Leukotriene A(4) hydrolase

Overview
NameLeukotriene A(4) hydrolase
Smed IDSMED30025839
Length (bp)2129
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leukotriene A(4) hydrolase (SMED30025839) t-SNE clustered cells

Violin plots show distribution of expression levels for Leukotriene A(4) hydrolase (SMED30025839) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leukotriene A(4) hydrolase (SMED30025839) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leukotriene A(4) hydrolase (SMED30025839) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025839

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025839SMESG000053576.1 SMESG000049276.1 Contig46689uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025839SMESG000053576.1 SMESG000049276.1 Contig46689newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025839SMESG000053576.1 SMESG000049276.1 Contig48389uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30025839SMESG000053576.1 SMESG000049276.1 Contig48389newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v6_733_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025839SMESG000053576.1 SMESG000049276.1 dd_Smed_v4_733_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 493.812 bits (1270), Expect = 1.162e-166
Identity = 273/619 (44.10%), Postives = 377/619 (60.90%), Query Frame = 2
Query:  107 SLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            SL  P S        T+HL     +DF R+ + G+  L +++       L LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSAI++      EDP+++    I+KF QKV I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ S+  +GE H F +LV  L + DPD ++S VPYEKG  LLF+LE + G  ++ L +LK Y E + YKS+TTD+WK F Y Y  DK ++    L+ VDW  W Y     P+         +A   L+ +WI    +     + +D KDL         HQ   FL      + A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   V+ + +++ +MHP+TA
Sbjct:    9 SLASPASVCR-----TKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGE-RQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRK----IYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDL-------SSHQLNEFLA--QTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AVRTYQEHKASMHPVTA 601          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 478.789 bits (1231), Expect = 3.470e-161
Identity = 270/598 (45.15%), Postives = 369/598 (61.71%), Query Frame = 2
Query:  218 LQLKNLTKKQ--------------ADLK-LDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWI-----NLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            L  +NL+K+Q              A LK LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSAI++      EDP+++    I+KF QKV I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ S+  +GE H F +LV  L + DPD ++S VPYEKG  LLF+LE + G  ++ L +LK Y E + YKS+TTD+WK F Y Y  DK ++    L+ VDW  W Y     P+         +A   L+ +WI     +LN   + +D KDL         HQ   FL      + A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   V+ + +++ +MHP+TA
Sbjct:    2 LPQRNLSKRQVPTMHIPVKTRRLLAALKVLDTKDLTIEKVVINGQEVKYALGE-RQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRK----IYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLN-SFNATDLKDL-------SSHQLNEFLA--QTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AVRTYQEHKASMHPVTA 577          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Human
Match: LTA4H (leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:HGNC:6710])

HSP 1 Score: 426.402 bits (1095), Expect = 9.029e-142
Identity = 242/510 (47.45%), Postives = 318/510 (62.35%), Query Frame = 2
Query:  218 LQLKNLTKKQ--------------ADLK-LDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWI-----NLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHS 1657
            L  +NL+K+Q              A LK LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSAI++      EDP+++    I+KF QKV I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ S+  +GE H F +LV  L + DPD ++S VPYEKG  LLF+LE + G  ++ L +LK Y E + YKS+TTD+WK F Y Y  DK ++    L+ VDW  W Y     P+         +A   L+ +WI     +LN   + +D KDL         HQ   FL        A LHS
Sbjct:    2 LPQRNLSKRQVPTMHIPVKTRRLLAALKVLDTKDLTIEKVVINGQEVKYALGE-RQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRK----IYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLN-SFNATDLKDL-------SSHQLNEFLAQTLQRMAAALHS 493          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Human
Match: RNPEP (arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:10078])

HSP 1 Score: 293.508 bits (750), Expect = 4.625e-89
Identity = 194/631 (30.74%), Postives = 323/631 (51.19%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFD-------RKLIEGSVNLQLKNL-TKKQADLKLDT-KYLDIKKVSVK----GTE------TRFDIVDCKIEALGSCLKIPIGI-SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICG-KDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKI------PVDHVLKRDHGDASERLADKWINLNPEISDSDQKDL-LLEYESFLPHQKYYFLQVLND-FKEAKLHSKVIETMGNLY-QYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMH 1909
            D  S +N   +   HL  D   +F         + + G+  L L+ L  +  A+L+LD+   L++   +++    G+E        F            C+  P    + E+  V + Y        + WL PE T GKK P++++Q QA+  R+ FPC D+P VK  YSA ++ P+ F  +MSA   E   K G +    F+    I SYL+A+  G+L   ++  RS VW+EP +++ A  E+    E  L+  E + G YVWG YDLL +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI+HSW GNLVTN  W +FWLNEG T Y +R I    + +     L  + G A L++ ++  GE +  N+L V +    DPDD+++  PYEKG   + +L ++ G +DQ   +LK Y   +K++S+  D++  F+ +Y  + +      +   ++ +W     W        P D ++K      +E LA  W         +++ D+  +E  +  P + Y  +  L+   +++ L    ++ +G+ Y   + + N+E+   W  + ++++H     ++ +FL++QG+ KYT P+Y  +    ++  + L  + F    + +H
Sbjct:   24 DVASASNFRAFELLHLHLDLRAEFGPPGPGAGSRGLSGTAVLDLRCLEPEGAAELRLDSHPCLEVTAAALRRERPGSEEPPAEPVSFYTQPFSHYGQALCVSFPQPCRAAERLQVLLTY-RVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWE---KRGPNKFF-FQMCQPIPSYLIALAIGDLVSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYT-CLEAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYFPELKKKRVDIIPGFEFDRWLNTPGWPPYLPDLSPGDSLMK-----PAEELAQLWA--------AEELDMKAIEAVAISPWKTYQLVYFLDKILQKSPLPPGNVKKLGDTYPSISNARNAELRLRWGQIVLKNDHQEDFWKVKEFLHNQGKQKYTLPLYHAMMGG-SEVAQTLAKETFASTASQLH 634          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Human
Match: RNPEP (arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGNC:10078])

HSP 1 Score: 266.159 bits (679), Expect = 2.538e-82
Identity = 141/336 (41.96%), Postives = 202/336 (60.12%), Query Frame = 2
Query:  416 TTANCTALQ----------WLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICG-KDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYM 1384
            T  +CT+L           WL PE T GKK P++++Q QA+  R+ FPC D+P VK  YSA ++ P+ F  +MSA   E   K G +    F+    I SYL+A+  G+L   ++  RS VW+EP +++ A  E+    E  L+  E + G YVWG YDLL +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI+HSW GNLVTN  W +FWLNEG T Y +R I    + +     L  + G A L++ ++  GE +  N+L V +    DPDD+++  PYEKG   + +L ++ G +DQ   +LK Y   +K++S+  D++  F+ +Y 
Sbjct:    2 TCCSCTSLSALLDFWAEVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKYKYSALIEVPDGFTAVMSASTWE---KRGPNKFF-FQMCQPIPSYLIALAIGDLVSAEVGPRSRVWAEPCLIDAAKEEYNGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYT-CLEAATGRALLRQHMDITGEENPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLVGDQDQFDSFLKAYVHEFKFRSILADDFLDFYLEYF 332          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Celegans
Match: ltah-1.2 (LeukoTriene A4 Hydrolase homolog [Source:UniProtKB/TrEMBL;Acc:U4PAP4])

HSP 1 Score: 449.514 bits (1155), Expect = 1.210e-149
Identity = 254/614 (41.37%), Postives = 352/614 (57.33%), Query Frame = 2
Query:  113 NDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEK----FSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAE--LQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR-WLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLE-YESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
             DP S AN  +   EH    W + F  K+I G   L+ + LT     L LD + L I+ VS+ G +  F I        GS + + +    +K      V + Y T+ + TALQW+  E T  K+ PYLFSQCQAIHARS+ PC D+P VKSTY A+V  P     LMSAI  +    + +     ++Q V I SYL+AIV G L  + +S+R  VW+EP +V+KA  EFA+TE++L+ AE I G+Y+WG YD++ LPPSFP+GGMENPCLTF+TPTL+ GD+SLV V+AHEI HSW+GNLVTN +WE FWLNEG T +IER I  +   SE  R  +   G     +      +   H+F +L+      DPD +FS VPYEKGS LLF+LE   G  ++   +LK Y + + ++++ + +WK   YKY  D++ +    LD V++  WF G    P      +   +A E L  KW+  +    +S   D+  E Y +  P Q+   L  L        H K ++ +  LY+   S NSE+L  W+ LCI+S     I +  DF+NSQGRLK+ +PIYR+LA WP  + K   V  +LK  + MHPITA+ I
Sbjct:   11 RDPCSAANINEITVEHTAIKWTVSFQLKMIIGQATLRCRCLTDA-TKLVLDVRDLSIRSVSINGVDCDFRIAPNVYTFFGSKMSVYLPPQFQKAGTILQVTVAYGTSPDATALQWMKKEQTADKRMPYLFSQCQAIHARSIVPCMDTPSVKSTYEAEVTVPTGMTCLMSAI-GQGSKGDDDTTTFFYKQPVAIPSYLIAIVVGCLEKRDISDRCAVWAEPSVVDKAHWEFAETEDILASAEEIAGKYIWGRYDMVCLPPSFPFGGMENPCLTFLTPTLIAGDRSLVSVIAHEIAHSWSGNLVTNSSWEHFWLNEGFTMFIERKICGRLV-SEDYRQFMAFNGWTNSLIPAVYEQFTPTHQFTKLIQDHTNVDPDVAFSCVPYEKGSALLFYLEQKLGGSEIFEAYLKDYLKTFAHQAIDSWQWKDHLYKYFADQKEV----LDTVNFDLWFNGVGMPPEKPNYGQSMVEACEVLLKKWLAAD----ESTVGDITSEDYYAMQPLQQIELLSQLWQHDPPIEHYK-LDALNKLYKLNDSQNSELLLNWLRLCIKSKWEECIPKALDFVNSQGRLKFCRPIYRDLAQWPIANKKARDV--YLKGRSQMHPITAEMI 610          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 437.187 bits (1123), Expect = 5.319e-145
Identity = 250/615 (40.65%), Postives = 351/615 (57.07%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVK--GTETRFDIVDCKIEALGSCLKIPIGI--SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAI-KNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAE-LQESLN-AYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAK-LHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSIR 1933
            DP + AN E     H    W +DF++K I G V++ L ++ +    + LDT+ L ++ V++   G   +        +ALG  L I      S ++  + I+Y ++ N  ALQ+L  E T  +  PYLFSQCQAI+ARS+ PC D+P VKSTY A+V  P     LMSAI +   P++ G   I  F+Q V+I SYL+AIV G+L  K++S R  VW+EP   E + +EFA+TE +L +AE + G YVWG YDL+VLP +FP+GGMENPCLTF+TPTLL GD+SLV V+AHEI+HSWTGNLVTN +WE FWLNEG T ++ER I  K Y  EL R      G  E L  ++N  +G  H++ +LV  L   DPDD+FS VPYEKGS LLF +E   G +    ++L+ Y + Y YK+++T+EWK + Y    DK+ I    LDN+DW  W + +  +P           A + LA KW     E           + E F        L VL+  +  K +    +  +   Y+   + N+E+ F W+ML + +  +P +D    F  + GR+KY KPIYR+L  W     +   +  F  N   MHPIT K+I+
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITL-DVKQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRVAPYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYEEALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLH-KAGLPPKPKYDSTPMQACKDLAAKWTTEGSEAP--------TDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMPALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGW--SATRDRAISQFKANIPNMHPITVKAIQ 605          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 437.187 bits (1123), Expect = 5.319e-145
Identity = 250/615 (40.65%), Postives = 351/615 (57.07%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVK--GTETRFDIVDCKIEALGSCLKIPIGI--SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAI-KNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAE-LQESLN-AYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAK-LHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSIR 1933
            DP + AN E     H    W +DF++K I G V++ L ++ +    + LDT+ L ++ V++   G   +        +ALG  L I      S ++  + I+Y ++ N  ALQ+L  E T  +  PYLFSQCQAI+ARS+ PC D+P VKSTY A+V  P     LMSAI +   P++ G   I  F+Q V+I SYL+AIV G+L  K++S R  VW+EP   E + +EFA+TE +L +AE + G YVWG YDL+VLP +FP+GGMENPCLTF+TPTLL GD+SLV V+AHEI+HSWTGNLVTN +WE FWLNEG T ++ER I  K Y  EL R      G  E L  ++N  +G  H++ +LV  L   DPDD+FS VPYEKGS LLF +E   G +    ++L+ Y + Y YK+++T+EWK + Y    DK+ I    LDN+DW  W + +  +P           A + LA KW     E           + E F        L VL+  +  K +    +  +   Y+   + N+E+ F W+ML + +  +P +D    F  + GR+KY KPIYR+L  W     +   +  F  N   MHPIT K+I+
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITL-DVKQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRVAPYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYEEALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLH-KAGLPPKPKYDSTPMQACKDLAAKWTTEGSEAP--------TDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMPALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGW--SATRDRAISQFKANIPNMHPITVKAIQ 605          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 433.721 bits (1114), Expect = 1.016e-143
Identity = 250/615 (40.65%), Postives = 351/615 (57.07%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVK--GTETRFDIVDCKIEALGSCLKIPIGI--SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAI-KNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAE-LQESLN-AYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAK-LHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSIR 1933
            DP + AN E     H    W +DF++K I G V++ L ++ +    + LDT+ L ++ V++   G   +        +ALG  L I      S ++  + I+Y ++ N  ALQ+L  E T  +  PYLFSQCQAI+ARS+ PC D+P VKSTY A+V  P     LMSAI +   P++ G   I  F+Q V+I SYL+AIV G+L  K++S R  VW+EP   E + +EFA+TE +L +AE + G YVWG YDL+VLP +FP+GGMENPCLTF+TPTLL GD+SLV V+AHEI+HSWTGNLVTN +WE FWLNEG T ++ER I  K Y  EL R      G  E L  ++N  +G  H++ +LV  L   DPDD+FS VPYEKGS LLF +E   G +    ++L+ Y + Y YK+++T+EWK + Y    DK+ I    LDN+DW  W + +  +P           A + LA KW     E           + E F        L VL+  +  K +    +  +   Y+   + N+E+ F W+ML + +  +P +D    F  + GR+KY KPIYR+L  W     +   +  F  N   MHPIT K+I+
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITL-DVKQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRA-PYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYEEALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLH-KAGLPPKPKYDSTPMQACKDLAAKWTTEGSEAP--------TDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMPALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGW--SATRDRAISQFKANIPNMHPITVKAIQ 604          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Celegans
Match: ltah-1.1 (Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-Prot;Acc:G5EFT4])

