKKL 148          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd4 (tigger transposable element derived 4 [Source:MGI Symbol;Acc:MGI:2685264])

HSP 1 Score: 72.0182 bits (175), Expect = 1.674e-13
Identity = 44/131 (33.59%), Postives = 63/131 (48.09%), Query Frame = 1
Query: 1078 YSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRKIFSQKRAAFQGSSFIGQCSRSPS 1470
            Y    +F   E GL ++ +P  TF  K    + G K  KD+IT+   +N  G   +  ++I K + PR FKG  I +LPVY+ AN+ AW+TA +F  W         K  +QKR       F+  C   P 
Sbjct:  174 YHPKNVFNVKETGLLYRMLPTNTFAFKGETCSVG-KLCKDRITLALGTNMDGSEKLPLLIIGKNRAPRCFKG--IKSLPVYYEANRTAWMTAAIFEQWMQK---LDEKFQAQKRRVV---IFVDSCPAHPE 295          

HSP 2 Score: 24.6386 bits (52), Expect = 1.674e-13
Identity = 8/17 (47.06%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSL 982
            F  S+GW ++FK R+ L
Sbjct:  126 FKCSNGWLDRFKSRYGL 142          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Match: Tigd5 (tigger transposable element derived 5 [Source:MGI Symbol;Acc:MGI:2145902])

HSP 1 Score: 65.855 bits (159), Expect = 1.446e-10
Identity = 31/106 (29.25%), Postives = 55/106 (51.89%), Query Frame = 1
Query: 1075 SYSYDQIFYADECGLFWKKIPER--TFLTKQNKSASG--HKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
             Y  +QI+ A+  GL+W+ +PE+  T  T  +K   G   +   D++T+L  +N +G   +KP+VI +   P S +  N +  P  +  +  AW++  L   WF+ 
Sbjct:  237 GYGDEQIYNANVTGLYWRLLPEQASTPGTGDSKEPGGCSRRWRSDRVTVLLAANLTGSHKLKPLVIGQLPDPPSLRHHNQDKFPASYRYSPDAWLSRPLLRGWFFE 342          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q9Y4A0|JERKL_HUMAN (Jerky protein homolog-like OS=Homo sapiens OX=9606 GN=JRKL PE=2 SV=2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.844e-36
Identity = 47/123 (38.21%), Postives = 74/123 (60.16%), Query Frame = 1
Query: 1006 QASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            + + D  A + F   F + I  ++   +QI+ ADE GLFWK +P R  + K   +  GHK+ ++++TI+ C+NA+G   +K  V+ KAK PRSFK  +  NLPV + + K AW+  ++F  WF
Sbjct:  144 RLNGDETAVEDFCNNFRDFIERENLQPEQIYNADETGLFWKCLPSRISVIKGKCTVPGHKSIEERVTIMCCANATGLHKLKLCVVGKAKKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWF 266          

HSP 2 Score: 38.5058 bits (88), Expect = 1.844e-36
Identity = 23/58 (39.66%), Postives = 30/58 (51.72%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSV 1673
            +LP N  SL+QP DQG+IAT K  Y         + LE    L      KK T+LD++
Sbjct:  314 YLPPNVASLIQPSDQGVIATMKRNYRAGLLQ---NNLEEGNDLKSF--WKKLTLLDAL 366          

HSP 3 Score: 38.1206 bits (87), Expect = 1.844e-36
Identity = 19/41 (46.34%), Postives = 28/41 (68.29%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD--LQHENVEVF 1501
            VP V +YL  K L  KA+LLLDN+P HP +  L+ ++ ++F
Sbjct:  271 VPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF 311          

HSP 4 Score: 34.6538 bits (78), Expect = 1.844e-36
Identity = 22/101 (21.78%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRS-MNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKA 896
            KR  ++++ K+ I+ +L +      +   + + E T+R IR+N++ I    ++    S +     ++ S+ E +++A++ W   Q  K  PI      ++A
Sbjct:    6 KRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDRAMLEWFNQQRAKGNPISGPICAKRA 106          

HSP 5 Score: 28.1054 bits (61), Expect = 1.844e-36
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F  S GW  +FK+RHS+  +
Sbjct:  119 FNPSAGWLTRFKQRHSIREI 138          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|B2RRL2|JERKL_MOUSE (Jerky protein homolog-like OS=Mus musculus OX=10090 GN=Jrkl PE=2 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 8.996e-36
Identity = 46/123 (37.40%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1006 QASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            + + D  A + F   F + I  ++   +QI+ ADE GLFWK +P RT + K   +  GH   +++IT++ C+NA+G   +K  V+ KA+ PRSFK  +  NLPV + + K AW+  ++F  WF
Sbjct:  144 RLNGDETAVEDFCNNFRDFIEQENLQPEQIYNADETGLFWKCLPSRTTVIKGKCTVPGHNLGEERITVMCCTNATGLHKLKLCVVGKARKPRSFKSTDTLNLPVSYFSQKGAWMDLSIFRQWF 266          

HSP 2 Score: 38.1206 bits (87), Expect = 8.996e-36
Identity = 19/41 (46.34%), Postives = 28/41 (68.29%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD--LQHENVEVF 1501
            VP V +YL  K L  KA+LLLDN+P HP +  L+ ++ ++F
Sbjct:  271 VPQVREYLRSKGLQEKAVLLLDNSPTHPNENVLRSDDGQIF 311          

HSP 3 Score: 36.1946 bits (82), Expect = 8.996e-36
Identity = 22/58 (37.93%), Postives = 30/58 (51.72%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSV 1673
            +LP N  SL+QPL QG+IA  K  Y       + + LE    L      KK T+LD++
Sbjct:  314 YLPPNVASLIQPLGQGVIAAMKRNYRAG---LLHNNLEEGNDLKSF--WKKLTLLDAL 366          

HSP 4 Score: 35.8094 bits (81), Expect = 8.996e-36
Identity = 23/101 (22.77%), Postives = 50/101 (49.50%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRS-MNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKA 896
            KR  ++++ K+ I+ +L +      +   + + E T+R IR+N++ I    ++    S +     ++ S+ E ++KA++ W   Q  K  PI      ++A
Sbjct:    6 KRVVLTIKDKLDIIKKLEDGGSSKQLAVIYGIGETTVRDIRKNKEKIITYASSSDSTSLLAKRKSMKPSMYEELDKAMLEWFNQQRAKGNPISGPICAKRA 106          

HSP 5 Score: 28.1054 bits (61), Expect = 8.996e-36
Identity = 9/20 (45.00%), Postives = 13/20 (65.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F  S GW  +FK+RHS+  +
Sbjct:  119 FNPSAGWLTRFKQRHSIREI 138          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|O75564|JERKY_HUMAN (Jerky protein homolog OS=Homo sapiens OX=9606 GN=JRK PE=1 SV=3)

HSP 1 Score: 102.064 bits (253), Expect = 9.153e-32
Identity = 51/123 (41.46%), Postives = 73/123 (59.35%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            SAD  AA+QF   F    A    S +Q++ ADE GLFW+ +P  T    +  +  G K  KD++T+L C+NA+G   +KP+ I K   PR+FKG  I +LPV + A   AWV   +F+DWF++
Sbjct:  156 SADHQAAEQFCAFFRSLAAEHGLSAEQVYNADETGLFWRCLPNPT---PEGGAVPGPKQGKDRLTVLMCANATGSHRLKPLAIGKCSGPRAFKG--IQHLPVAYKAQGNAWVDKEIFSDWFHH 273          

HSP 2 Score: 36.965 bits (84), Expect = 9.153e-32
Identity = 25/118 (21.19%), Postives = 57/118 (48.31%), Query Frame = 3
Query:  573 GKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSI-RKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQI 923
            GK   +  KR  ++L+ KI I  RL   E    + + +++  +T+  IR ++  + R   ++   +++     +    +E +++ L  W   +  + +P+    + EKA   YE++Q+
Sbjct:    8 GKSRGEKRKRVVLTLKEKIDICTRLEKGESRKALMQEYNVGMSTLYDIRAHKAQLLRFFASSDSNKALEQRRTLHTPKLEHLDRVLYEWFLGKRSEGVPVSGPMLIEKAKDFYEQMQL 125          