HSP 1 Score: 433.721 bits (1114), Expect = 1.016e-143
Identity = 250/615 (40.65%), Postives = 351/615 (57.07%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVK--GTETRFDIVDCKIEALGSCLKIPIGI--SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAI-KNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAE-LQESLN-AYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAK-LHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSIR 1933
            DP + AN E     H    W +DF++K I G V++ L ++ +    + LDT+ L ++ V++   G   +        +ALG  L I      S ++  + I+Y ++ N  ALQ+L  E T  +  PYLFSQCQAI+ARS+ PC D+P VKSTY A+V  P     LMSAI +   P++ G   I  F+Q V+I SYL+AIV G+L  K++S R  VW+EP   E + +EFA+TE +L +AE + G YVWG YDL+VLP +FP+GGMENPCLTF+TPTLL GD+SLV V+AHEI+HSWTGNLVTN +WE FWLNEG T ++ER I  K Y  EL R      G  E L  ++N  +G  H++ +LV  L   DPDD+FS VPYEKGS LLF +E   G +    ++L+ Y + Y YK+++T+EWK + Y    DK+ I    LDN+DW  W + +  +P           A + LA KW     E           + E F        L VL+  +  K +    +  +   Y+   + N+E+ F W+ML + +  +P +D    F  + GR+KY KPIYR+L  W     +   +  F  N   MHPIT K+I+
Sbjct:    8 DPSTAANYEQVTVSHYALKWKVDFEKKHIAGDVSITL-DVKQDTERIVLDTRDLSVQSVALNLNGEPKKAGFTLEDNQALGQKLVITTESLKSGDRPVLEIKYESSNNAAALQFLTAEQTTDRA-PYLFSQCQAINARSIVPCMDTPSVKSTYEAEVCVPIGLTCLMSAIGQGSTPSECGKRTIFSFKQPVSIPSYLLAIVVGHLERKEISERCAVWAEPSQAEASFYEFAETEKILKVAEDVAGPYVWGRYDLVVLPATFPFGGMENPCLTFITPTLLAGDRSLVNVIAHEISHSWTGNLVTNFSWEHFWLNEGFTVFLERKIHGKMY-GELERQFESESGYEEALVRTVNDVFGPDHEYTKLVQNLGNADPDDAFSSVPYEKGSALLFTIEQALGDNSRFEQFLRDYIQKYAYKTVSTEEWKEYLYDSFTDKKVI----LDNIDWNLWLH-KAGLPPKPKYDSTPMQACKDLAAKWTTEGSEAP--------TDGEVFAKMSNSQKLAVLDAVRVNKTMFGDRMPALTATYKLDQAKNAELKFSWLMLGLETKWSPIVDASLAFALAVGRMKYCKPIYRSLFGW--SATRDRAISQFKANIPNMHPITVKAIQ 604          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Fly
Match: CG10602 (gene:FBgn0032721 transcript:FBtr0089314)

HSP 1 Score: 427.557 bits (1098), Expect = 3.326e-141
Identity = 242/618 (39.16%), Postives = 355/618 (57.44%), Query Frame = 2
Query:  104 LSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDI---VDCKIEALGS--CLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNA-YGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR-WLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLN-PEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKE-AKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            L + DP SY+  +   TEH   +W IDF    I+GSV  + K LT     + LD + +++   ++    +   I   +   ++ +G    L++P G +    +V I Y T+++ + LQWL P  T+GK+HPY+FSQCQAIHARS+ PCQD+P VK TY A V+ P++   LMSA+   D  + G  L   F+Q+V I +YLVAI  G L  + L   S+VW+E  +V+  A EF++T  +L  A  +CG YVW  YDLLV+PPSFP+GGMENPCLTFVTPTLL GDKSL  VVAHEI HSWTGNLVTNK +E FWLNEG T ++E  I+ +   ++ +   ++S  + +LQE +     +  +  +LV  L  C PDD+FS VPY KGS  L +LE++ G   +   +L+ Y + Y YKS+ T ++++  Y Y ID +   K KL  VDW  W       PV         + ++ LA  W + +  E++DS +    +       HQ   FL  L + K+   L+   I  + + Y   +S N+E+ F    L IR+     +D+I +F NS  R+K+ +PIYR+LA WP    K   ++NF+  ++ M  + + +I
Sbjct:    4 LGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALI--DKKEPGKTL---FKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLKTATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKELDFKMLS-NLTDLQECIRTQLNKTPELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDYFIDTDK--KDKLSAVDWDLWLKSEGMPPVIPNFDESLANVTKELASLWSSKSVAELADSAEIKTTISI-----HQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWP--EAKPAAIRNFVNVKDQMMAVCSHTI 606          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Fly
Match: CG10602 (gene:FBgn0032721 transcript:FBtr0089315)

HSP 1 Score: 427.557 bits (1098), Expect = 3.326e-141
Identity = 242/618 (39.16%), Postives = 355/618 (57.44%), Query Frame = 2
Query:  104 LSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDI---VDCKIEALGS--CLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNA-YGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR-WLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLN-PEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKE-AKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            L + DP SY+  +   TEH   +W IDF    I+GSV  + K LT     + LD + +++   ++    +   I   +   ++ +G    L++P G +    +V I Y T+++ + LQWL P  T+GK+HPY+FSQCQAIHARS+ PCQD+P VK TY A V+ P++   LMSA+   D  + G  L   F+Q+V I +YLVAI  G L  + L   S+VW+E  +V+  A EF++T  +L  A  +CG YVW  YDLLV+PPSFP+GGMENPCLTFVTPTLL GDKSL  VVAHEI HSWTGNLVTNK +E FWLNEG T ++E  I+ +   ++ +   ++S  + +LQE +     +  +  +LV  L  C PDD+FS VPY KGS  L +LE++ G   +   +L+ Y + Y YKS+ T ++++  Y Y ID +   K KL  VDW  W       PV         + ++ LA  W + +  E++DS +    +       HQ   FL  L + K+   L+   I  + + Y   +S N+E+ F    L IR+     +D+I +F NS  R+K+ +PIYR+LA WP    K   ++NF+  ++ M  + + +I
Sbjct:    4 LGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALI--DKKEPGKTL---FKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLKTATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKELDFKMLS-NLTDLQECIRTQLNKTPELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDYFIDTDK--KDKLSAVDWDLWLKSEGMPPVIPNFDESLANVTKELASLWSSKSVAELADSAEIKTTISI-----HQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWP--EAKPAAIRNFVNVKDQMMAVCSHTI 606          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Fly
Match: CG10602 (gene:FBgn0032721 transcript:FBtr0347402)

HSP 1 Score: 426.787 bits (1096), Expect = 6.994e-140
Identity = 242/618 (39.16%), Postives = 355/618 (57.44%), Query Frame = 2
Query:  104 LSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDI---VDCKIEALGS--CLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNA-YGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR-WLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLN-PEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKE-AKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            L + DP SY+  +   TEH   +W IDF    I+GSV  + K LT     + LD + +++   ++    +   I   +   ++ +G    L++P G +    +V I Y T+++ + LQWL P  T+GK+HPY+FSQCQAIHARS+ PCQD+P VK TY A V+ P++   LMSA+   D  + G  L   F+Q+V I +YLVAI  G L  + L   S+VW+E  +V+  A EF++T  +L  A  +CG YVW  YDLLV+PPSFP+GGMENPCLTFVTPTLL GDKSL  VVAHEI HSWTGNLVTNK +E FWLNEG T ++E  I+ +   ++ +   ++S  + +LQE +     +  +  +LV  L  C PDD+FS VPY KGS  L +LE++ G   +   +L+ Y + Y YKS+ T ++++  Y Y ID +   K KL  VDW  W       PV         + ++ LA  W + +  E++DS +    +       HQ   FL  L + K+   L+   I  + + Y   +S N+E+ F    L IR+     +D+I +F NS  R+K+ +PIYR+LA WP    K   ++NF+  ++ M  + + +I
Sbjct:   75 LGVVDPSSYSQPDLITTEHSALNWKIDFAATKIQGSVLHRFKVLTANLDKILLDVRDINVTNATLLAGGSELPINFFISDAVDDIGQKLTLELPSGTAKGSLNVRIDYETSSSASGLQWLNPTQTLGKEHPYMFSQCQAIHARSVIPCQDTPAVKFTYDATVEHPSELTALMSALI--DKKEPGKTL---FKQEVPIPAYLVAIAIGKLVSRPLGENSSVWAEEAIVDACAEEFSETATMLKTATELCGPYVWKQYDLLVMPPSFPFGGMENPCLTFVTPTLLAGDKSLADVVAHEIAHSWTGNLVTNKNFEHFWLNEGFTVFVESKIVGRMQGAKELDFKMLS-NLTDLQECIRTQLNKTPELTKLVVDLSNCGPDDAFSSVPYIKGSTFLRYLEDLFGGPTVFEPFLRDYLKKYAYKSIETKDFQSALYDYFIDTDK--KDKLSAVDWDLWLKSEGMPPVIPNFDESLANVTKELASLWSSKSVAELADSAEIKTTISI-----HQLIDFLGKLIESKDIVDLNEGKINLLESTYNLKSSKNAEVRFRLNRLIIRARLIKRLDEILEFANSNFRMKFCRPIYRDLAGWP--EAKPAAIRNFVNVKDQMMAVCSHTI 677          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Fly
Match: CG31445 (gene:FBgn0051445 transcript:FBtr0085401)

HSP 1 Score: 105.916 bits (263), Expect = 3.411e-23
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKE--GNHLIHKFEQKVNISSYLVAIVCGNLAGK--KLSNRS--TVWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMENPCLT-------FVTPT--LLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLV-------PVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKS 1342
            +Q +   AR  FPC D P  K+++   +    QFN L +    E    E   N++  +F++ V +S+YLVA    + + K   L N +    W+ P  +++  +       +L   E   G  Y     D + +P  F  G MEN  L          +PT   L   + L  V+AHE+ H W GNLVT K W D WLNEG   Y+  L +++ Y     R           + SL A     + + LV       P+ +  + ++SF  + Y+KGS +L  +    G++     L+ Y + Y YK+
Sbjct:  162 TQFEPSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIWCEFQESVPMSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMAVP-DFSAGAMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPEWHSRD----------KGSLTALMTAFRLDSLVSSHPISRPIQMVTEIEESFDAISYQKGSAVLRMMHLFMGEESFRTGLREYLKLYAYKN 457          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Fly
Match: CG31445 (gene:FBgn0051445 transcript:FBtr0332431)