HSP 3 Score: 29.261 bits (64), Expect = 9.153e-32
Identity = 10/17 (58.82%), Postives = 14/17 (82.35%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGI 1550
            FLP +  SL+QP++QGI
Sbjct:  319 FLPASVASLVQPMEQGI 335          

HSP 4 Score: 27.7202 bits (60), Expect = 9.153e-32
Identity = 16/41 (39.02%), Postives = 24/41 (58.54%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELP--FKALLLLDNAPGHPQDLQHENVEVF 1501
            VP V ++     LP   KA+LLLD++  HPQ+ +  +  VF
Sbjct:  276 VPSVREHFRTIGLPEDSKAVLLLDSSRAHPQEAELVSSNVF 316          

HSP 5 Score: 24.6386 bits (52), Expect = 9.153e-32
Identity = 9/22 (40.91%), Postives = 12/22 (54.55%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL 991
            +P   S GW  +FK RH +  L
Sbjct:  127 EPCVFSGGWLWRFKARHGIKKL 148          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q96MW7|TIGD1_HUMAN (Tigger transposable element-derived protein 1 OS=Homo sapiens OX=9606 GN=TIGD1 PE=1 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 4.766e-31
Identity = 80/299 (26.76%), Postives = 132/299 (44.15%), Query Frame = 1
Query: 1039 FPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRKIF-SQKRAAFQGSSFIGQCSRSPSRLAA*KCRSFFYQKTQLLCYNLWTKG*LPHSRHCTL*APLCIF*INWKMMALFQL-------SIPGKSLRFW-------ILLNIAISYRKIKKSTLHACLKAVWPDVVDKNINLTVSLGQEYSDIIEFAHTIGGEGFDDLAIGRKIGNYFQQHD 1890
            +P+  ++ I    Y+  QIF  DE   +WKK+P RTF+ ++ KS  G KA+KD++T+L  +NA+GD  +KP++I  +++PR+ K    + LPV +  N KA +TA LF  WF        + + S+K+  F+    I      P  L         Y++  ++     T   L       +      +  N    AL  +       S   K   FW        + NI  S+ ++K STL    K + P ++D       S+ +  +D++E A  +  E          +    Q HD
Sbjct:  165 YPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVPGFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYFKPTVETYCSEKKIPFKILLLIDNAPSHPRALME------IYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDDYEGFKTSVEEVSADVVEIAKELELE-----VEPEDVTELLQSHD 452          

HSP 2 Score: 43.1282 bits (100), Expect = 4.766e-31
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 3
Query:  771 MNTTS-HVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQ 920
            MNT     RNS++  MEK LV+W+EDQ  + IP+  + I  KAL ++  ++
Sbjct:   67 MNTRMIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMK 117          

HSP 3 Score: 28.8758 bits (63), Expect = 4.766e-31
Identity = 10/20 (50.00%), Postives = 14/20 (70.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F AS GWF +FK+R   H++
Sbjct:  129 FEASRGWFMRFKERSHFHNI 148          

HSP 4 Score: 59.6918 bits (143), Expect = 3.437e-15
Identity = 30/65 (46.15%), Postives = 45/65 (69.23%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSR-----KKFTILDSVKH 1679
            F+P NTTS+LQP+DQG+I+TFK+ Y+ +TF   L  +++D S     S+     K FTILD++K+
Sbjct:  322 FMPANTTSILQPMDQGVISTFKSYYLRNTFHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKN 386          

HSP 5 Score: 45.4394 bits (106), Expect = 3.437e-15
Identity = 21/41 (51.22%), Postives = 28/41 (68.29%), Query Frame = 2
Query: 1388 PDVEKYLVKKELPFKALLLLDNAPGHPQDLQ--HENVEVFF 1504
            P VE Y  +K++PFK LLL+DNAP HP+ L   +E + V F
Sbjct:  282 PTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIF 322          
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Match: sp|Q17RP2|TIGD6_HUMAN (Tigger transposable element-derived protein 6 OS=Homo sapiens OX=9606 GN=TIGD6 PE=2 SV=2)

HSP 1 Score: 88.1965 bits (217), Expect = 1.820e-29
Identity = 50/128 (39.06%), Postives = 71/128 (55.47%), Query Frame = 1
Query: 1075 SYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRKIFSQKRAAFQGSSFIGQCS 1458
             YS D IF ADE G+F++ +P+ T   K +    G KA K ++T LFC NASG   M+P+++ ++  P   K  NI++LP  + AN+ AW+T  LFN+W     AR       KRA  +    I  CS
Sbjct:  169 DYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKA-KQRLTALFCCNASGTEKMRPLIVGRSASPHCLK--NIHSLPCDYRANQWAWMTRDLFNEWLMQVDAR------MKRAERRILLLIDNCS 287          

HSP 2 Score: 46.595 bits (109), Expect = 1.820e-29
Identity = 36/139 (25.90%), Postives = 70/139 (50.36%), Query Frame = 3
Query:  585 KKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIREN----EDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIRNLLLQVTVGSKNLKRGIHCIV 989
            K N KR+  SLE K+ ++G + + +R  D+ + F +  +T+ T  ++    E+ +R++      + M      R+++ + ++KA+  W ++ + K I +  + I +KAL +   L   N   Q +VG  N  R  H I 
Sbjct:    4 KGNKKRRQFSLEEKMKVVGAVDSGKRKGDVAKEFGITPSTLSTFLKDRTKFEEKVREASVGPQRKRM------RSALYDDIDKAVFAWFQEIHAKNILVTGSVIRKKALNLANMLGYDN--FQASVGWLNRFRDRHGIA 134          

HSP 3 Score: 38.1206 bits (87), Expect = 1.820e-29
Identity = 21/61 (34.43%), Postives = 32/61 (52.46%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSVKHS 1682
            +LP N T++LQPL+ GII T K LY       IL KL +      +D ++   ++ +   S
Sbjct:  302 YLPSNCTAVLQPLNLGIIHTMKVLYQSHLLKQILLKLNSSEDQEEVDIKQAIDMIAAAWWS 362          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: T2M7L0 (Tigger transposable element-derived protein 1 (Fragment) OS=Hydra vulgaris OX=6087 GN=TIGD1 PE=2 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 2.686e-84
Identity = 67/125 (53.60%), Postives = 88/125 (70.40%), Query Frame = 1
Query: 1006 QASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            QASAD+ AA++F     E I  + Y  DQIF ADE GL+WKK+P RT ++   K ASG K++K +ITI  CSN SG  ++KP++IN   +PR+FK  N++ LPV+W ANKKAW+T  LF DWFYN
Sbjct:  238 QASADVKAAEKFKTDLPEIIDKEGYVADQIFNADETGLYWKKLPSRTHISINEKKASGFKSSKQRITIHKCSNLSGSLLIKPMIINNFLNPRAFKNVNMSELPVFWRANKKAWMTRELFKDWFYN 362          

HSP 2 Score: 97.0561 bits (240), Expect = 2.686e-84
Identity = 52/112 (46.43%), Postives = 73/112 (65.18%), Query Frame = 3
Query:  585 KKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQ 920
            +K MKRK I+L  K  IL RL+N E+V  + +  ++NE+TIRT+++NE  IRK+V           + +RN+IM  ME+AL+IWLED   K+IP+  N I  KALKIYE  +
Sbjct:   88 RKYMKRKSITLMEKTAILDRLKNGEKVFSVAKSLNLNESTIRTLKKNEVKIRKTVANSCPSGAKRATRIRNAIMIKMERALMIWLEDCVSKKIPVCGNLIKRKALKIYEHFK 199          

HSP 3 Score: 58.9214 bits (141), Expect = 2.686e-84
Identity = 27/60 (45.00%), Postives = 38/60 (63.33%), Query Frame = 3
Query: 1497 FFLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSVK 1676
             + P N TSL+QPLDQGII TFK  YI   F  I  +LE+    ++++  K+F+ILD  +
Sbjct:  403 LYFPPNCTSLIQPLDQGIIQTFKMYYIQIFFEVIFSRLEDQEWKTLLEVWKEFSILDCTR 462          