HSP 1 Score: 105.916 bits (263), Expect = 3.411e-23
Identity = 86/307 (28.01%), Postives = 136/307 (44.30%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKE--GNHLIHKFEQKVNISSYLVAIVCGNLAGK--KLSNRS--TVWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMENPCLT-------FVTPT--LLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLV-------PVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKS 1342
            +Q +   AR  FPC D P  K+++   +    QFN L +    E    E   N++  +F++ V +S+YLVA    + + K   L N +    W+ P  +++  +       +L   E   G  Y     D + +P  F  G MEN  L          +PT   L   + L  V+AHE+ H W GNLVT K W D WLNEG   Y+  L +++ Y     R           + SL A     + + LV       P+ +  + ++SF  + Y+KGS +L  +    G++     L+ Y + Y YK+
Sbjct:  162 TQFEPSSARKAFPCFDEPGFKASFVVTLGYHKQFNALSNMPVREIRPHESLANYIWCEFQESVPMSTYLVAYSVNDFSFKPSTLPNGALFRTWARPNAIDQCDYAAEFGPKVLQYYEEFFGIRYPLPKIDQMAVP-DFSAGAMENWGLVKYRESTLLYSPTHSSLADKQDLANVIAHELAHQWFGNLVTMKWWTDLWLNEGFATYVAGLGVQEIYPEWHSRD----------KGSLTALMTAFRLDSLVSSHPISRPIQMVTEIEESFDAISYQKGSAVLRMMHLFMGEESFRTGLREYLKLYAYKN 457          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Zebrafish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 484.952 bits (1247), Expect = 2.505e-163
Identity = 257/605 (42.48%), Postives = 367/605 (60.66%), Query Frame = 2
Query:  152 TEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGISDEKFSVC-IQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN---EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLN----PEISDSDQKDL----LLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            T+HL+  + +DFDR +++G V L ++ L  K + L LD+K L I KVS  G   +F++   K +  GS L+I  P  +S  +  +  I+Y T+   TALQWL P+ T GKKHPYLFSQCQA H R++ PCQD+P VK TY A+V  P +   LMSA+++    DP+ + + +I++F Q V + SYL+AIV G L  +++  RS VWSE E V++AA+EFA+TE +L  AES+ G YVWG YD+LVLPPSFPYGGMENPCLTFVTPT+L GD+SL  V+AHEI+HSWTGNLVTN+TWE FWLNEGHT YIER+I  +  + E +R      G  EL ES+  +G  +    LVP L E D D++FS VPYEKG  LL+HLE + G  ++ + ++K Y + + Y S+TT+EWK + + Y  DK +I    L+ VDW  W +     PV         DA   L  KW+          +++D K L    L+E+ + L              +E  L    ++ MG +Y+     N+E+ F W+ +C+++    A+         QGR+K+T+P+++ + N+         VK F +N  ++HP+TA
Sbjct:   18 TKHLNLIYHVDFDRHVLKGKVALTVEVLEDKFSSLTLDSKDLKISKVSANGQAAKFEL-GAKHKFKGSPLEITLPFELSRGQHVIVEIEYETSPTATALQWLTPKQTAGKKHPYLFSQCQATHCRTMVPCQDTPSVKHTYYAQVSVPRELVALMSALRDGQEPDPS-DSSRVIYRFRQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEYVDEAAYEFAETETMLKTAESLAGPYVWGQYDVLVLPPSFPYGGMENPCLTFVTPTVLAGDRSLAGVIAHEISHSWTGNLVTNRTWEHFWLNEGHTVYIERMIA-RCMEGEQLRQFKGIGGWKELHESVKQFGANNVLTNLVPNLHEVDTDEAFSSVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQLFAYGSVTTEEWKNYLFTYFKDKVDI----LNKVDWNAWMHTPGMAPVRPQYDTTMADACTSLCQKWVKAKEADLASFTEADVKQLNSPQLIEFMALL-------------LQEDPLPLSHVKKMGEVYKLNNIKNAEVRFRWLRICVKAQWEEAVPLALKMATEQGRMKFTRPLFKEVYNF--SKYSDEAVKTFKENRGSLHPVTA 600          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Zebrafish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 481.1 bits (1237), Expect = 5.810e-162
Identity = 256/605 (42.31%), Postives = 366/605 (60.50%), Query Frame = 2
Query:  152 TEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGISDEKFSVC-IQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN---EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLN----PEISDSDQKDL----LLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            T+HL+  + +DFDR +++G V L ++ L  K + L LD+K L I KVS  G   +F++   K +  GS L+I  P  +S  +  +  I+Y T+   TALQWL P+ T GKKHPYLFSQCQA H R++ PCQD+P VK TY A+V  P +   LMSA+++    DP+ + + +I++F Q V + SYL+AIV G L  +++  RS VWSE E V++AA+EFA+TE +L  AES+ G YVWG YD+LVLPPSFPYGGMENPCLTFVTPT+L GD+SL  V+AHEI+HSWTGNLVTN+TWE FWLNEGHT YIER+I  +  + E +R      G  EL ES+  +G  +    LVP L E D D++FS VPYEKG  LL+HLE + G  ++ + ++K Y + + Y S+TT+EWK + + Y  DK +I    L+ VDW  W +     PV         DA   L  KW+          +++D K L    L+E+ + L              +E  L    ++ MG +Y+     N+E+ F W+ +C+++    A+         QGR+K+T+P+++ + N+         VK F +   ++HP+TA
Sbjct:   18 TKHLNLIYHVDFDRHVLKGKVALTVEVLEDKFSSLTLDSKDLKISKVSANGQAAKFEL-GAKHKFKGSPLEITLPFELSRGQHVIVEIEYETSPTATALQWLTPKQTAGKKHPYLFSQCQATHCRTMVPCQDTPSVKHTYYAQVSVPRELVALMSALRDGQEPDPS-DSSRVIYRFRQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEYVDEAAYEFAETETMLKTAESLAGPYVWGQYDVLVLPPSFPYGGMENPCLTFVTPTVLAGDRSLAGVIAHEISHSWTGNLVTNRTWEHFWLNEGHTVYIERMIA-RCMEGEQLRQFKGIGGWKELHESVKQFGANNVLTNLVPNLHEVDTDEAFSSVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQLFAYGSVTTEEWKNYLFTYFKDKVDI----LNKVDWNAWMHTPGMAPVRPQYDTTMADACTSLCQKWVKAKEADLASFTEADVKQLNSPQLIEFMALL-------------LQEDPLPLSHVKKMGEVYKLNNIKNAEVRFRWLRICVKAQWEEAVPLALKMATEQGRMKFTRPLFKEVYNF--SKYSDEAVKTFKEIRGSLHPVTA 600          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Zebrafish
Match: rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:ZFIN;Acc:ZDB-GENE-040718-241])

HSP 1 Score: 364.385 bits (934), Expect = 1.932e-116
Identity = 217/611 (35.52%), Postives = 343/611 (56.14%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDT-KYLDIKKVSVKGTE---TRFDIVDCKIEALGSCL--KIPIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICG-KDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKIPV-DHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLY-QYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMH 1909
            D  + ++   +  EH   D  +DF +K I G+  ++L+ +   Q++L+LD    L + ++++       TR + +     + G+ L  K P   S D+K  + I+Y  T +   + WL PE T GK  PY+F+Q QA+  RS FPC D+P VKSTYSA V+ P+ F  +MSA K E    +G  L   F  +  I +YLVA+  G+L   ++  R+ VW+EP +++ A  E+ +  E+ LS+ E + G YVWG YD+L +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI HSW GNLVTN TW DFWLNEG T Y +R +  + Y  E    L  + G A L++ ++  GE H  N+L V +    DPDD+++  PYEKG   + +L ++ G + +   +LK Y E +K++S+  ++   F+ +Y  + +  +  K++ +D+  W     W   V D    +     +E LA+KW++ N ++    + DL    +S+  +Q  YFL  +   +++ L    ++ +   Y Q   S+N+E+   W  +  ++ ++P    I DFL+SQG+ KYT P+YR L N  ++  K L ++ F      +H
Sbjct:   16 DVATSSSFRQFKIEHFHLDLKVDFLQKSISGTETIELQCIQDSQSELQLDIHPSLSVHEITLSQNARDWTRTEFLTQDFTSYGTTLLVKFPTAFSSDDKLQLAIRYTAT-DGPGVCWLEPEQTAGKLKPYVFTQGQAVLNRSCFPCFDTPAVKSTYSAAVQVPDGFTAVMSANKWEQRKADGAFL---FTMEHPIPAYLVALAVGDLQSAEVGPRTRVWTEPCLLQAAKQEYDNVIEDFLSVGEKLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIVHEICHSWFGNLVTNATWGDFWLNEGFTMYAQRRVCRELY-GEAYTCLEAATGKALLRQHMDNTGEDHPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLTGDQSRFDTFLKAYVEKFKFRSVLAEDALEFYLEYFPELKERNVHKIEGLDFDSWLNVPGWPPYVPDLSAGQTLMKPAELLAEKWLSHNLDLESICKTDL----KSWKTYQTVYFLDRI--LEKSPLPDGNLKKLEECYSQIIKSNNAELKVRWAQIVAKNQYSPGFQHIRDFLSSQGKQKYTLPVYRALWN-GSEETKALAIEMFSATSGQLH 614          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Zebrafish
Match: rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:ZFIN;Acc:ZDB-GENE-040718-241])

HSP 1 Score: 364.385 bits (934), Expect = 1.932e-116
Identity = 217/611 (35.52%), Postives = 343/611 (56.14%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDT-KYLDIKKVSVKGTE---TRFDIVDCKIEALGSCL--KIPIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICG-KDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKIPV-DHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLY-QYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMH 1909
            D  + ++   +  EH   D  +DF +K I G+  ++L+ +   Q++L+LD    L + ++++       TR + +     + G+ L  K P   S D+K  + I+Y  T +   + WL PE T GK  PY+F+Q QA+  RS FPC D+P VKSTYSA V+ P+ F  +MSA K E    +G  L   F  +  I +YLVA+  G+L   ++  R+ VW+EP +++ A  E+ +  E+ LS+ E + G YVWG YD+L +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI HSW GNLVTN TW DFWLNEG T Y +R +  + Y  E    L  + G A L++ ++  GE H  N+L V +    DPDD+++  PYEKG   + +L ++ G + +   +LK Y E +K++S+  ++   F+ +Y  + +  +  K++ +D+  W     W   V D    +     +E LA+KW++ N ++    + DL    +S+  +Q  YFL  +   +++ L    ++ +   Y Q   S+N+E+   W  +  ++ ++P    I DFL+SQG+ KYT P+YR L N  ++  K L ++ F      +H
Sbjct:   16 DVATSSSFRQFKIEHFHLDLKVDFLQKSISGTETIELQCIQDSQSELQLDIHPSLSVHEITLSQNARDWTRTEFLTQDFTSYGTTLLVKFPTAFSSDDKLQLAIRYTAT-DGPGVCWLEPEQTAGKLKPYVFTQGQAVLNRSCFPCFDTPAVKSTYSAAVQVPDGFTAVMSANKWEQRKADGAFL---FTMEHPIPAYLVALAVGDLQSAEVGPRTRVWTEPCLLQAAKQEYDNVIEDFLSVGEKLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIVHEICHSWFGNLVTNATWGDFWLNEGFTMYAQRRVCRELY-GEAYTCLEAATGKALLRQHMDNTGEDHPLNKLRVKIEPGVDPDDTYNETPYEKGFCFVSYLAHLTGDQSRFDTFLKAYVEKFKFRSVLAEDALEFYLEYFPELKERNVHKIEGLDFDSWLNVPGWPPYVPDLSAGQTLMKPAELLAEKWLSHNLDLESICKTDL----KSWKTYQTVYFLDRI--LEKSPLPDGNLKKLEECYSQIIKSNNAELKVRWAQIVAKNQYSPGFQHIRDFLSSQGKQKYTLPVYRALWN-GSEETKALAIEMFSATSGQLH 614          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Zebrafish
Match: rnpepl1 (arginyl aminopeptidase like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-5522])