HSP 4 Score: 47.3654 bits (111), Expect = 2.686e-84
Identity = 19/40 (47.50%), Postives = 28/40 (70.00%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQDLQHENVEVFF 1504
            VP VE ++V+K L F+ LL+LDNA  H  ++ H NV+V +
Sbjct:  365 VPQVESFMVEKNLSFRVLLILDNASSHSAEINHPNVKVLY 404          

HSP 5 Score: 42.3578 bits (98), Expect = 2.686e-84
Identity = 46/192 (23.96%), Postives = 81/192 (42.19%), Query Frame = 1
Query: 1678 IAISYRKIKKSTLHACLKAVWPDVVDKNINLTVSLGQEYSDIIEFAHTIGGEGFDDL---------------------AIGRKIGNYFQQHDPNVERALRFQ*AINESLNQYEEVYKDLTKN-----KSQFLIRDF---------ISKSYRTEINPIPTTERYEILSSDDSDIIETTKRR----LIVESDSD 2136
            ++++  +IK+STL+AC + + P +V K  N++    +   +I     + G EGF D+                      I       F + D N + AL F   + + L+  EE+   LT+N     +S+   R+F         + K  + +I      E ++  S +D  +I   KRR    LI +SD +
Sbjct:  464 VSLACTEIKQSTLNACWRPLLPQIVKKEDNIS----ETVKEITRIVSSFGKEGFADIQVQDIEQLLQERSLNEEELAELIDESTSETFVEEDTNNKSALNFTYDLKKGLDLAEELEFQLTQNDPSTIRSEKFKREFQNCLAPYKEVLKELQNKITFENQGENFQ--SEEDYQLIRVKKRRRIGHLIFDSDDE 649          

HSP 6 Score: 35.8094 bits (81), Expect = 2.686e-84
Identity = 13/21 (61.90%), Postives = 17/21 (80.95%), Query Frame = 2
Query:  929 PFTASHGWFEKFKKRHSLHSL 991
             FTAS GW +K KKR+SLH++
Sbjct:  212 SFTASAGWLDKLKKRYSLHNI 232          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A4Y2B316 (Tigger transposable element-derived protein 1 OS=Araneus ventricosus OX=182803 GN=TIGD1_66 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 2.461e-75
Identity = 124/389 (31.88%), Postives = 198/389 (50.90%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRKIF-SQKRAAFQGSSFIGQCSRSPSRLAA*KCRSFFY-----QKTQLLCYNLWTKG*LPHSRHCTL*APLCIF*INWKMMALFQLSIPGKSL---RFW---------ILLNIAISYRKIKKSTLHACLKAVWPDVVDKNINLTVSLGQEYSDIIEFAHTIGGEGFDD---------------------------------------------------LAIGRKIGNYFQQHDPNVERALRFQ*AINESLNQYEEVYKD 1968
            A  D  AA ++P++FS+ I   +Y+ DQ+F A+E GLFWKK+P RT+L++  +S +G KA+K++IT+L CSNASGD +MKP+VI+++ +PR+ K  +  NLPVYW A+ K  VT  +F DWFYN      +++  +K  +F+    I    R P+ L     +  F         Q L  +++T     + +H        IF        +      G +L   R W          L+ +AI+  +IKKSTL+AC K++WPDVV    ++  +L  EYS+I+  AH +GGEGFDD                                                   LA+ +++ N+F Q+DPN++R+L+F   ++  +  Y+++ +D
Sbjct:  155 AITDEKAATEYPKEFSKIIQDGAYTPDQVFNANEMGLFWKKMPRRTYLSQSERSNAGFKASKERITVLLCSNASGDYLMKPMVISRSLNPRAMKSLDKGNLPVYWKADNKTCVTVPIFRDWFYNCFVSDVELYVKEKNLSFKVLLLIDSAPRHPTDLHHDNVKVVFLPPNTASLIQPLERSIFTTFNAYYIKH--------IF------KRIVDEVNSGNTLSVTRVWENYSIVDCVELIKLAIT--EIKKSTLNACWKSIWPDVVVSGHDVP-ALENEYSEIMRLAHRVGGEGFDDMASNELEELMTDSEFNAAKQVEVVFDSTSSEDETDCDEKVPRLTLCTIDKGLAMAKELENFFIQNDPNMDRSLKFARELHNCMASYKKLSED 526          

HSP 2 Score: 114.775 bits (286), Expect = 2.461e-75
Identity = 55/114 (48.25%), Postives = 84/114 (73.68%), Query Frame = 3
Query:  585 KKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIR 926
            K+ +KRK I+LETKI IL RL+  E    + + F +NEAT+RTI++NE+ IR SV AG   S+  TSHVR++ +E+MEKAL+ W+E+  QK+IPI+ +AI +KA++I+  ++ +
Sbjct:    5 KQGLKRKRITLETKIQILDRLKTGEGSSSVAKHFELNEATVRTIKKNEEKIRASVAAGCSESLKRTSHVRDTTLELMEKALIHWVEENIQKKIPIEGDAIRQKAVEIFNNIKAK 118          

HSP 3 Score: 27.7202 bits (60), Expect = 2.461e-75
Identity = 11/17 (64.71%), Postives = 13/17 (76.47%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSL 982
            F+ S GW E+FKKR SL
Sbjct:  129 FSGSKGWLERFKKRFSL 145          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A2A4JVK0 (HTH CENPB-type domain-containing protein OS=Heliothis virescens OX=7102 GN=B5V51_10937 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 8.846e-69
Identity = 58/116 (50.00%), Postives = 90/116 (77.59%), Query Frame = 1
Query: 1033 KQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            +++P++F+  +A   Y+ +QIF ADE GLFWK++P + F++K  KSA G KA KD++T+L CSNASGDC++KP+++ +  +PR+ + +N +NLPV+W A+KKAWVT+ +F DWF N
Sbjct:  166 ERYPEEFANLVADGGYTPEQIFNADETGLFWKRMPNKIFISKSEKSAPGFKAAKDRVTLLLCSNASGDCVIKPLMLYRCLNPRALQNQNKDNLPVFWRADKKAWVTSAVFCDWFRN 281          

HSP 2 Score: 81.2629 bits (199), Expect = 8.846e-69
Identity = 43/104 (41.35%), Postives = 67/104 (64.42%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIY 908
            K+  + L+ KI +L RLR  E    I+R F +NE+T+R+I+++ED IR SV +    +  +   VR+  +E ME AL +W+ED+NQKR+P+    I EKA ++Y
Sbjct:   14 KKSVLPLKVKIEMLDRLRLGESFASISRSFDVNESTVRSIKKSEDRIRSSVAS----TSLSAKVVRDPAIEKMEVALSLWIEDRNQKRVPLSGPMIREKAKRLY 113          

HSP 3 Score: 52.7582 bits (125), Expect = 8.846e-69
Identity = 33/75 (44.00%), Postives = 42/75 (56.00%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQDL--QHENVEVFFTKKHNFFVTTFGPRDNCHIQGIVHYKHLYVYFR 1603
            VP+VE YL  K L FKA+L+LDNAPGHP++L   H N++V F   +        P D    QGI+    LY   R
Sbjct:  284 VPEVETYLKSKNLDFKAVLVLDNAPGHPRELGTMHPNIKVTFLPPNT--TALLQPMD----QGIIQAFKLYYIRR 352          

HSP 4 Score: 41.2022 bits (95), Expect = 8.846e-69
Identity = 34/160 (21.25%), Postives = 64/160 (40.00%), Query Frame = 1
Query: 1669 LLNIAISYRKIKKSTLHACLKAVWPDVVDKNINLTVSLGQEYSDIIEFAHTIGGEGFD-------------------------------------------------DLAIGRKIGN----YFQQHDPNVERALRFQ*AINESLNQYEEVYKDLTKNKSQ 1989
            ++NI  S +++K  TL +C K +WP ++  N   ++ +    ++I E A  IG +GF+                                                 +L+ G ++ N    +F + DP++ER+L F+  I  +  +Y+   K+L K   Q
Sbjct:  382 IINIKESLQELKPHTLKSCWKKLWPVLMAGNEEESLQIQSLAANIAEIASEIGRDGFEQIESSDVQELLASQDEDLTETDLEEMINSQPMEEEEALTSTGNVTFNMKNLSEGLRMANELCDFFMKIDPSMERSLIFKRKIANATAEYQSELKELLKTAKQ 541          

HSP 5 Score: 34.2686 bits (77), Expect = 8.846e-69
Identity = 13/25 (52.00%), Postives = 18/25 (72.00%), Query Frame = 2
Query:  926 KPFTASHGWFEKFKKRHSLHSL*LI 1000
            + F AS GWF KFK R SLH++ ++
Sbjct:  130 RGFQASEGWFNKFKMRQSLHNIKIV 154          

HSP 6 Score: 67.3958 bits (163), Expect = 8.787e-8
Identity = 30/54 (55.56%), Postives = 39/54 (72.22%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTI 1661
            FLP NTT+LLQP+DQGII  FK  YI  TF +ILD +E +  +S+++  KKF I
Sbjct:  325 FLPPNTTALLQPMDQGIIQAFKLYYIRRTFKFILDNMECNPDMSVMECWKKFDI 378          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A085MYN5 (HTH CENPB-type domain-containing protein OS=Trichuris suis OX=68888 GN=M514_08364 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 7.864e-67
Identity = 56/122 (45.90%), Postives = 79/122 (64.75%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            ASAD ++A  FPQ+F   +  K Y  +Q++  DE  LFWKK+P RT++ K  + A G KA KD++T++ C NA+G  I KP VI +A  PR  K K+  + PV+W  N+KAW+TA LF +W 
Sbjct:  162 ASADQESASTFPQEFRRLVGRKGYLPEQVYNCDETALFWKKMPSRTYIHKDARQAMGFKAFKDRLTLVLCGNAAGHMI-KPGVIYRACTPRPLKNKSKESFPVFWQHNRKAWMTAILFLEWL 282          

HSP 2 Score: 73.9442 bits (180), Expect = 7.864e-67
Identity = 41/117 (35.04%), Postives = 67/117 (57.26%), Query Frame = 3
Query:  567 GKGKDSKKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKL 917
            G+     + M+RK +SL  K+ IL  L +     ++ R    NE++IR+I++ +  IR+S+ A    +    S VR+ ++   EKAL +W+ED +QK +P+D   I EKAL +YE  
Sbjct:    9 GRRTSLHEKMERKVLSLYEKLKILDLLNSGMSCAEVGRRVGKNESSIRSIKQKQAEIRQSLCAAPTMA-KRVSVVRDKVLVKAEKALTLWIEDMSQKHVPVDGRMIREKALSLYEHF 124          

HSP 3 Score: 60.077 bits (144), Expect = 7.864e-67
Identity = 28/58 (48.28%), Postives = 36/58 (62.07%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSV 1673
            FLP N+T LLQPLDQGI+   KA Y   TF  I D L+ +   S++ S K F I D++
Sbjct:  328 FLPPNSTPLLQPLDQGIMKCVKATYTRLTFQRIRDALDANPHFSVMQSWKSFNIADAI 385          

HSP 4 Score: 54.6842 bits (130), Expect = 7.864e-67
Identity = 27/42 (64.29%), Postives = 31/42 (73.81%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD--LQHENVEVFF 1504
            +P+V+ YL  K LPFKALLL+DNAPGHPQ      ENVEV F
Sbjct:  287 IPEVKSYLRAKGLPFKALLLIDNAPGHPQAACAADENVEVVF 328          

HSP 5 Score: 38.1206 bits (87), Expect = 7.864e-67
Identity = 21/61 (34.43%), Postives = 35/61 (57.38%), Query Frame = 1
Query: 1669 LLNIAISYRKIKKSTLHACLKAVWPDVVDKNINLTVSLGQEYSDIIEFAHTIGGEGFDDLA 1851
            ++ IA + + IK S+++AC + +W +VV+ +     S   E  +I   A  IGGEGF D+ 
Sbjct:  385 IILIAEAVQAIKHSSVNACWRPLWRNVVN-DFKGFPSADTELENIRNIAMEIGGEGFSDMV 444          
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Match: A0A3Q1C7G7 (HTH CENPB-type domain-containing protein OS=Amphiprion ocellaris OX=80972 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 9.727e-67
Identity = 56/124 (45.16%), Postives = 87/124 (70.16%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            ASAD +AA++FPQ   E I    YS  Q+F  DE GLFWKK+PE+T+++++ K+  G+KA KD++T++  +NA G   +KP+++ +A +PR+ K    ++LPV W +N KAWVT  +F DWF++
Sbjct:  162 ASADKEAAERFPQVLKEIIEEGGYSAKQVFNVDETGLFWKKMPEKTYISREEKTMPGYKAAKDRLTLMLGANADGSFKLKPLLVYRAANPRALKNVTKSSLPVIWMSNIKAWVTLAVFEDWFFH 285          

HSP 2 Score: 80.8777 bits (198), Expect = 9.727e-67
Identity = 43/110 (39.09%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIR 926
            KR+ IS E K+ I+ +L   E+++ + R ++MN +TI TI + +D I + V   +       S  R  I+E MEK L IWLEDQ Q+RIP+    I EKA  I+E ++ +
Sbjct:   17 KRQAISFEMKVAIIKKLDAGEKMVSVARAYNMNRSTIGTIYKQKDRIMEHVKGAVPMQSTIISKKRGKILEEMEKLLTIWLEDQQQRRIPLSLMLIQEKAKSIFEDVKAK 126          

HSP 3 Score: 55.8398 bits (133), Expect = 9.727e-67
Identity = 24/59 (40.68%), Postives = 37/59 (62.71%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSVK 1676
            +LP NTTSLLQP+DQG+IA FK  Y   T+   L  +++D  +++    K + I + +K
Sbjct:  329 YLPPNTTSLLQPMDQGVIANFKKYYTRRTYRMALTAVDSDPEMTLRSYWKSYNIFNCIK 387          

HSP 4 Score: 40.817 bits (94), Expect = 9.727e-67
Identity = 20/42 (47.62%), Postives = 29/42 (69.05%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQDLQ--HENVEVFF 1504
            +P+V+ Y  +  +PFK LL+LDNAPGHP  L   H +V+V +
Sbjct:  288 IPEVKLYCRENGIPFKILLVLDNAPGHPPHLDDFHPDVKVVY 329          

HSP 5 Score: 36.965 bits (84), Expect = 9.727e-67
Identity = 13/18 (72.22%), Postives = 16/18 (88.89%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLH 985
            F+ASHGWF +FKKR +LH
Sbjct:  136 FSASHGWFSRFKKRANLH 153          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005656.1 (pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1 gene:ENSPMAG00000005132.1 transcript:ENSPMAT00000005656.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.724 bits (330), Expect = 3.181e-40
Identity = 56/124 (45.16%), Postives = 85/124 (68.55%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            A AD++AA+ F     E I    YS +Q+F  +E GLFWK++P  TFL+++ K+A G KA+KD++ +L  +NA+GDC +KP+++  +K PR+ KG    +LPV W +NKK W+TA++F DW  N
Sbjct:  156 AGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETGLFWKRMPASTFLSREEKTAPGFKASKDRLALLVGANAAGDCKLKPLLVYHSKTPRALKGCIKADLPVIWRSNKKGWITASVFLDWLKN 279          

HSP 2 Score: 46.595 bits (109), Expect = 3.181e-40
Identity = 26/98 (26.53%), Postives = 51/98 (52.04%), Query Frame = 3
Query:  633 ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIR 926
            I+ R    E V DI++   +  +T+  I +  ++I+              +  R+ +ME ME++L +W++ QN+ R+P+ T  I  KAL+++   + R
Sbjct:   23 IIRRYEGGETVRDISKSLGLATSTVCGIHKASENIKARAQRMTPLVAAKLTRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQAKALRLFNDFKKR 120          

HSP 3 Score: 25.7942 bits (55), Expect = 3.181e-40
Identity = 11/20 (55.00%), Postives = 14/20 (70.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F AS GW+ KFK R++L  L
Sbjct:  130 FGASTGWYAKFKGRYNLRHL 149          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001313.1 (pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gene:ENSPMAG00000001181.1 transcript:ENSPMAT00000001313.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 1.561e-36
Identity = 53/124 (42.74%), Postives = 82/124 (66.13%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            A AD++AA+ F     E I    YS +Q+F  +E  LFWK++P  TFL+++ K+A G KA+KD++ +L  +N +GDC +KP+++  +K PR  KG    +LP+ W +NKK W+TA++F DW  N
Sbjct:  154 AGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKN 276          