HSP 1 Score: 261.151 bits (666), Expect = 1.140e-76
Identity = 183/628 (29.14%), Postives = 296/628 (47.13%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTK------YLDIKKVSVKGTETRFDIVDCKIEAL---GSCLKIPIGIS----DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVL-VECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPV---DHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSS-NSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSIR 1933
            L D  S +N   +   H   D  ++F  K I G   L+L  +      L LDT        +D K     G    F  +  ++E     GS L I +  +       F V ++Y TT +  A+ WL  E T G+  P +F+Q  ++  RS FPC D+P VKSTYSA V+ P    VLMSA ++    ++    + +F  +  + +YLVA+V G+L    +  RS VW+EP ++  A  +   + E  L++AE + G YVWG YDL+ LPPSFP   MENPCLTF+  ++L   + L+  V HEI H W GN VTN TWE+ WL+EG   Y +R I  + Y  E    L     +  L   +   G+ +  ++L        +P    +   YEKG   + +L  +CG  +    +L+ Y E +++ S+   +   FF  +  + +    A+ + +++++W  G    P+   D    R      + L D W N  P+       DL     S+   Q   FL  L D   + L  +V+  + + Y       N+E+   W+ + +R++  P + ++  FL+      YT P+Y +L       +K   V+ F + +  +HP   ++++
Sbjct:   34 LVDIASASNFHCFKLRHFHLDLHLNFAVKRITGWQVLELTPVQPGVQSLILDTHPSLLIHSVDCKVPGASGAPDVFLSLTYRVEPFTDYGSSLNITLPAAVIRPHRAFRVTVRYTTT-DGPAIWWLDAELTCGQTRPLVFTQGHSVCNRSFFPCFDTPAVKSTYSATVRVPEGVTVLMSASRSAYSKQDR---VFQFSMEYPVPAYLVALVAGDLQHADIGPRSRVWAEPCILTCAVSKLGGSVERWLNVAEGLFGPYVWGRYDLVFLPPSFPIVAMENPCLTFIISSILESQEFLLIDVIHEIAHGWFGNAVTNATWEEMWLSEGLATYAQRRITTEAY-GEAFTCLETVFRLDALHRQMRLLGDNNPVSKLQAKFEPGVNPSSLMNLFTYEKGFCFVSYLSQLCGDIKRFDSFLRAYIEKFRFSSVIAQDLLDFFLGFFPELKEGCVAQREGLEFERWLNG-CGPPLCEPDLSAGRTLTGPVQHLCDLWGNDAPDTQVISTFDL----SSWSTFQTVLFLDRLLD--RSPLSQEVMSLLSSCYAALLDDMNAEVQIRWLQIVVRNSFYPDLPRVRSFLHKHTSRMYTVPLYEDLC---GGVMKCFAVEVFYQTQARLHPNLRRTLQ 646          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 484.952 bits (1247), Expect = 3.276e-163
Identity = 265/609 (43.51%), Postives = 362/609 (59.44%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGIS---DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGN--HLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPIT 1918
            + DP S+A+ E +  +H++    +DF   +I  S +L +++L    A L LDTK L IKKV+V G + +F +        G+ L+I +  S    ++  V I   T+   +ALQWL  E T GK HPYLFSQCQA H RS+ PCQD+P VK TY ++V  P +   LMSA+++ +  ++ +    I+ F Q V I SYL+A+V G L G+K   R+T+W+E E++E + +EF++TE +L  AE + G YVWG YDLL+LPPSFPYGGMENPCLTFVTPT+L GD+SL  V+AHEI+HSWTGNLVTN+TWE+FWLNEGHT Y+ER I +     E  R      G  ELQ S+N +G  +    LVP L E D D +FS VPYEKG  LLF+LE + G  ++ L +LK Y + + YKS+TT++WK F Y Y  DK +I    LD VDWK W +     PV         +A   L+ KW+        S   D + +  S   HQ    L +L    EA L    ++ M  +Y      NSEI F W+ LCIR+     I         QGR+K+T+P+YR+L N+  +  +  TV  FLKN + MHP+T
Sbjct:    1 MADPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFAL-GTSHSFKGTPLEITLPFSLTRGQEVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGELVEQNDCSRKIYCFMQNVPIPSYLIALVVGALEGRKGGPRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLAGDRSLAGVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVNTFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPKYDMTLANACIALSQKWVKAKESDLSSFNADDVKDLSS---HQLIEVLTIL--LLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNF--EKAREETVNTFLKNRSCMHPVT 596          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 442.965 bits (1138), Expect = 3.091e-147
Identity = 253/610 (41.48%), Postives = 344/610 (56.39%), Query Frame = 2
Query:  101 ALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGIS---DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPIT 1918
            A  + DP S+A+ E +  +H++    +DF   +I  S +L +++L    A L LDTK L IKKV+V G + +F +        G+ L+I +  S    ++  V I   T+   +ALQWL  E T GK HPYLFSQCQA H RS+ PCQD+P VK TY ++V  P +   LMSA+++ +                     LV  + G         R+T+W+E E++E + +EF++TE +L  AE + G YVWG YDLL+LPPSFPYGGMENPCLTFVTPT+LV    L+ V+AHEI+HSWTGNLVTN+TWE+FWLNEGHT Y+ER I +     E  R      G  ELQ S+N +G  +    LVP L E D D +FS VPYEKG  LLF+LE + G  ++ L +LK Y + + YKS+TT++WK F Y Y  DK +I    LD VDWK W +     PV         +A   L+ KW+        S   D + +  S   HQ    L +L    EA L    ++ M  +Y      NSEI F W+ LCIR+     I         QGR+K+T+P+YR+L N+  +  +  TV  FLKN + MHP+T
Sbjct:    1 AADMADPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFAL-GTSHSFKGTPLEITLPFSLTRGQEVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGE---------------------LVDCIHGG-------PRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVNTFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPKYDMTLANACIALSQKWVKAKESDLSSFNADDVKDLSS---HQLIEVLTIL--LLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNF--EKAREETVNTFLKNRSCMHPVT 569          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 441.425 bits (1134), Expect = 7.934e-147
Identity = 255/607 (42.01%), Postives = 344/607 (56.67%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGIS---DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPIT 1918
            L DP S+A+ E +  +H++    +DF   +I  S +L +++L    A L LDTK L IKKV+V G + +F +        G+ L+I +  S    ++  V I   T+   +ALQWL  E T GK HPYLFSQCQA H RS+ PCQD+P VK TY ++V  P +   LMSA+++ +                     LV  + G         R+T+W+E E++E + +EF++TE +L  AE + G YVWG YDLL+LPPSFPYGGMENPCLTFVTPT+LV    L+ V+AHEI+HSWTGNLVTN+TWE+FWLNEGHT Y+ER I +     E  R      G  ELQ S+N +G  +    LVP L E D D +FS VPYEKG  LLF+LE + G  ++ L +LK Y + + YKS+TT++WK F Y Y  DK +I    LD VDWK W +     PV   +K  HG  S+       + N +    D KDL         HQ    L +L    EA L    ++ M  +Y      NSEI F W+ LCIR+     I         QGR+K+T+P+YR+L N+  +  +  TV  FLKN + MHP+T
Sbjct:    5 LRDPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFAL-GTSHSFKGTPLEITLPFSLTRGQEVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGE---------------------LVDCIHGG-------PRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVNTFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPNVKILHGIFSQAKESDLSSFNAD----DVKDL-------SSHQLIEVLTIL--LLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNF--EKAREETVNTFLKNRSCMHPVT 562          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 417.542 bits (1072), Expect = 1.382e-137
Identity = 250/607 (41.19%), Postives = 335/607 (55.19%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGIS---DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPIT 1918
            + DP S+A+ E +  +H++    +DF   +I  S +L +++L    A L LDTK L IKKV+V G + +F +        G+ L+I +  S    ++  V I   T+   +ALQWL  E T GK HPYLFSQCQA H RS+ PCQD+P VK TY ++V  P +   LMSA+++ +                        +V  N   +K+      W   +M+ K    F  TE +L  AE + G YVWG YDLL+LPPSFPYGGMENPCLTFVTPT+LV    L+ V+AHEI+HSWTGNLVTN+TWE+FWLNEGHT Y+ER I +     E  R      G  ELQ S+N +G  +    LVP L E D D +FS VPYEKG  LLF+LE + G  ++ L +LK Y + + YKS+TT++WK F Y Y  DK +I    LD VDWK W +     PV   +K  HG  S+       + N +    D KDL         HQ    L +L    EA L    ++ M  +Y      NSEI F W+ LCIR+     I         QGR+K+T+P+YR+L N+  +  +  TV  FLKN + MHP+T
Sbjct:    1 MADPSSFASPEKFNIKHMNLKLHVDFASCVITASTSLTVRSLQDSLASLILDTKDLTIKKVAVNGKDAKFAL-GTSHSFKGTPLEITLPFSLTRGQEVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGE------------------------LVEQNDCSRKIYCFMQNW---QMLGKGFFSF--TEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVNTFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPNVKILHGIFSQAKESDLSSFNAD----DVKDL-------SSHQLIEVLTIL--LLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNF--EKAREETVNTFLKNRSCMHPVT 557          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Xenopus
Match: cd37 (CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804])

HSP 1 Score: 415.231 bits (1066), Expect = 8.511e-137
Identity = 243/557 (43.63%), Postives = 319/557 (57.27%), Query Frame = 2
Query:  260 LDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGIS---DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPIT 1918
            LDTK L IKKV+V G + +F +        G+ L+I +  S    ++  V I   T+   +ALQWL  E T GK HPYLFSQCQA H RS+ PCQD+P VK TY ++V  P +   LMSA+++ +   E N    K             I C    G     R+T+W+E E++E + +EF++TE +L  AE + G YVWG YDLL+LPPSFPYGGMENPCLTFVTPT+LV    L+ V+AHEI+HSWTGNLVTN+TWE+FWLNEGHT Y+ER I +     E  R      G  ELQ S+N +G  +    LVP L E D D +FS VPYEKG  LLF+LE + G  ++ L +LK Y + + YKS+TT++WK F Y Y  DK +I    LD VDWK W +     PV   +K  HG  S+       + N +    D KDL         HQ    L +L    EA L    ++ M  +Y      NSEI F W+ LCIR+     I         QGR+K+T+P+YR+L N+  +  +  TV  FLKN + MHP+T
Sbjct:   30 LDTKDLTIKKVAVNGKDAKFAL-GTSHSFKGTPLEITLPFSLTRGQEVIVEIDSVTSPKSSALQWLTAEQTAGKVHPYLFSQCQATHCRSIIPCQDTPSVKFTYCSQVSVPKELVALMSALRDGELV-EQNDCSRK-------------IYCFMQNG---GPRTTIWTEKELLEPSVYEFSETEKMLKYAEDLVGPYVWGQYDLLILPPSFPYGGMENPCLTFVTPTVLVWSFFLLIVIAHEISHSWTGNLVTNETWENFWLNEGHTVYLERRI-DGLLHGEEFRQFKALGGWKELQNSVNTFGATNPLTNLVPNLHEIDVDAAFSSVPYEKGFALLFYLEQLLGGPEIFLGFLKSYIQMFAYKSVTTEQWKNFLYSYFKDKVDI----LDKVDWKGWMHTPGMPPVQPNVKILHGIFSQAKESDLSSFNAD----DVKDL-------SSHQLIEVLTIL--LLEAPLTVSHVKRMQEVYNLNDVKNSEIRFRWLRLCIRAKCEDVIPLALKMATEQGRMKFTRPLYRDLYNF--EKAREETVNTFLKNRSCMHPVT 548          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Mouse
Match: Lta4h (leukotriene A4 hydrolase [Source:MGI Symbol;Acc:MGI:96836])

HSP 1 Score: 491.5 bits (1264), Expect = 7.162e-166
Identity = 271/620 (43.71%), Postives = 382/620 (61.61%), Query Frame = 2
Query:  107 SLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFL-QVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            SL  P S        T+HL     +DF R+ + G+  L +++  +    L LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSAI++      EDP+++    I++F Q+V I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ ++  +GE H F +LV  L + DPD ++S +PYEKG  LLF+LE + G  ++ L +LK Y + + Y+S+TTD+WK+F Y +  DK ++    L+ VDW  W Y     PV         +A   L+ +W+    E     S +D KDL         HQ   FL QVL   ++A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   V  + +++ +MHP+TA
Sbjct:    9 SLASPASVCR-----TQHLHLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDLTIEKVVINGQEVKYTLGESQGYK-GSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAPDPEDPSRK----IYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFHALGGWGELQNTIKTFGESHPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSVTTDDWKSFLYSHFKDKVDL----LNQVDWNTWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAKEEDLSSFSIADLKDL-------SSHQLNEFLAQVL---QKAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AVHTYQEHKASMHPVTA 601          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Mouse
Match: Rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:MGI Symbol;Acc:MGI:2384902])

HSP 1 Score: 317.39 bits (812), Expect = 3.498e-98
Identity = 182/534 (34.08%), Postives = 295/534 (55.24%), Query Frame = 2
Query:  341 EALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICG-KDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKI------PVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLY-QYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMH 1909
            +AL    + P G +D +F + + Y        + WL PE T GKK P++++Q QA+  R+ FPC D+P VK TYSA ++ P+ F  +MSA   E   K G +    F+    I SYL+A+  G+LA  ++  RS VW+EP ++E A  E++   E  L+  E + G YVWG YDLL +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI+HSW GNLVTN  W +FWLNEG T Y +R I    + +     L  + G A L++ +N  GE +  N+L V +    DPDD+++  PYEKG   + +L ++ G +DQ  ++LK Y + +K++S+  +++  F+ +Y  + +      +   ++ +W     W        P D ++K      +E LA+ W+   P++    Q    +   ++  +Q  YFL  +   +++ L    ++ +G  Y + + + N+E+   W  + +++++     ++ DFL SQG+ KYT P+Y  +    ++  + L    F    + +H
Sbjct:  120 QALCVAFRQPCGAAD-RFELELTY-RVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKCTYSALIEVPDGFTAVMSADTWE---KRGPNKFF-FQMSHPIPSYLIALAIGDLASAEVGPRSRVWAEPCLIEAAKEEYSGVIEEFLATGEKLFGPYVWGRYDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYT-CLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFDRWLNTPGWPPYLPDLSPGDSLMK-----PAEELAELWVTSEPDM----QAIEAVAISTWKTYQLVYFLDKI--LQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQGKQKYTLPLYHAMMGG-SEMARTLAKDTFAATASQLH 634          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Mouse
Match: Rnpep (arginyl aminopeptidase (aminopeptidase B) [Source:MGI Symbol;Acc:MGI:2384902])

HSP 1 Score: 266.929 bits (681), Expect = 1.326e-79
Identity = 166/533 (31.14%), Postives = 272/533 (51.03%), Query Frame = 2
Query:  341 EALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICG-KDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKI------PVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLY-QYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMH 1909
            +AL    + P G +D +F + + Y        + WL PE T GKK P++++Q QA+  R+ FPC D+P VK TYSA ++ P+ F  +MSA   E   K G +    F+    I SYL+A+  G+LA  ++  R                                      YDLL +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI+HSW GNLVTN  W +FWLNEG T Y +R I    + +     L  + G A L++ +N  GE +  N+L V +    DPDD+++  PYEKG   + +L ++ G +DQ  ++LK Y + +K++S+  +++  F+ +Y  + +      +   ++ +W     W        P D ++K      +E LA+ W+   P++    Q    +   ++  +Q  YFL  +   +++ L    ++ +G  Y + + + N+E+   W  + +++++     ++ DFL SQG+ KYT P+Y  +    ++  + L    F    + +H
Sbjct:  120 QALCVAFRQPCGAAD-RFELELTY-RVGEGPGVCWLAPEQTAGKKKPFVYTQGQAVLNRAFFPCFDTPAVKCTYSALIEVPDGFTAVMSADTWE---KRGPNKFF-FQMSHPIPSYLIALAIGDLASAEVGPR--------------------------------------YDLLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEISHSWFGNLVTNANWGEFWLNEGFTMYAQRRISTILFGAAYT-CLEAATGRALLRQHMNVSGEENPLNKLRVKIEPGVDPDDTYNETPYEKGYCFVSYLAHLVGDQDQFDKFLKAYVDEFKFQSILAEDFLEFYLEYFPELKKKGVDSIPGFEFDRWLNTPGWPPYLPDLSPGDSLMK-----PAEELAELWVTSEPDM----QAIEAVAISTWKTYQLVYFLDKI--LQKSPLPPGNVKKLGETYPKISNAQNAELRLRWGQIILKNDYQEEFQKVKDFLQSQGKQKYTLPLYHAMMGG-SEMARTLAKDTFAATASQLH 595          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Mouse
Match: Rnpepl1 (arginyl aminopeptidase (aminopeptidase B)-like 1 [Source:MGI Symbol;Acc:MGI:1914170])

HSP 1 Score: 255.758 bits (652), Expect = 1.843e-74
Identity = 161/522 (30.84%), Postives = 263/522 (50.38%), Query Frame = 2
Query:  386 EKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINL--NPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSS-NSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSIR 1933
            + F V ++Y +T +  A+ WL PE T G   P++F+Q  ++  RS FPC D+P VK TYSA VKAP    VLMSA ++    +EG   ++ F  +  + +YLVA+V G+L    +  RS VW+EP ++  A  + +   E  LS AE + G Y+WG YD++ LPPSFP   MENPCLTF+  ++L  D+ LV  V HE+ HSW GN VTN TWE+ WL+EG   Y +R I  + Y +     L  +  +  L   +   GE    ++L V +    +P    +   YEKG   +++L  +CG  Q    +L+ Y E YK+ S+   +    F  +  + +  S      +++++W         +  L +  G +  R  +    L     +  +      ++   +   Q   FL  L D   + L  +V+ ++   Y     S N+EI   W+ + +R+++ P + ++  FL SQ    YT P+Y +L       +K   ++ F + +  +HP   ++I+
Sbjct:  156 QPFQVILRYTST-DAPAIWWLDPELTYGNAKPFVFTQGHSVCNRSFFPCFDTPAVKCTYSAVVKAPLGVQVLMSATQSVYVEEEG---LYHFHMEHPVPAYLVALVAGDLKPADIGPRSRVWAEPCLLPTATSKLSGAVEQWLSAAERLYGPYMWGRYDIVFLPPSFPIVAMENPCLTFIISSILESDEFLVIDVIHEVAHSWFGNAVTNATWEEMWLSEGLATYAQRRITTETYGAAFT-CLETAFRLDALHRQMRLLGEDSPVSKLQVKLEPGVNPSHLMNLFTYEKGYCFVYYLSQLCGGPQRFDDFLRAYVEKYKFTSVVAQDLLDSFLSFFPELKEQSVDCRAGLEFERWLNATGPPLAEPDLSQ--GSSLTRPVEALFQLWTAEPLEQAAASASAIDISKWRTFQTALFLDRLLD--GSPLPQEVVMSLSKCYSSLLDSMNAEIRIRWLQIVVRNDYYPDLHRVRRFLESQMSRMYTIPLYEDLC---TGALKSFALEVFYQTQGRLHPNLRRTIQ 665          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Mouse
Match: Lnpep (leucyl/cystinyl aminopeptidase [Source:MGI Symbol;Acc:MGI:2387123])

HSP 1 Score: 115.161 bits (287), Expect = 6.883e-26
Identity = 114/414 (27.54%), Postives = 200/414 (48.31%), Query Frame = 2
Query:  206 GSVNLQLKNLTKKQADLKLDTKYLDIKKVS----VKGTETRFDIVDCKI-EALGSCLKIPIGISDEKFSVCIQYATTANCT--ALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAI--KNEDPTKEGNHLIH-KFEQKVNISSYLVAIVCG---NLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLL-------VGDKSLVF-VVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRH--LLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDE-WKAF 1369
            GSV + L+ L   + D+ L +   +I +V+    V   E + +I++    E +      P+ ++   +++ I+Y+   + +      +       +K  +  +Q + + ARS FPC D P  K+T+  K+   N+ +  +S +  K+  P +EG  LI  +F + V +S+YLVA + G   NL+        +V++ PE + +  H    T  LL   ++    +Y     DL+ +P  F  G MEN   LTF   TLL       V D+ LV  ++AHE+ H W GNLVT + W D WLNEG   ++E   +EK +  EL  +   L +      ++SLN+    H  +  V    +   ++ F  + Y KG++LL  L++   +D     +  Y  ++ Y ++ +D+ W +F
Sbjct:  192 GSVTISLQALQDTR-DIILHSTGHNISRVTFMSAVSSQEKQVEILEYPYHEQIAVVAPEPL-LTGHNYTLKIEYSANISNSYYGFYGITYTDKSNEKKYFAATQFEPLAARSAFPCFDEPAFKATFIIKI-TRNEHHTALSNMPKKSSVPAEEG--LIQDEFSESVKMSTYLVAFIVGEMRNLSQDVNGTLVSVYAVPEKIGQVHHALDTTIKLLEFYQTYFEIQYPLKKLDLVAIP-DFEAGAMENWGLLTFREETLLYDNATSSVADRKLVTKIIAHELAHQWFGNLVTMQWWNDLWLNEGFATFMEYFSVEKIF-KELNSYEDFLDARFKTMRKDSLNS---SHPISSSVQSSEQI--EEMFDSLSYFKGASLLLMLKSYLSEDVFRHAVILYLHNHSYAAIQSDDLWDSF 593          
BLAST of Leukotriene A(4) hydrolase vs. UniProt/SwissProt
Match: sp|Q3SZH7|LKHA4_BOVIN (Leukotriene A-4 hydrolase OS=Bos taurus OX=9913 GN=LTA4H PE=2 SV=3)

HSP 1 Score: 495.738 bits (1275), Expect = 9.786e-167
Identity = 275/616 (44.64%), Postives = 376/616 (61.04%), Query Frame = 2
Query:  107 SLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGIS---DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN-EDPTKEG-NHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWI-----NLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            SL  P S        T+HL     IDF R+++ G+  L +++       L LDTK L I+KV + G E ++ + + +    GS ++I + I+   +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TYSA+V  P +   LMSAI++ E P  E  N  I++F QKV I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G Y+WG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ S+  +GE H F +LV  L   DPD ++S VPYEKG  LLF+LE + G  ++ L +LK Y E + YKS+TTD WK F Y +  DK +I    L+ VDW  W Y     PV         +A   L+ +WI     +LN   S +D KD       F  HQ   FL  +   + A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   ++ + +++ +MHP+TA
Sbjct:    9 SLASPASVCQ-----TKHLHLRCSIDFTRRVLSGTAALTIQSQEDNLRSLILDTKDLTIEKVVINGQEVKYTLGE-RQSYKGSPIEISLPIALCKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYSAEVSVPKELVALMSAIRDGEAPDPEDPNRKIYRFSQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYIWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFHALGGWGELQNSIKTFGETHPFTKLVVDLTNTDPDVAYSSVPYEKGFALLFYLEQLLGGPEVFLGFLKAYVEKFSYKSITTDNWKDFLYSHFKDKVDI----LNQVDWNTWLYSPGLPPVKPNYDMTLTNACISLSQRWITAKDDDLN-SFSSADLKD-------FSSHQVNEFLAQM--LQNAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AIRTYKEHKASMHPVTA 601          
BLAST of Leukotriene A(4) hydrolase vs. UniProt/SwissProt
Match: sp|Q6S9C8|LKHA4_CHILA (Leukotriene A-4 hydrolase OS=Chinchilla lanigera OX=34839 GN=LTA4H PE=2 SV=3)

HSP 1 Score: 495.738 bits (1275), Expect = 1.000e-166
Identity = 271/605 (44.79%), Postives = 374/605 (61.82%), Query Frame = 2
Query:  152 TEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFL-QVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            T+HL     +DF  + + G   L +++       L LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSA+++      EDP+++    I+KF QKV I  YL+A+V G L  +K+  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ ++  +GE H F +LV  L + DPD ++S VPYEKG  LLFHLE + G  ++ L +LK Y E + YKS+TTD+WK F Y +  DK +I    L+ VDW  W Y     PV         +A   L+ +WI    E     + +D KDL         HQ   FL QVL   ++A L    ++ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   ++ +  ++ +MHP+TA
Sbjct:   19 TKHLHLRCSVDFSSRALTGIAALTIQSQEDNLRSLVLDTKALTIEKVVINGQEVKYALGE-RQSYKGSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAVLPCQDTPSVKLTYTAEVSVPKELVALMSAVRDGETPDPEDPSRK----IYKFNQKVPIPCYLIALVVGALESRKIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFHALGGWGELQNTIKTFGETHPFTKLVVDLTDVDPDVAYSSVPYEKGFALLFHLEQLLGGPEVFLGFLKAYVERFSYKSITTDDWKNFLYSHFKDKVDI----LNQVDWNAWLYSPGLPPVKPNYDMTLTNACIALSQRWITAKEEDLNTFNATDLKDLST-------HQVNEFLAQVL---QQAPLPLGHVKRMQEVYNFNAVNNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AIRTYQAHKASMHPVTA 601          
BLAST of Leukotriene A(4) hydrolase vs. UniProt/SwissProt
Match: sp|P09960|LKHA4_HUMAN (Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2)

HSP 1 Score: 493.812 bits (1270), Expect = 5.580e-166
Identity = 273/619 (44.10%), Postives = 377/619 (60.90%), Query Frame = 2
Query:  107 SLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            SL  P S        T+HL     +DF R+ + G+  L +++       L LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSAI++      EDP+++    I+KF QKV I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ S+  +GE H F +LV  L + DPD ++S VPYEKG  LLF+LE + G  ++ L +LK Y E + YKS+TTD+WK F Y Y  DK ++    L+ VDW  W Y     P+         +A   L+ +WI    +     + +D KDL         HQ   FL      + A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   V+ + +++ +MHP+TA
Sbjct:    9 SLASPASVCR-----TKHLHLRCSVDFTRRTLTGTAALTVQSQEDNLRSLVLDTKDLTIEKVVINGQEVKYALGE-RQSYKGSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKEHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGETPDPEDPSRK----IYKFIQKVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFNALGGWGELQNSVKTFGETHPFTKLVVDLTDIDPDVAYSSVPYEKGFALLFYLEQLLGGPEIFLGFLKAYVEKFSYKSITTDDWKDFLYSYFKDKVDV----LNQVDWNAWLYSPGLPPIKPNYDMTLTNACIALSQRWITAKEDDLNSFNATDLKDL-------SSHQLNEFLA--QTLQRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEDAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AVRTYQEHKASMHPVTA 601          
BLAST of Leukotriene A(4) hydrolase vs. UniProt/SwissProt
Match: sp|P24527|LKHA4_MOUSE (Leukotriene A-4 hydrolase OS=Mus musculus OX=10090 GN=Lta4h PE=1 SV=4)

HSP 1 Score: 491.5 bits (1264), Expect = 5.010e-165
Identity = 271/620 (43.71%), Postives = 382/620 (61.61%), Query Frame = 2
Query:  107 SLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFL-QVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            SL  P S        T+HL     +DF R+ + G+  L +++  +    L LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQCQAIH R++ PCQD+P VK TY+A+V  P +   LMSAI++      EDP+++    I++F Q+V I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ ++  +GE H F +LV  L + DPD ++S +PYEKG  LLF+LE + G  ++ L +LK Y + + Y+S+TTD+WK+F Y +  DK ++    L+ VDW  W Y     PV         +A   L+ +W+    E     S +D KDL         HQ   FL QVL   ++A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   V  + +++ +MHP+TA
Sbjct:    9 SLASPASVCR-----TQHLHLRCSVDFARRTLTGTAALTVQSQEENLRSLTLDTKDLTIEKVVINGQEVKYTLGESQGYK-GSPMEISLPIALSKNQEIVIEISFETSPKSSALQWLTPEQTSGKQHPYLFSQCQAIHCRAILPCQDTPSVKLTYTAEVSVPKELVALMSAIRDGEAPDPEDPSRK----IYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSANEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFHALGGWGELQNTIKTFGESHPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVKKFSYQSVTTDDWKSFLYSHFKDKVDL----LNQVDWNTWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAKEEDLSSFSIADLKDL-------SSHQLNEFLAQVL---QKAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AVHTYQEHKASMHPVTA 601          
BLAST of Leukotriene A(4) hydrolase vs. UniProt/SwissProt
Match: sp|P30349|LKHA4_RAT (Leukotriene A-4 hydrolase OS=Rattus norvegicus OX=10116 GN=Lta4h PE=2 SV=2)