HSP 2 Score: 43.1282 bits (100), Expect = 1.561e-36
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 3
Query:  633 ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKAL 899
            I+ +    E V DI++   +  +T+  IR+  ++I             T    R+ +ME ME++L +W++ QN+ R+P+ T  I  KAL
Sbjct:   23 IIRQYEGGETVRDISKSLGLATSTVCGIRKASENIEAKAQRMTPFVAATLMRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQVKAL 111          

HSP 3 Score: 28.4906 bits (62), Expect = 1.561e-36
Identity = 12/20 (60.00%), Postives = 15/20 (75.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F AS GW+ KFK R++LH L
Sbjct:  128 FGASTGWYAKFKGRYNLHHL 147          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010132.1 (pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 gene:ENSPMAG00000009170.1 transcript:ENSPMAT00000010132.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 120.168 bits (300), Expect = 1.653e-36
Identity = 53/124 (42.74%), Postives = 82/124 (66.13%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            A AD++AA+ F     E I    YS +Q+F  +E  LFWK++P  TFL+++ K+A G KA+KD++ +L  +N +GDC +KP+++  +K PR  KG    +LP+ W +NKK W+TA++F DW  N
Sbjct:  153 AGADVEAAEAFKSTLKEIIEGGGYSPEQVFNVNETRLFWKRMPASTFLSREKKTAPGFKASKDRLALLVGANGAGDCRLKPLLVYHSKTPRYLKGCIKADLPI-WRSNKKGWITASVFLDWLKN 275          

HSP 2 Score: 43.1282 bits (100), Expect = 1.653e-36
Identity = 26/89 (29.21%), Postives = 46/89 (51.69%), Query Frame = 3
Query:  633 ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKAL 899
            I+ +    E V DI++   +  +T+  IR+  ++I             T    R+ +ME ME++L +W++ QN+ R+P+ T  I  KAL
Sbjct:   22 IIRQYEGGETVRDISKSLGLATSTVCGIRKASENIEAKAQRMTPFVAATLMRKRSPLMENMEESLGMWIKHQNEHRMPLSTALIQVKAL 110          

HSP 3 Score: 28.4906 bits (62), Expect = 1.653e-36
Identity = 12/20 (60.00%), Postives = 15/20 (75.00%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL 991
            F AS GW+ KFK R++LH L
Sbjct:  127 FGASTGWYAKFKGRYNLHHL 146          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: JRKL (JRK like [Source:HGNC Symbol;Acc:HGNC:6200])

HSP 1 Score: 83.9593 bits (206), Expect = 1.021e-31
Identity = 40/121 (33.06%), Postives = 70/121 (57.85%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            +A+  AA++   KF E    +  S  Q++ A E GL+WK +P RT       +A   +  +D+I +L C++A+G   +   V+ +A HPR F+  +++ LPV++  +++AWVT  +F  WF
Sbjct:  145 AAEALAARESFMKFLE---EQGLSPQQVYAATETGLYWKSLPART-------AAGNCRVGRDRIALLLCASAAGTHRLPLAVVGRAAHPRVFRNLDVSLLPVHYYNHRRAWVTTDIFRRWF 255          

HSP 2 Score: 41.5874 bits (96), Expect = 1.021e-31
Identity = 33/131 (25.19%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSI-RKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIRNLLLQVTVGSKNLKRGIHCI 986
            KR  +SLETK+ IL RL   E    +   F++   TI  I++ ++ + R +    +   ++    +R S    +E+A+  W        +PI ++ + E+A   +E L +           +N KR  +CI
Sbjct:    4 KRIVLSLETKLRILRRLEKGETAKQLALEFNLGHRTIYDIKKAKEKLWRLNKVLDVDTGLSYMKVIRESRFPQLEEAVYKWFRQHRAMGLPITSSMLIEQARHFHEHLGLTEPFAASAGWLRNFKRR-YCI 133          

HSP 3 Score: 35.4242 bits (80), Expect = 1.021e-31
Identity = 20/42 (47.62%), Postives = 27/42 (64.29%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQD--LQHENVEVFF 1504
            VP+V + L    LP KA+LLLDN+P HP D  L   ++ VF+
Sbjct:  260 VPEVTQNLEALGLPPKAVLLLDNSPAHPDDGSLCCGDITVFY 301          

HSP 4 Score: 34.6538 bits (78), Expect = 1.021e-31
Identity = 12/26 (46.15%), Postives = 16/26 (61.54%), Query Frame = 3
Query: 1497 FFLPKNTTSLLQPLDQGIIATFKALY 1574
            F+LP N    L+PL+QG +   K LY
Sbjct:  300 FYLPPNLAPALKPLEQGAVGHLKVLY 325          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004617.1 (pep scaffold:Pmarinus_7.0:GL477874:26927:28564:-1 gene:ENSPMAG00000004208.1 transcript:ENSPMAT00000004617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.4413 bits (241), Expect = 1.415e-30
Identity = 74/291 (25.43%), Postives = 133/291 (45.70%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSCARCRK--IFSQKRAAFQGSSFIGQCSRSPSRLAA*KCRSFFYQKTQLL-CYNLWTKG*LPHSRHCTL*APLCIF*INWKMMALFQLSIPGKSLRFWILLNI-------AISYRKIKKSTLHACLKAVWP-------DVVDKNINLT-VSLGQEYSDIIEFAHTIGG 1830
             +D+DA +++  +F   +  K     QI+ ADE GLFWK +P +T  +    +A+G+K +K+ +T+L C+NASG   +K   + K+K+  + K  + + LPV++   +KAW+    F DWF+       +  +F +K     GS  I     +P+  +    ++   Q  QL  C  L+ K  L                   + +   +   P   +R W  L+I       A ++R +++  L  C K +WP       D+ + +  L+ V+L +   + +   H I G
Sbjct:  154 GSDVDAVREYIARFQAMVDDKGLCASQIYNADETGLFWKSLPSKTLASSSEVNAAGYKCSKEGMTVLMCANASGTHRLKLTCLGKSKNLGALKDLSEDCLPVHYYGQRKAWMDQFTFKDWFFTKFVPAVRDNLFREK----LGSRAILVIDNAPAHPSG---QTLQTQDGQLFKC--LYRKELL-------------------RKLLDMEDEDPETLIRHWRALSIKDALFVAASAWRHVRRDILSRCWKPIWPASFVPQVDLKEADEELSPVALQESARECLALLHDIPG 416          

HSP 2 Score: 43.1282 bits (100), Expect = 1.415e-30
Identity = 33/114 (28.95%), Postives = 54/114 (47.37%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSH---VRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIRN 929
            KR F+SLE KI +L ++R    +  I   +++   T+R IR+N D I K  +    +S N T      R++  + ++  L  W   Q  +  P+    + EKA     KL+ R 
Sbjct:    5 KRVFLSLEKKIEVLEKIRTGRSLQAIAADYNIGYTTVRDIRDNADKISKFFSE--LQSANATKKRKTTRSADNKELDAKLYEWFLQQRAQGHPVSGPMLCEKAKVFSAKLRSRQ 116          

HSP 3 Score: 31.187 bits (69), Expect = 1.415e-30
Identity = 11/27 (40.74%), Postives = 16/27 (59.26%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSLHSL*LIYIKH 1012
            F AS GW   FK+RH +  L ++  +H
Sbjct:  127 FMASQGWLRSFKERHGIRRLSVVGERH 153          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO44738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUQ6])

HSP 1 Score: 64.6994 bits (156), Expect = 3.295e-13
Identity = 30/118 (25.42%), Postives = 61/118 (51.69%), Query Frame = 1
Query: 1021 IDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            ++   ++ +K  E   +  Y    I+   E GL+++ +P++  + +   +++      +++T+  C N  G+   KP+VI    +P  F   +   LPV W AN++AW+T ++F DW 
Sbjct:  141 VNVTTEWTEKIME--VTDGYRSTDIYNLVETGLYYRALPDKNLVPETESTST------ERLTVTLCCNMDGE-FEKPLVIGPTANPPCFAKLDSECLPVIWRANRRAWITTSIFADWL 249          