HSP 1 Score: 478.019 bits (1229), Expect = 7.681e-160
Identity = 269/620 (43.39%), Postives = 377/620 (60.81%), Query Frame = 2
Query:  107 SLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFL-QVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            SL  P S        T+HL     +DF R+ + G+  L +++       L LDTK L I+KV + G E ++ + + +    GS ++I  PI +S +++  + I + T+   +ALQWL PE T GK+HPYLFSQ +AIH R++ PCQD+  VK TY+A+V  P +   LMSAI++      EDP+++    I++F Q+V I  YL+A+V G L  +++  R+ VWSE E VEK+A+EF++TE++L IAE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GDKSL  V+AHEI+HSWTGNLVTNKTW+ FWLNEGHT Y+ER I  + +  E  RH     G  ELQ ++  +GE H F +LV  L + DPD ++S +PYEKG  LLF+LE + G  ++ L +LK Y E + Y+S+TTD+WK+F Y +  DK ++    L+ VDW  W Y     PV         +A   L+ +W+    E     S  D KDL         HQ   FL QVL   + A L    I+ M  +Y +   +NSEI F W+ LCI+S    AI         QGR+K+T+P++++LA +   H +   V+ + +++  MHP+TA
Sbjct:    9 SLASPASVCR-----TQHLHLRCSVDFARRALTGTAALTVQSQEDNLRTLTLDTKDLTIEKVVINGQEVKYTLGESQGYK-GSPMEISLPIALSKNQEVVIEISFETSPKSSALQWLTPEQTSGKQHPYLFSQWEAIHCRAILPCQDT-SVKLTYTAEVSVPKELVALMSAIRDGEAPDPEDPSRK----IYRFNQRVPIPCYLIALVVGALESRQIGPRTLVWSEKEQVEKSAYEFSETESMLKIAEDLGGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDKSLSNVIAHEISHSWTGNLVTNKTWDHFWLNEGHTVYLERHICGRLF-GEKFRHFHALGGWGELQNTIKTFGESHPFTKLVVDLKDVDPDVAYSSIPYEKGFALLFYLEQLLGGPEVFLGFLKAYVEKFSYQSVTTDDWKSFLYAHFKDKVDL----LNQVDWNAWLYAPGLPPVKPNYDVTLTNACIALSQRWVTAKEEDLNSFSIEDLKDL-------SSHQLNEFLAQVL---QRAPLPLGHIKRMQEVYNFNAINNSEIRFRWLRLCIQSKWEEAIPLALKMATEQGRMKFTRPLFKDLAAFDKSHDQ--AVRTYQEHKACMHPVTA 600          
BLAST of Leukotriene A(4) hydrolase vs. TrEMBL
Match: A0A0V0J1C4 (Leuk-A4-hydro_C domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR128187 PE=4 SV=1)

HSP 1 Score: 518.85 bits (1335), Expect = 4.735e-173
Identity = 269/611 (44.03%), Postives = 364/611 (59.57%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNL---TKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTK--EGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLE-YESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            DP S +N E ++T H++FDW IDF+ K I G V  ++      T     L  D K L+I KV +  TET++ + D     LGSCLKI +      F++ I Y T+    ALQWL    T  K+ P+LF+QCQAIHARSLFPCQD+P VK TY+A V+A     VLMSA    D T+     + +H FEQ + + SYLVA+VCG+L   ++  RS VW+EP +VE+AA EF + + ++S AE ICG Y WG YD+LVLPPSFP+GGMENPCLTFVTPTLL GD+SL+  +AHE +HSWTGNLVTN +WE+FWLNEGHT+Y+E L++E  Y  +  R L I +G  ELQ  L  + +GH F +LVP L   DPDD FS +PY+KGS LL+ LE   GK  ML+WL+ Y +H++  SL+T  W  F  K       +    L  V+W  WFY    IP      R      + +    I     I+D +    +   YES +P Q+   LQ L   +   +H   +  +  + Q + S NSE+ + W ++C+RS + P +    +FLNSQGR+K+T+PIY+ L +     I    + NF      MHP TAK +
Sbjct:   19 DPSSNSNPEYFLTRHVNFDWTIDFNTKTISGCVAYEMVAFDLSTAPDQMLVFDVKDLEISKVCINETETKWLVTDGPHPQLGSCLKIHLPEQTASFTLHIGYQTSPQSPALQWLDAAITADKQKPFLFTQCQAIHARSLFPCQDTPRVKFTYTATVRADPCMTVLMSAKYCADSTECPSSGNPVHNFEQPIPVPSYLVALVCGDLRSAQIGPRSKVWAEPSVVERAAFEFGEVDQVISAAERICGPYQWGNYDILVLPPSFPFGGMENPCLTFVTPTLLAGDRSLICTIAHEASHSWTGNLVTNASWENFWLNEGHTKYLEGLVLEAMYGVD-YRELHIELGYEELQACLADFKQGHPFTKLVPCLDGVDPDDCFSIIPYQKGSLLLYFLEQKYGKPAMLKWLRAYLDHFRGLSLSTRSWLDFLSK------QLGPNVLTEVNWNDWFYKTGAIPWVPKFTRKLSTVCDSVVSA-ITKEVLINDPNVASFVRSTYESLMPLQRQLVLQRL--LERVPIHHDNLRVLDQMLQISQSKNSELRYRWSLICLRSQYLPGLHSALEFLNSQGRMKFTRPIYKALMS--CQSIAEQAINNFKAQRQNMHPTTAKLV 617          
BLAST of Leukotriene A(4) hydrolase vs. TrEMBL
Match: A0A068WHC1 (Leukotriene A 4 hydrolase OS=Echinococcus granulosus OX=6210 GN=EgrG_000972400 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 8.227e-173
Identity = 266/617 (43.11%), Postives = 373/617 (60.45%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNL---TKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLL-EYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            ++DP S +N E ++T+H+DFDW +DFD K++ G V L L  +      +  L+LD K +++ ++ +      F +       LG+ L I +G+   +F V I+Y T    +ALQWL  + T  KK P+LF+QCQAIHARSLFPCQD+P VK T+SA V AP +  VLM A ++      ++P K     IH F Q + I SYLVA+ CG L   ++  RS VW+EP ++  A  EF   ++++++AES+CG+Y WG+YD+LVLPPSFPYGGMENPCLTFVTP LL GDKSL  V+AHEI HSWTGNLVTN +WE FWLNEGHT+Y+E LI+E+ Y ++  R L I +G  EL   L  + EGH   ++VP L     DD+FS VPY+KGS  L+ LEN  GK  +L WLK Y  H++  SL+T  W  F   ++       K  L  +DW  W Y    IP      R      +++A++ I   P  SD++    +  +YE+ LP Q+    + L   K   L    +  + N+   +TS N+EI F W ++ + S + P +D   +FLNSQGR+KYT+PIY+ L  WP+  IK+  + N+  N+  MHP TAK +
Sbjct:   17 IDDPSSESNPELFLTQHVDFDWKVDFDAKVVSGCVKLHLMPMDFFASCRDTLRLDIKDINVSRIHINNEPVEFTVDAGSYPNLGNVLSIKVGLQTSRFVVVIEYCTMPQSSALQWLDAQMTADKKQPFLFTQCQAIHARSLFPCQDTPRVKFTFSASVLAPPEVTVLMGAHRSTPSGHCDEPEKPS---IHYFHQDIPIPSYLVALACGELDHARIGQRSFVWAEPSVLPWAKAEFEGVDDMIAVAESLCGDYEWGVYDILVLPPSFPYGGMENPCLTFVTPCLLAGDKSLTSVIAHEIAHSWTGNLVTNASWEHFWLNEGHTKYVEGLILERLYGTDY-RELFIDLGYEELLVCLEEFKEGHPLAKMVPCLKGIHTDDAFSIVPYQKGSLFLYFLENKYGKAAVLSWLKSYISHFRRHSLSTRVWIEFLAAHL------GKNILQEIDWNTWLYHAGSIPWVPKTNRKLSSVVDKVAER-IKNTPLGSDAESAAYVRGQYETMLPLQRQLLWRRL--LKCVPLSHDNLLVLNNMLAVSTSKNAEIRFLWSLIVLYSQYLPGVDGALEFLNSQGRMKYTRPIYKALVAWPS--IKQQAINNYKANKQYMHPTTAKLV 618          
BLAST of Leukotriene A(4) hydrolase vs. TrEMBL
Match: A0A0X3PPR4 (Leuk-A4-hydro_C domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR128187 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 9.887e-173
Identity = 268/612 (43.79%), Postives = 365/612 (59.64%), Query Frame = 2
Query:  113 NDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNL---TKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTK--EGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLE-YESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
             DP S +N E ++T H++FDW IDF+ K I G V  ++      T     L  D K L+I KV +  TET++ + D     LGSCLKI +      F++ I Y T+    ALQWL    T  K+ P+LF+QCQAIHARSLFPCQD+P VK TY+A V+A     VLMSA    D T+     + +H FEQ + + SYLVA+VCG+L   ++  RS VW+EP +VE+AA EF + + ++S AE ICG Y WG YD+LVLPPSFP+GGMENPCLTFVTPTLL GD+SL+  +AHE +HSWTGNLVTN +WE+FWLNEGHT+Y+E L++E  Y  +  R L I +G  ELQ  L  + +GH F +LVP L   DPDD FS +PY+KGS LL+ LE   GK  ML+WL+ Y +H++  SL+T  W  F  K       +    L  V+W  WFY    IP      R      + +    I      SD++  D +   YE  +  Q+   LQ L   +        +  +  ++Q + + NSEI + W ++C+RS + P +    +FLNSQGR+K+T+PIY+ L +WP+  +    + NF      MHP TAK +
Sbjct:   18 RDPSSNSNPEYFLTRHVNFDWTIDFNTKTISGCVAYEMVAFDLSTAPDQMLVFDVKDLEISKVCINETETKWLVTDGPHPQLGSCLKIHLPEQTASFTLHIGYQTSPQSPALQWLDAAITADKQKPFLFTQCQAIHARSLFPCQDTPRVKFTYTATVRADPCMTVLMSAKYCADSTECPSSGNPVHNFEQPIPVPSYLVALVCGDLRSAQIGPRSKVWAEPSVVERAAFEFGEVDQVISAAERICGPYQWGNYDILVLPPSFPFGGMENPCLTFVTPTLLAGDRSLICTIAHEASHSWTGNLVTNASWENFWLNEGHTKYLEGLVLEAMYGVDY-RELHIELGYEELQACLADFKQGHPFTKLVPCLDGVDPDDCFSIIPYQKGSLLLYFLEQKYGKPAMLKWLRAYLDHFRGLSLSTRSWLDFLSK------QLGPNVLTEVNWDDWFYKTDAIPWVPNFTRKLSTVCDSVVSA-ITKEDLRSDANVADSVRSTYEGLVSLQRQLVLQRL--LERVPFPHDNLRVLDQMFQISQAKNSEIRYRWSLICLRSQYLPGLHSALEFLNSQGRMKFTRPIYKALMSWPS--VAEQAISNFKAQRQNMHPTTAKLV 617          
BLAST of Leukotriene A(4) hydrolase vs. TrEMBL
Match: W6UMY4 (Leukotriene A-4 hydrolase OS=Echinococcus granulosus OX=6210 GN=EGR_02555 PE=4 SV=1)