HSP 2 Score: 28.8758 bits (63), Expect = 3.295e-13
Identity = 10/21 (47.62%), Postives = 15/21 (71.43%), Query Frame = 2
Query:  920 NKKPFTASHGWFEKFKKRHSL 982
            + K F AS+GW E F++RH +
Sbjct:  108 DMKDFRASNGWLEGFRRRHGI 128          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Match: EDO40000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8J7])

HSP 1 Score: 62.3882 bits (150), Expect = 9.810e-13
Identity = 40/106 (37.74%), Postives = 65/106 (61.32%), Query Frame = 1
Query: 1060 TIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPV-VINKAKHPRSFKGKNINNLPVYWNANKKAWVT-ATLFNDW 1371
            T+ SK Y+ + +F ADE GLF+K +P++    K  +S  G K +K ++T L  +++SG+ +  P+ VI K++ PR F G  + NLP  + A KK W+  + LF +W
Sbjct:  117 TLLSK-YALEDMFDADEFGLFYKALPDKLMHLKL-QSCVGGKQSKVRLTGLAAASSSGEKL--PMFVIGKSQKPRCFSG--VRNLPCRYRAPKKGWILDSNLFEEW 216          

HSP 2 Score: 25.409 bits (54), Expect = 9.810e-13
Identity = 16/50 (32.00%), Postives = 25/50 (50.00%), Query Frame = 3
Query:  807 EMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQIRNLLLQVTVGS 956
            E +EKAL  W     Q+ +PI    + E A+    +L   +++L   VGS
Sbjct:   30 EDLEKALYTWSVRMKQQGVPISGPVLKETAIHFANELI--SIVLSGFVGS 77          

HSP 3 Score: 23.483 bits (49), Expect = 9.810e-13
Identity = 7/17 (41.18%), Postives = 12/17 (70.59%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSL 982
            F  S+GW +++KKR  +
Sbjct:   74 FVGSNGWIDRWKKRQDV 90          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000036785.1 (pep primary_assembly:ASM223467v1:22:11796267:11802170:-1 gene:ENSORLG00000024024.1 transcript:ENSORLT00000036785.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 4.376e-36
Identity = 45/109 (41.28%), Postives = 67/109 (61.47%), Query Frame = 1
Query: 1048 KFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWF 1374
            KF   I   +Y  +Q+F   E GLFWK+IP +         ASG +  KD++T++ C NA+G  ++KP +I++ K+PR+ K KN++ LPVYW  N  AW+T  L  +WF
Sbjct:  142 KFKTIIKEGTYKPEQVFNMGETGLFWKQIPSQA-------KASGFRGQKDRVTLVMCGNAAG-FMIKPGLISRLKNPRALKNKNMSALPVYWMHNTMAWMTKALNLNWF 242          

HSP 2 Score: 45.4394 bits (106), Expect = 4.376e-36
Identity = 28/71 (39.44%), Postives = 40/71 (56.34%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQDLQHENVEVFFTKKHNFFVTTFGPRDNCHIQGIVH-YKHLYV 1594
            +P+V+ YL +K L FK LLL+DNA G   DL H+ V++ F   +    +   P D    QGI+  +K LY 
Sbjct:  247 IPEVKGYLTEKGLDFKVLLLIDNAGGFADDLSHDGVQIEFLPPNT--SSLIQPMD----QGIIRTFKALYT 311          

HSP 3 Score: 39.6614 bits (91), Expect = 4.376e-36
Identity = 19/74 (25.68%), Postives = 39/74 (52.70%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMME 818
            +RK +++  K+ +L  L+       + R + +NE+T+R I++ E++IR++      +       VRN  +  ME
Sbjct:    8 QRKMLTVTQKVGLLDMLKEGRSYSAVGRHYGLNESTVRYIKKEENNIRRTAAISFNKDAKRVVTVRNKTIIRME 81          

HSP 4 Score: 33.113 bits (74), Expect = 4.376e-36
Identity = 13/21 (61.90%), Postives = 16/21 (76.19%), Query Frame = 2
Query:  929 PFTASHGWFEKFKKRHSLHSL 991
            PF AS GWF+KF+KR  L S+
Sbjct:  101 PFYASKGWFDKFQKRFGLKSV 121          

HSP 5 Score: 66.2402 bits (160), Expect = 7.768e-11
Identity = 28/60 (46.67%), Postives = 44/60 (73.33%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSVKH 1679
            FLP NT+SL+QP+DQGII TFKALY  +T  +++D +++D + S  D  +++TI   ++H
Sbjct:  286 FLPPNTSSLIQPMDQGIIRTFKALYTRNTLQHLVDAMDSDQNFSFKDYWREYTIASCLQH 345          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000031980.1 (pep primary_assembly:ASM223467v1:3:6881985:6888319:-1 gene:ENSORLG00000025652.1 transcript:ENSORLT00000031980.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 9.180e-34
Identity = 51/111 (45.95%), Postives = 72/111 (64.86%), Query Frame = 1
Query: 1048 KFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYN 1380
            KF   I    Y  +QIF  DE GLFWK++P RTF+ ++   A G KA KD++T++ C NA+G  ++KP +I ++K+PR+ K KN ++L V W  N KAW+T  L  DWF N
Sbjct:   96 KFKAIIEEGGYKPEQIFNIDETGLFWKRMPSRTFIMQEEAKAPGFKAQKDRLTLVKCGNAAG-FMIKPGLIYRSKNPRALKNKNKDDLHVCWMYNAKAWMTKALNLDWFKN 205          

HSP 2 Score: 43.8986 bits (102), Expect = 9.180e-34
Identity = 28/71 (39.44%), Postives = 39/71 (54.93%), Query Frame = 2
Query: 1385 VPDVEKYLVKKELPFKALLLLDNAPGHPQDLQHENVEVFFTKKHNFFVTTFGPRDNCHIQGIVH-YKHLYV 1594
            +P V+ YL  K L FK LLL+DNA GH  DL ++ V++ F   +    +   P D    QGI+  +K LY 
Sbjct:  208 IPQVKCYLRGKGLDFKVLLLVDNAGGHADDLAYDCVQIKFLPPNT--TSLIQPMD----QGIIRAFKALYT 272          

HSP 3 Score: 29.261 bits (64), Expect = 9.180e-34
Identity = 12/28 (42.86%), Postives = 19/28 (67.86%), Query Frame = 1
Query: 1669 LLNIAISYRKIKKSTLHACLKAVWPDVV 1752
            L NI  + +++K  TL+AC K +WP+ V
Sbjct:  304 LQNIQRAIQEMKTETLNACWKKLWPEAV 331          

HSP 4 Score: 26.9498 bits (58), Expect = 9.180e-34
Identity = 10/14 (71.43%), Postives = 11/14 (78.57%), Query Frame = 2
Query:  932 FTASHGWFEKFKKR 973
            F AS GWFE FKK+
Sbjct:   77 FNASKGWFENFKKQ 90          

HSP 5 Score: 61.6178 bits (148), Expect = 1.472e-9
Identity = 27/60 (45.00%), Postives = 42/60 (70.00%), Query Frame = 3
Query: 1500 FLPKNTTSLLQPLDQGIIATFKALYIISTFMYILDKLENDGSLSIIDSRKKFTILDSVKH 1679
            FLP NTTSL+QP+DQGII  FKALY  +T  +++D +++D   S+ D  + +TI   +++
Sbjct:  247 FLPPNTTSLIQPMDQGIIRAFKALYTRNTLQHLVDAMDSDQDSSLKDYWRGYTIASCLQN 306          
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Match: ENSORLT00000029563.1 (pep primary_assembly:ASM223467v1:22:22280271:22280612:-1 gene:ENSORLG00000027274.1 transcript:ENSORLT00000029563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.9954 bits (136), Expect = 1.654e-9
Identity = 28/88 (31.82%), Postives = 50/88 (56.82%), Query Frame = 3
Query:  597 KRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKR 860
            ++K ++L  KI +L +L   +    + R + +NE+T+R I++NE  +R SV +  C S    + VR+  +  ME AL  W +D  +K+
Sbjct:   19 QKKVLTLHEKIELLDKLMGGKSYSAVGRHYGLNESTVRYIKKNEKEVRSSVASVFCGSAKMVNVVRDKTIVKMESALAFWFQDLRKKK 106          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000030786.1 (SMESG000030786.1)