HSP 1 Score: 518.079 bits (1333), Expect = 1.460e-172
Identity = 266/617 (43.11%), Postives = 373/617 (60.45%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNL---TKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN------EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLL-EYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            ++DP S +N E ++T+H+DFDW +DFD K++ G V L L  +      +  L+LD K +++ ++ +      F +       LG+ L I +G+   +F V I+Y T    +ALQWL  + T  KK P+LF+QCQAIHARSLFPCQD+P VK T+SA V AP +  VLM A ++      ++P K     IH F Q + I SYLVA+ CG L   ++  RS VW+EP ++  A  EF   ++++++AES+CG+Y WG+YD+LVLPPSFPYGGMENPCLTFVTP LL GDKSL  V+AHEI HSWTGNLVTN +WE FWLNEGHT+Y+E LI+E+ Y ++  R L I +G  EL   L  + EGH   ++VP L     DD+FS VPY+KGS  L+ LEN  GK  +L WLK Y  H++  SL+T  W  F   ++       K  L  +DW  W Y    IP      R      +++A++ I   P  SD++    +  +YE+ LP Q+    + L   K   L    +  + N+   +TS N+EI F W ++ + S + P +D   +FLNSQGR+KYT+PIY+ L  WP+  IK+  + N+  N+  MHP TAK +
Sbjct:   30 IDDPSSESNPELFLTQHVDFDWKVDFDAKVVSGCVKLHLMPMDFFASCRDTLRLDIKDINVSRIHINNEPVEFTVDAGSYPNLGNVLSIKVGLQTSRFVVVIEYCTMPQSSALQWLDAQMTADKKQPFLFTQCQAIHARSLFPCQDTPRVKFTFSASVLAPPEVTVLMGAHRSTPSGHCDEPEKPS---IHYFHQDIPIPSYLVALACGELDHARIGQRSFVWAEPSVLPWAKAEFEGVDDMIAVAESLCGDYEWGVYDILVLPPSFPYGGMENPCLTFVTPCLLAGDKSLTSVIAHEIAHSWTGNLVTNASWEHFWLNEGHTKYVEGLILERLYGTDY-RELFIDLGYEELLVCLEEFKEGHPLAKMVPCLKGIHTDDAFSIVPYQKGSLFLYFLENKYGKAAVLSWLKSYISHFRRHSLSTRVWIEFLAAHL------GKNILQEIDWNTWLYHAGSIPWVPKTNRKLSSVVDKVAER-IKNTPLGSDAESAAYVRGQYETMLPLQRQLLWRRL--LKCVPLSHDNLLVLNNMLAVSTSKNAEIRFLWSLIVLYSQYLPGVDGALEFLNSQGRMKYTRPIYKALVAWPS--IKQQAINNYKANKQYMHPTTAKLV 631          
BLAST of Leukotriene A(4) hydrolase vs. TrEMBL
Match: A0A5K3FS52 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 1.476e-172
Identity = 265/614 (43.16%), Postives = 373/614 (60.75%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQAD---LKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPT---KEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLL-LEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            + DP S +N E +VT+H+DFDW +DF+ +++ G V L +  L    AD   LKLD K +++  V++      F I +     LG+ L + +G     F+V I+Y TT   +ALQWL  + T  KK P+LF+QCQAIHARSLFPCQD+P VK TY+A V AP    VLMSA +   P    +  +  +H F Q + I SYLVA+ CG L   ++ +RS VW+EP ++ +A  EF + + L++ AES+CGEY WGIYD+LVLPPSFPYGGMENPCLTFVTPTLL GD+SL  V+AHEI+HSWTGNLVTN +WE FWLNEGHT+Y+E L++E  Y ++  R L I +G  ELQ  L  + EGH   ++VP L     DD+FS +PY+KGS LL++LE   GK  +L WLK Y  H++  SL+T  W  F   ++       +  L  V+W +W YG   IP      R      +++ ++ I   P  SD+D    +  +YE  +P Q+    Q L   K   L    +  + ++   + S N+EI + W ++ + S + P +D   +FLNSQGR+K+T+PIY+ L  WP   I++  + NF  +   +HP TAK +
Sbjct:   17 VQDPSSQSNPELFVTQHVDFDWKVDFNARVLSGKVTLHMTPLDLYSADSVALKLDIKDINVLCVNINEKPAEFTIQNGSHPNLGNVLCVDVGYQRSGFTVVIEYDTTPQSSALQWLDAQMTADKKCPFLFTQCQAIHARSLFPCQDTPRVKFTYTACVIAPPGVTVLMSAQRPTSPRHCDEPESPSMHFFTQDIPIPSYLVALACGELVSARIGSRSLVWAEPSVLPRAQLEFNEVDTLIAAAESLCGEYEWGIYDILVLPPSFPYGGMENPCLTFVTPTLLAGDRSLTSVIAHEISHSWTGNLVTNASWEHFWLNEGHTKYVEGLVLELLYGTDY-RELFIELGYEELQICLGEFKEGHPLAKMVPCLTGVHTDDAFSVIPYQKGSLLLYYLEQTYGKAAILSWLKSYISHFRRHSLSTRTWMDFLAAHL------GQTVLQEVNWNEWLYGSGPIPWVPKSDRKLSSVVDQVVER-IRSTPLGSDTDSAAYVRCQYELMIPLQRQLLWQRL--LKYIPLSHDNLRVLDSMLAVSRSQNAEIRYRWSLIVLYSQYLPGVDCALEFLNSQGRMKFTRPIYKALMAWPT--IRQQAINNFKSHRPFLHPTTAKLV 618          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Cavefish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 407.142 bits (1045), Expect = 8.553e-134
Identity = 239/615 (38.86%), Postives = 342/615 (55.61%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN---EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPV---DHVLKRDHGDASERLADKWINL-NPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYR--NLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            + D  S+++    +T HL+     DF  +++ G V L ++ L  K + L LDTK L I KVS  G   +F++   +    GS L I  P  +S +   V ++Y T+ + +ALQWL P  T GKKHPYLFSQCQA H R++ PCQD+P VK TY A+V  P +   +MSA+++    DPT + + +I++F Q V + SYL+A+V G L  +++  RS VWSE E V++ A EF +TE +L  AES+ G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL GD+SL  V+AHEI+HSWTGNLVTNKTWE F                                       ++ +G  +    LV  L   +PD+ FS VPYEKG  LL+HLE + G    + ++K Y + + Y S+TT++WK + + Y  DK +I    L+ VDW  W Y     P    D  L     DA   LA +W    + ++S   + D+    +    HQ   FL +L    +  L +  ++ M  +Y++ + +NSEI   W+ LC++S    A+         QGR+K+T+P++   N A + ++      VK F ++ N MH +TA
Sbjct:    4 VTDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLKIFKVSANGQAAKFEL-GAQHGFKGSPLDITLPFELSGQHVIVEVEYETSPSASALQWLSPAQTAGKKHPYLFSQCQATHCRTMVPCQDTPSVKHTYYAQVSVPKELIAVMSAVRDGQEADPT-DSSRVIYRFRQPVPMPSYLIALVVGALESREIGPRSRVWSEKEHVDQGAFEFTETETMLKTAESLAGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLAGDRSLSNVIAHEISHSWTGNLVTNKTWEHF---------------------------------------VHQFGANNAATNLVVNLEGVNPDECFSCVPYEKGFALLYHLEELMGGPVFMGFVKSYIQMFAYSSVTTEQWKDYLFTYFKDKVDI----LNKVDWNGWMYTPGMPPFKPYDTTL----ADACNALAQRWTKAKDADLSGFSEADI----KQLSSHQLIEFLALLL--LQDPLPTSHVKRMQEVYKFNSINNSEIR-CWLRLCVKSEWEDAVPLALKMATEQGRMKFTRPLFDVYNFAKFRDE-----AVKVFKEHRNEMHSVTA 557          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Cavefish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 395.201 bits (1014), Expect = 3.780e-129
Identity = 231/609 (37.93%), Postives = 337/609 (55.34%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGISDEKFSVC-IQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINL-NPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            + D  S+++    +T HL+     DF  +++ G V L ++ L  K + L LDTK L I KVS  G   +F++   +    GS L I  P  +S  +  +  ++Y T+ + +ALQWL P  T GKKHPYLFSQCQA H R++ P                   Q ++ +   +  DPT + + +I++F Q V + SYL+A+V G L  +++  RS VWSE E V++ A EF +TE +L  AES+ G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLLV   +   V+AHEI+HSWTGNLVTNKTWE FWLNEGHT Y+ER+I                         ++ +G  +    LV  L   +PD+ FS VPYEKG  LL+HLE + G  ++ + ++K Y + + Y S+TT++WK + + Y  DK +I    L+ VDW  W Y     P          DA   LA +W    + ++S   + D+    +    HQ   FL +L   +   L +  ++ M  +Y++ + +NSEI   W+ LC++S    A+         QGR+K+T+P++R++ N+     +   VK F ++ N MH +TA
Sbjct:    4 VTDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLKIFKVSANGQAAKFEL-GAQHGFKGSPLDITLPFELSRGQHVIVEVEYETSPSASALQWLSPAQTAGKKHPYLFSQCQATHCRTMVP---------------NLLTQTHIAVRDGQEADPT-DSSRVIYRFRQPVPMPSYLIALVVGALESREIGPRSRVWSEKEHVDQGAFEFTETETMLKTAESLAGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLLVSTCNSPGVIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGR-----------------------VHQFGANNAATNLVVNLEGVNPDECFSCVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQMFAYSSVTTEQWKDYLFTYFKDKVDI----LNKVDWNGWMYTPGMPPFKPQYDTTLADACNALAQRWTKAKDADLSGFSEADI----KQLSSHQLIEFLALLLL-QVDPLPTSHVKRMQEVYKFNSINNSEIRCRWLRLCVKSEWEDAVPLALKMATEQGRMKFTRPLFRDVYNFAK--FRDEAVKVFKEHRNEMHSVTA 561          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Cavefish
Match: lta4h (leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE-040426-2477])

HSP 1 Score: 391.349 bits (1004), Expect = 1.392e-127
Identity = 232/615 (37.72%), Postives = 335/615 (54.47%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIP---------IGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINL-NPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            + D  S+++    +T HL+     DF  +++ G V L ++ L  K + L LDTK L I KVS  G   +F++   +    GS L I          I IS +   V ++Y T+ + +ALQWL P  T GKKHPYLFSQCQA H R++ P                   Q ++ +   +  DPT + + +I++F Q V + SYL+A+V G L  +++  RS VWSE E V++ A EF +TE +L  AES+ G YVWG YDLLVLPPSFPYGGMENPCLTFVTPTLL        V+AHEI+HSWTGNLVTNKTWE FWLNEGHT Y+ER+I                         ++ +G  +    LV  L   +PD+ FS VPYEKG  LL+HLE + G  ++ + ++K Y + + Y S+TT++WK + + Y  DK +I    L+ VDW  W Y     P          DA   LA +W    + ++S   + D+    +    HQ   FL +L   +   L +  ++ M  +Y++ + +NSEI   W+ LC++S    A+         QGR+K+T+P++R++ N+     +   VK F ++ N MH +TA
Sbjct:    4 VTDHCSFSSFSKCLTRHLNLSLQADFSSRVLRGRVALTVEVLEDKFSSLTLDTKDLKIFKVSANGQAAKFEL-GAQHGFKGSPLDITLPFELSRLCIFISGQHVIVEVEYETSPSASALQWLSPAQTAGKKHPYLFSQCQATHCRTMVP---------------NLLTQTHIAVRDGQEADPT-DSSRVIYRFRQPVPMPSYLIALVVGALESREIGPRSRVWSEKEHVDQGAFEFTETETMLKTAESLAGPYVWGQYDLLVLPPSFPYGGMENPCLTFVTPTLL--------VIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGR-----------------------VHQFGANNAATNLVVNLEGVNPDECFSCVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQMFAYSSVTTEQWKDYLFTYFKDKVDI----LNKVDWNGWMYTPGMPPFKPQYDTTLADACNALAQRWTKAKDADLSGFSEADI----KQLSSHQLIEFLALLLL-QVDPLPTSHVKRMQEVYKFNSINNSEIRCRWLRLCVKSEWEDAVPLALKMATEQGRMKFTRPLFRDVYNFAK--FRDEAVKVFKEHRNEMHSVTA 559          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Cavefish
Match: rnpep (arginyl aminopeptidase [Source:NCBI gene;Acc:103045130])

HSP 1 Score: 340.502 bits (872), Expect = 1.937e-107
Identity = 211/617 (34.20%), Postives = 331/617 (53.65%), Query Frame = 2
Query:  101 ALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDT-KYLDIKKVSVKGTE---TRFDIVDCKIEALGSCLKIPIGI---SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKIPV-DHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTT-SSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPN-DHIKRLTVKNFLKNENTMH 1909
            A +  D  + ++   +  EH   D  +DFD++ + G+ +L+++      A+L LD+   L++ +VS    E   T          + GS L +       S ++F + I+Y T      + WL PE T GK  PY+F+Q QA+  RS FPC D+P VKSTY+A +K P+ F  +MSA K E   K  N  +   EQ   I +YLVA+  G+L   ++  RS VW+EP ++E A  E+    E  L + E + G YVWG YD+L +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI HSW GNLVTN  W DFWLNEG T Y +R I ++ Y  E    L  + G A L++ ++  GE H  N+L V +    DPDD+++  PYEKG   + +L ++ G  +    +LK Y + +K++S+  ++   FF ++  D +  S  K++ +++  W     W + + D    +     +++LAD W   + +I+   +    +  E++  +Q  YFL  +   +++ L       +   Y +   S+N+E+   W  +  ++ H P    +  FL+ QG+ KYT P+YR L  W   + +K L  + F    + +H
Sbjct:   10 ADTAEDVATSSSFRRFRIEHFHLDLQVDFDQRSLSGTESLRVRCALGSAAELLLDSHPSLELHEVSFSRDERDWTAAQFHSRDFTSYGSTLVVQFPTAWSSGDQFHLSIKY-TAHQGPGVCWLDPEQTAGKLRPYVFTQGQAVLNRSFFPCFDTPAVKSTYTAAIKVPDGFTAVMSATKWEH-RKADNTFLFSMEQP--IPAYLVALAVGDLVSAEVGPRSRVWTEPCLLEAAKKEYDGVIEEFLLVGERLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEICHSWFGNLVTNANWGDFWLNEGFTMYAQRRICKELY-GEAYTCLEAATGRALLRQHMDNTGEDHPLNKLRVKIKPGVDPDDTYNETPYEKGFCFVSYLAHLRGDQKRFDAFLKAYVDRFKFRSVIAEDALEFFLEFFPDLKKNSVHKIEGLEFDSWLNVSGWPLYLPDLSAGQSLMKPADQLADLWGADSVDIAAISK----INTEAWKTYQTVYFLDKI--IEKSPLPDGNTRMLEEQYPHMVKSNNAELRLRWAQIVAKNQHKPGYPHVRSFLSCQGKQKYTLPVYRAL--WSGTEEMKALATEIFSATSHQLH 613          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Cavefish
Match: rnpep (arginyl aminopeptidase [Source:NCBI gene;Acc:103045130])