HSP 1 Score: 132.88 bits (333), Expect = 1.545e-36
Identity = 66/77 (85.71%), Postives = 71/77 (92.21%), Query Frame = 3
Query:  690 MNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQ 920
            MNEATIRTIR+NEDSIRKSV A M  SMNTTS+VRNS MEMMEKALVIWLEDQNQKRIPIDTNAI+ KALKI+EKL+
Sbjct:    1 MNEATIRTIRKNEDSIRKSVAAEMYTSMNTTSNVRNSAMEMMEKALVIWLEDQNQKRIPIDTNAISVKALKIFEKLE 77          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000034930.1 (SMESG000034930.1)

HSP 1 Score: 117.087 bits (292), Expect = 4.811e-33
Identity = 59/88 (67.05%), Postives = 68/88 (77.27%), Query Frame = 1
Query: 1675 NIAISYRKIKKSTLHACLKAVWPDVVDKNINLTVSLGQEYSDIIEFAHTIGGEGFDDLAIGRKIGNYFQQHDPNVERALRFQ*AINES 1938
            +I ISYRKIKKSTLHAC KAVWPDVVD+NINLTVSLGQEYSDIIE AHTIGGEGFDDLA  R I    +  + N +  + F   ++E+
Sbjct: 1031 HIGISYRKIKKSTLHACWKAVWPDVVDENINLTVSLGQEYSDIIELAHTIGGEGFDDLA-QRDINEVMEDQELNEDDLIEFVNKVSEN 1117          

HSP 2 Score: 44.669 bits (104), Expect = 4.811e-33
Identity = 21/25 (84.00%), Postives = 23/25 (92.00%), Query Frame = 3
Query: 1605 KLENDGSLSIIDSRKKFTILDSVKH 1679
            KLENDGSL IID+ KKFTILDSV+H
Sbjct: 1007 KLENDGSLLIIDAWKKFTILDSVRH 1031          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000071434.1 (SMESG000071434.1)

HSP 1 Score: 84.3445 bits (207), Expect = 2.455e-22
Identity = 56/137 (40.88%), Postives = 78/137 (56.93%), Query Frame = 3
Query:  519 NLLTFMIDFLNFSFTHGKGKDSKKNMKRKFIS---LETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKIYEKLQ 920
            N  TF+   LN   T         N+KRK+ S   ++ K  IL RL   E+   I +  ++NEAT+RTI++ E  IR +V AG   S   +S +R  I+E MEKAL IW+ D  Q+RI +D+N I +KALK Y  L+
Sbjct:  105 NQHTFVSSALNLDQTKND------NVKRKWSSKLMMKMKKQILDRLLKGEKASHIAKTLNLNEATVRTIKKKEKEIRCAVAAGCSLSSKYSSRLRVPIIEKMEKALSIWINDSCQERIRLDSNIIRQKALKTYNYLK 235          

HSP 2 Score: 41.2022 bits (95), Expect = 2.455e-22
Identity = 23/55 (41.82%), Postives = 34/55 (61.82%), Query Frame = 1
Query: 1009 ASADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTKQNKSA 1173
            ASA   AA  +P+K  + I  + Y++ Q+F ADE GL W+K P    L ++NK+A
Sbjct:  272 ASAYHAAAISYPEKILKIIEDQGYTWKQVFNADEIGLRWQKCP-IGHLYQENKTA 325          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000027161.1 (SMESG000027161.1)

HSP 1 Score: 92.8189 bits (229), Expect = 1.143e-21
Identity = 55/160 (34.38%), Postives = 83/160 (51.88%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTK-QNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPVYWNANKKAWVTATLFNDWFYNSC-----ARCRKIFSQKRAAFQGSSFIGQCSRSPSR 1473
            SAD DAA  +P    + +    Y+ DQ++  DE  L +K +P RTF TK  N    G K  KD++T+LFC N SG   ++P++I K+K PR F   N+ + P  +  +  AW+  T F DWF+ +      A  RK+  +++A       +  C   P R
Sbjct:  340 SADKDAANSYPFWLKKFLEEGCYTADQVYNCDETDLCYKILPNRTFTTKTDNHKREGFKKRKDRLTLLFCVNKSGSHKLRPLMIGKSKAPRCFYRVNMKSPPFQYINSNNAWMNTTAFYDWFHKTFVPDVRAHLRKLKLEEKAL-----ILDNCPAHPKR 494          

HSP 2 Score: 30.4166 bits (67), Expect = 1.143e-21
Identity = 10/17 (58.82%), Postives = 15/17 (88.24%), Query Frame = 2
Query:  932 FTASHGWFEKFKKRHSL 982
            F AS+GW ++FKKRH++
Sbjct:  313 FKASNGWLDRFKKRHAI 329          
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Match: SMESG000013943.1 (SMESG000013943.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.710e-18
Identity = 40/103 (38.83%), Postives = 59/103 (57.28%), Query Frame = 1
Query: 1012 SADIDAAKQFPQKFSETIASKSYSYDQIFYADECGLFWKKIPERTFLTK-QNKSASGHKATKDQITILFCSNASGDCIMKPVVINKAKHPRSFKGKNINNLPV 1317
            SAD + A  +P    + +    Y+ DQ++  DE GL +K +P RT  TK  N    G K  KD++T+LFC N SG   + P++I K+K PR F   N+ +LP+
Sbjct:  147 SADKEDANSYPFLLKKFLEEGCYTADQVYNCDETGLCYKMLPNRTLATKTDNHKREGFKKRKDRLTLLFCINKSGSHKLSPLMIGKSKAPRCFHHVNMKSLPL 249          

HSP 2 Score: 35.039 bits (79), Expect = 1.710e-18
Identity = 27/107 (25.23%), Postives = 50/107 (46.73%), Query Frame = 3
Query:  585 KKNMKRKFISLETKI*ILGRLRNDERVIDITRFFSMNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWLEDQNQKRIPIDTNAITEKALKI 905
            K+  KR   S + K+  L +L+N ++   + R F ++E+T+R  + NE  IR          +     V+++   +++ AL  WL     + +PI    +  KA K 
Sbjct:    3 KQVQKRMSFSTKEKLLALDQLKNGKQQTQLARDFGISESTVRGWKTNEIMIRSLPNILEDELILQRKRVKSASDNVLDSALYQWLVQARSEGVPISGPILKAKAEKF 109          
The following BLAST results are available for this feature:
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
JRKL4.157e-3738.21JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
JRK1.594e-3241.46Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
JRK1.594e-3241.46Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
JRK2.063e-3241.46Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
JRK2.063e-3241.46Jrk helix-turn-helix protein [Source:HGNC Symbol;A... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000046714.16.157e-2334.69pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
kif63.824e-2035.16kinesin family member 6 [Source:Xenbase;Acc:XB-GEN... [more]
apmapl5.853e-822.28adipocyte plasma membrane associated protein LIKE ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Jrkl1.476e-3637.40Jrk-like [Source:MGI Symbol;Acc:MGI:1924782][more]
Tigd23.160e-2935.83tigger transposable element derived 2 [Source:MGI ... [more]
Jrk7.263e-2936.59jerky [Source:MGI Symbol;Acc:MGI:106214][more]
Tigd41.674e-1333.59tigger transposable element derived 4 [Source:MGI ... [more]
Tigd51.446e-1029.25tigger transposable element derived 5 [Source:MGI ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y4A0|JERKL_HUMAN1.844e-3638.21Jerky protein homolog-like OS=Homo sapiens OX=9606... [more]
sp|B2RRL2|JERKL_MOUSE8.996e-3637.40Jerky protein homolog-like OS=Mus musculus OX=1009... [more]
sp|O75564|JERKY_HUMAN9.153e-3241.46Jerky protein homolog OS=Homo sapiens OX=9606 GN=J... [more]
sp|Q96MW7|TIGD1_HUMAN4.766e-3126.76Tigger transposable element-derived protein 1 OS=H... [more]
sp|Q17RP2|TIGD6_HUMAN1.820e-2939.06Tigger transposable element-derived protein 6 OS=H... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T2M7L02.686e-8453.60Tigger transposable element-derived protein 1 (Fra... [more]
A0A4Y2B3162.461e-7531.88Tigger transposable element-derived protein 1 OS=A... [more]
A0A2A4JVK08.846e-6950.00HTH CENPB-type domain-containing protein OS=Heliot... [more]
A0A085MYN57.864e-6745.90HTH CENPB-type domain-containing protein OS=Trichu... [more]
A0A3Q1C7G79.727e-6745.16HTH CENPB-type domain-containing protein OS=Amphip... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000005656.13.181e-4045.16pep scaffold:Pmarinus_7.0:GL476578:539135:542172:1... [more]
ENSPMAT00000001313.11.561e-3642.74pep scaffold:Pmarinus_7.0:GL487606:277:3092:-1 gen... [more]
ENSPMAT00000010132.11.653e-3642.74pep scaffold:Pmarinus_7.0:GL477949:48477:51271:1 g... [more]
JRKL1.021e-3133.06JRK like [Source:HGNC Symbol;Acc:HGNC:6200][more]
ENSPMAT00000004617.11.415e-3025.43pep scaffold:Pmarinus_7.0:GL477874:26927:28564:-1 ... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO447383.295e-1325.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400009.810e-1337.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSORLT00000036785.14.376e-3641.28pep primary_assembly:ASM223467v1:22:11796267:11802... [more]
ENSORLT00000031980.19.180e-3445.95pep primary_assembly:ASM223467v1:3:6881985:6888319... [more]
ENSORLT00000029563.11.654e-931.82pep primary_assembly:ASM223467v1:22:22280271:22280... [more]
back to top
BLAST of Tigger transposable element-derived protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000030786.11.545e-3685.71SMESG000030786.1[more]
SMESG000034930.14.811e-3367.05SMESG000034930.1[more]
SMESG000071434.12.455e-2240.88SMESG000071434.1[more]
SMESG000027161.11.143e-2134.38SMESG000027161.1[more]
SMESG000013943.11.710e-1838.83SMESG000013943.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025841 ID=SMED30025841|Name=Tigger transposable element-derived protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2425bp
AAAAAAAAGACTGCTAAAAAAAATTTTGATATTATATGTACATATTATTT
AATTATTTTATTCTATTCTATTTATTTTTAACAATTTTCTGGTACCACTT
ATGATGTGTTTACAAGTTGTCAAGAAAAAAAGCGAGAAAATGCTAAAAAC
CATAAGTTTTTTGAGCTTGTAATAAAAGAGGGTATACAAAGTTTCAAAAT
TCTATTAATTACATAATCGATTATTATGTAAATTATTTAATTGTAAATCG
ATTAATTAATTGATCATTCTTATCAGATGCTAACCTTAATAAAAAATTAG
AGAAACGTCAATATTCGGTCAACTTGCAACCGACATCATTAACAAAAAAA
ATATTGTTTCTAATACAAAACGGGGAAATCACTTTTTCGTGTTGTGTAAA
TTCTCTGAATGAATCAGTTGATTTTAATTTTTGGATGGATTAGTTTGTAT
CTAAGTGATGTAATTTAGCGTTAAAATTAAGAACAGAACAATTAGAAGGT
AGGTATAAAACTTATATAAATCTCTTAACTTTTATGATTGATTTTTTGAA
TTTTAGTTTTACCCATGGCAAAGGAAAAGATTCAAAAAAGAATATGAAAC
GAAAATTTATTTCCTTAGAAACAAAAATTTAAATTTTGGGTCGATTACGT
AATGACGAAAGAGTAATAGATATTACAAGATTTTTTTCAATGAATGAAGC
TACAATAAGAACGATCCGGGAAAATGAAGACTCGATCAGAAAAAGCGTTA
CAGCTGGAATGTGTAGGAGCATGAATACTACATCTCATGTAAGAAATAGT
ATTATGGAAATGATGGAAAAGGCATTAGTAATATGGCTTGAGGACCAAAA
TCAAAAACGAATACCTATTGATACTAATGCCATAACAGAAAAAGCATTAA
AAATTTATGAAAAATTACAAATAAGAAACCTTTTACTGCAAGTCACGGTT
GGTTCGAAAAATTTAAAAAGAGGCATTCATTGCATAGTTTGTAACTAATC
TATATCAAGCATCAGCTGATATAGATGCAGCAAAACAATTTCCTCAAAAG
TTTTCTGAAACAATTGCCAGTAAATCGTACTCTTATGATCAGATTTTTTA
TGCGGATGAGTGTGGATTATTTTGGAAAAAAATACCTGAGAGAACATTTT
TAACAAAACAAAATAAATCAGCCAGCGGCCACAAAGCAACAAAGGATCAA
ATAACAATTCTTTTTTGTAGCAATGCATCAGGTGACTGTATTATGAAGCC
AGTGGTGATTAATAAAGCAAAGCATCCACGTTCGTTCAAAGGAAAAAACA
TAAACAATCTTCCTGTTTATTGGAATGCAAACAAAAAAGCTTGGGTTACC
GCCACTTTATTTAATGATTGGTTCTACAACTCCTGTGCCAGATGTAGAAA
AATATTTAGTCAAAAAAGAGCTGCCTTTCAAGGCTCTTCTTTTATTGGAC
AATGCTCCAGGTCACCCTCAAGACTTGCAGCATGAAAATGTAGAAGTTTT
TTTTACCAAAAAACACAACTTCTTTGTTACAACCTTTGGACCAAGGGATA
ATTGCCACATTCAAGGCATTGTACATTATAAGCACCTTTATGTATATTTT
AGATAAATTGGAAAATGATGGCTCTCTTTCAATTATCGATTCCAGGAAAA
AGTTTACGATTTTGGATTCTGTTAAACATAGCAATTTCTTATCGTAAAAT
TAAAAAATCAACACTCCATGCGTGTTTAAAAGCAGTGTGGCCTGATGTTG
TTGATAAAAATATAAATTTAACAGTATCTTTGGGTCAAGAATATTCAGAC
ATAATTGAGTTTGCTCATACGATAGGTGGAGAAGGTTTTGACGATTTAGC
AATAGGAAGAAAAATAGGAAACTACTTCCAACAACATGATCCGAATGTTG
AACGAGCTCTCCGATTTCAGTGAGCTATTAACGAATCTTTGAATCAATAT
GAAGAAGTTTATAAAGATTTGACTAAAAACAAATCACAATTTTTAATTAG
AGATTTTATTTCTAAGTCTTACCGAACTGAAATCAATCCTATACCAACCA
CGGAGCGGTACGAAATATTATCCAGTGATGACAGTGATATTATAGAAACT
ACTAAAAGAAGACTGATTGTTGAAAGTGATAGTGACAGCAATTTAAATTA
AGTTAGTTTTTATTGAGGTCAACATGTTAGTACATAATTGCATATTTTGT
ATATAATGTATATTTTTGGTGAATTGTTTAAAAATTTATTTTGTTTTACA
TTTTTTTGTTTCAAAACTAATTGAATTATTATGTTTTTGTTTTATATTAT
CAGACTGCTGTTGAACTCTTTTACTGGTATTATTTTTTTCTCAATAAATG
ATTAAAAATAGGTAAAACTGTGGTTATTTTCGTTTAACACGGTTTTTTCA
TATAAATTTCATTTTTTCGCTTAAT
back to top

protein sequence of SMED30025841-orf-1

>SMED30025841-orf-1 ID=SMED30025841-orf-1|Name=SMED30025841-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MNEATIRTIRENEDSIRKSVTAGMCRSMNTTSHVRNSIMEMMEKALVIWL
EDQNQKRIPIDTNAITEKALKIYEKLQIRNLLLQVTVGSKNLKRGIHCIV
CN*
back to top

protein sequence of SMED30025841-orf-2

>SMED30025841-orf-2 ID=SMED30025841-orf-2|Name=SMED30025841-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MMALFQLSIPGKSLRFWILLNIAISYRKIKKSTLHACLKAVWPDVVDKNI
NLTVSLGQEYSDIIEFAHTIGGEGFDDLAIGRKIGNYFQQHDPNVERALR
FQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR004875DDE_SF_endonuclease_dom
IPR006600HTH_CenpB_DNA-bd_dom
IPR009057Homeobox-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003677DNA binding