HSP 1 Score: 322.398 bits (825), Expect = 7.393e-101
Identity = 199/585 (34.02%), Postives = 314/585 (53.68%), Query Frame = 2
Query:  101 ALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDT-KYLDIKKVSVKGTE---TRFDIVDCKIEALGSCLKIPIGI---SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADT-ENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQL-VPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQML-RWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF-YGRWKIPV-DHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTT-SSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYT 1816
            A +  D  + ++   +  EH   D  +DFD++ + G+ +L+++      A+L LD+   L++ +VS    E   T          + GS L +       S ++F + I+Y T      + WL PE T GK  PY+F+Q QA+  RS FPC D+P VKSTY+A +K P+ F  +MSA K E   K  N  +   EQ   I +YLVA+  G+L   ++  RS VW+EP ++E A  E+    E  L + E + G YVWG YD+L +PPSFP+GGMENPCLTFVTP LL GD+SL  V+ HEI HSW GNLVTN  W DFWLNEG T Y +R I ++ Y  E    L  + G A L++ ++  GE H  N+L V +    DPDD+++  PYEKG   + +L ++ G  +    +LK Y + +K++S+  ++   FF ++  D +  S  K++ +++  W     W + + D    +     +++LAD W   + +I+   +    +  E++  +Q  YFL  +   +++ L       +   Y +   S+N+E+   W  +  ++ H P    +  FL+ Q R  ++
Sbjct:   10 ADTAEDVATSSSFRRFRIEHFHLDLQVDFDQRSLSGTESLRVRCALGSAAELLLDSHPSLELHEVSFSRDERDWTAAQFHSRDFTSYGSTLVVQFPTAWSSGDQFHLSIKY-TAHQGPGVCWLDPEQTAGKLRPYVFTQGQAVLNRSFFPCFDTPAVKSTYTAAIKVPDGFTAVMSATKWEH-RKADNTFLFSMEQP--IPAYLVALAVGDLVSAEVGPRSRVWTEPCLLEAAKKEYDGVIEEFLLVGERLFGPYVWGRYDVLFMPPSFPFGGMENPCLTFVTPCLLAGDRSLADVIIHEICHSWFGNLVTNANWGDFWLNEGFTMYAQRRICKELY-GEAYTCLEAATGRALLRQHMDNTGEDHPLNKLRVKIKPGVDPDDTYNETPYEKGFCFVSYLAHLRGDQKRFDAFLKAYVDRFKFRSVIAEDALEFFLEFFPDLKKNSVHKIEGLEFDSWLNVSGWPLYLPDLSAGQSLMKPADQLADLWGADSVDIAAISK----INTEAWKTYQTVYFLDKI--IEKSPLPDGNTRMLEEQYPHMVKSNNAELRLRWAQIVAKNQHKPGYPHVRSFLSCQVRRHFS 583          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007860.1 (pep scaffold:Pmarinus_7.0:GL477456:228700:267302:1 gene:ENSPMAG00000007109.1 transcript:ENSPMAT00000007860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 241.121 bits (614), Expect = 4.771e-76
Identity = 115/181 (63.54%), Postives = 135/181 (74.59%), Query Frame = 2
Query:  500 QAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAI---KNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFW 1033
            QAIH RS+ PCQD+P +K TY AKV  P     LMSA+      DPT  G   +HKF+Q V I SYL+A+V G L  +++  R+ VWSE E VE+AA EF++TE +L+ AE + G YVWG YDLLVLPPSFPYGGMENPCLTFVTPT+L GDKSL  VVAHEI+HSWTGNLVTNKTWE FW
Sbjct:    1 QAIHCRSMVPCQDTPSLKFTYDAKVSVPKSLVALMSALCDGSEPDPTN-GEFTVHKFKQPVQIPSYLIALVVGALKSREIGPRTKVWSEKEFVEQAASEFSETETMLTTAEELVGPYVWGRYDLLVLPPSFPYGGMENPCLTFVTPTVLAGDKSLAGVVAHEISHSWTGNLVTNKTWEHFW 180          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007859.1 (pep scaffold:Pmarinus_7.0:GL477456:174117:191217:1 gene:ENSPMAG00000007104.1 transcript:ENSPMAT00000007859.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.153 bits (274), Expect = 4.979e-28
Identity = 71/193 (36.79%), Postives = 100/193 (51.81%), Query Frame = 2
Query: 1148 LNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLEN-ICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILF 1723
            ++ +G  H F +LVPVL   DPDDSFS VPYEKG  LL+HLE  + G D  + ++K Y E + Y + TT+EWKA+ ++Y  DK ++ +A    VDWK W Y     PV         D    LA +W         S   D L ++ S   +QK  FL +L       + S  ++ M  +Y+  +  NSEI F
Sbjct:    1 VDTFGPEHGFTKLVPVLDGVDPDDSFSTVPYEKGFALLYHLEQALGGPDVFIGFVKAYIEKFAYSTATTEEWKAYLFEYFKDKADVLQA----VDWKAWIYSPGMPPVKLQYDTTLADDCSALATRWSQAKDADLASFSADDLKDFSS---NQKVEFLALLLLQPALPVKS--LQRMEEVYKLNSVKNSEIRF 184          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Sea Lamprey
Match: lnpep (leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZDB-GENE-030131-1534])

HSP 1 Score: 95.1301 bits (235), Expect = 2.212e-20
Identity = 80/320 (25.00%), Postives = 140/320 (43.75%), Query Frame = 2
Query:  467 GKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRS------TVWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLLVGDKS--------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAE--LQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDE-WKAF 1369
            G   P   +Q +   AR  FPC D P  K+++   +        L +   NE  T++   L   F+  V +S+YLVA +  +   K +SN++      ++++ P   ++ +    +    L   E +    Y     DL+ +P  F  G MEN   +T+    LL+G K+        +  V+AHE+ H W GNLVT   W D WLNEG   ++E +         L+  + ++  + E   Q+SL +    H  +      ++    + F  V Y KG+++L  L         +  ++ Y   + Y +  TD+ W++ 
Sbjct:  324 GSDRPLAVTQFEPTSARESFPCFDEPDFKASFDISIVRDAAHTTLSNMPLNETVTRKDGLLEDTFKGSVVMSTYLVAFIVSDF--KSISNKTKHGTNVSIYTSPGKEQQGSFALENAIKFLDFYEELFNISYPLPKQDLVAIP-DFAAGAMENWGLVTYRETALLLGPKASGVRDTLWVAQVIAHELAHQWFGNLVTMNWWNDLWLNEGFATFMEFVATGSLKPDWLMMDVFLTEVVMEALTQDSLPS---SHAISSAAVGTMQI--GEMFDSVSYNKGASVLNMLRTFLTPAVFVDGIRDYLLVHSYGNAHTDDLWESL 635          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007869.1 (pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1 gene:ENSPMAG00000007088.1 transcript:ENSPMAT00000007869.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.411e-19
Identity = 97/372 (26.08%), Postives = 155/372 (41.67%), Query Frame = 2
Query:  458 ATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAP------NQFNVLMSAIKNEDPTKEGNHLIH-KFEQKVNISSYLVAIVCG--NLAGKKLSNRSTVWSEPEMVEKAAHEFA---DTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLLVGDKS--------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTT-DEWKAFFYKYMIDKENISKAKLDNV--DWKKWFYGRWKIPVDHVLKRDHGDA 1501
            A  G+      +Q +A  AR  FPC D P +K+T+   +  P      +  NVL       DP      L+  ++ +   +S+YL+A V G  +    + S+   V     + +    +FA    T+ L    +     Y     DL+ +   F  G MEN   +T+    LLV  K+        +  VV HE+ H W GNLVT + W   WLNEG   +IE L ++  +    I    +S   A   E L+A    H     VPV    + D+ F  + Y KG++++  L +  G +   + +  Y   +++K+  T D W++         E  S   +  V   W K    +   PV HV     G++
Sbjct:  122 AACGEARYAAVTQFEATDARRAFPCWDEPGIKATFDVTLIVPQDRVALSNMNVLERKPHEADP-----ELVEVRYARTPIMSTYLLAFVVGEFDFVEARSSDGVLVRVYTPLGKSEQGKFALEVATKTLPFYKDYFNVPYPLPKIDLIAIA-DFAAGAMENWGLVTYRETALLVDPKNSSSASKQWVALVVGHELAHQWFGNLVTMEWWTHLWLNEGFASWIEYLCVDHCFPEFDIWTQFVSTDYAPALE-LDALDNSHPIE--VPVGHPSEVDEIFDAISYSKGASVIRMLHDYIGDEDFKKGMNMYLTKFQHKNAATEDLWESL--------EQASGKPVAAVMSSWTK----QMGFPVLHVYSEHQGES 472          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Sea Lamprey
Match: ANPEP (alanyl aminopeptidase, membrane [Source:HGNC Symbol;Acc:HGNC:500])

HSP 1 Score: 88.5817 bits (218), Expect = 2.178e-18
Identity = 99/383 (25.85%), Postives = 164/383 (42.82%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKV--KAPNQFNVLMSAIKNEDPTKEGNHLIH-KFEQKVNISSYLVAIVCGNLAG-KKLSNRS--TVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDL-LVLP-------PSFPYGGMENPCLTFVTPTLLV--------GDK-SLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVP---VLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKY-KSLTTDEWKAFFYKYMIDKENIS--KAKLDNVDWKKWFYGRWKI----PVDHVLKRDHGDASERLADKWINLNP 1540
            SQ +   AR  FPC D P +K+T+   +  KA +     M  +     T      +H KF   V + +YL+A +  +    + ++N++   +W++   +     E+A     L+I   I   +    YD+  VLP       P F  G MEN  L     T L+        G+K S+  +V HE+ H W GNLVT + W + WLNEG   Y+E +   +   S  I+ L+I   + +LQ +++           VP   V+     +  F  + Y KG+ +L    +   +   +  LK Y +  ++  ++  D W+    ++ +D   ++   A  D +D       RW I    PV HV       +S +L      LNP
Sbjct:  210 SQMEPTDARKTFPCFDEPDMKATFDITLIHKAEHVALSNMPVVYMSTATSIEEDWVHTKFNTSVVMPTYLLAFIISDFEKVEAVANKTLIRIWAKKTEIAAGNAEYA-----LNITGKILN-FFEEYYDVPYVLPKSDQIAIPDFAAGAMENWGLVTYRETALLYNPDVSSNGNKESVATIVTHELAHQWFGNLVTMRWWSELWLNEGFASYLEYIGTHEVEPSWNIKALII---LNDLQRAMSVDALASSRPLSVPHSEVMTPAQANSMFDTISYSKGACILSMTSSFLTEPVFVAGLKSYLKEMQFGNAVHQDLWRHL--QWAVDNHTVTLPVAVKDILD-------RWTIQMGYPVVHV-----NTSSGKLTQSHFLLNP 569          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Yeast
Match: LAP2 (Leucyl aminopeptidase yscIV with epoxide hydrolase activity; metalloenzyme containing one zinc atom; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and nucleus; also known as leukotriene A4 hydrolase [Source:SGD;Acc:S000004990])

HSP 1 Score: 397.127 bits (1019), Expect = 1.803e-129
Identity = 246/623 (39.49%), Postives = 358/623 (57.46%), Query Frame = 2
Query:  116 DPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTK---KQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFA-DTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVE-CDPDDSFSRVPYEKGSNLLFHLENIC-GKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYES-----FLPHQKYYFLQVLN----------DFKEAKLHSKVIETMGNLYQ--YTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPI 1915
            D  + +N +D+   H D +  + F++  I GSV  QLK L +   K  +L LDT YLD+++V + G++  F I   K E LGS L I     ++ F++ IQ+ TT  CTALQWL  + T G K PY+FSQ +AIHARSLFPC D+P VKST++A +++P    V+ S I+ ED +K+ N  I++FEQKV I +YL+ I  G+L+   +  RSTV++EP  ++    EF  D E  +  AE I  EY WG YD+LV   S+PYGGME+P +TF TPTL+  D+S + V+AHE+ HSW+GNLVTN +W  FWLNEG T Y+ER I+   +  E  RH    IG ++LQ S+++  +  +F+ LV  L +  DPDD+FS VPYEKG NLLFHLE I  GK +   +++ YF+ +  KSL T ++    Y++  +K+ I    LD+VDW+ W Y     P  H +     D   +LADKW+ +   +  ++  D   E+ +     F  +Q   FL+ L           DF  AK        + ++YQ     S N+E++F      I +        + D+L + GR+K+ +P YR L    N   +RL +  F K ++T HPI
Sbjct:   57 DQSTLSNYKDFAVLHTDLNLSVSFEKSAISGSVTFQLKKLHEGKNKSDELHLDTSYLDVQEVHIDGSKADFQIEQRK-EPLGSRLVINNASCNDNFTLNIQFRTTDKCTALQWLNSKQTKGGK-PYVFSQLEAIHARSLFPCFDTPSVKSTFTASIESP--LPVVFSGIRIEDTSKDTN--IYRFEQKVPIPAYLIGIASGDLSSAPIGPRSTVYTEPFRLKDCQWEFENDVEKFIQTAEKIIFEYEWGTYDILVNVDSYPYGGMESPNMTFATPTLIAHDRSNIDVIAHELAHSWSGNLVTNCSWNHFWLNEGWTVYLERRIIGAIH-GEPTRHFSALIGWSDLQNSIDSMKDPERFSTLVQNLNDNTDPDDAFSTVPYEKGFNLLFHLETILGGKAEFDPFIRHYFKKFAKKSLDTFQFLDTLYEFYPEKKEI----LDSVDWETWLYKPGMPPRPHFITA-LADNVYQLADKWVEMAQHLKTTE--DFRSEFNAIDIKDFNSNQLVLFLETLTQNGHSNKKPKDFDWAKF-PVASRALLDIYQDNIVKSQNAEVVFKMFKFQIFAKLQEEYKHLADWLGTVGRMKFVRPGYRLL----NSVDRRLALATFDKFKDTYHPI 660          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Yeast
Match: AAP1 (Arginine/alanine amino peptidase; overproduction stimulates glycogen accumulation; AAP1 has a paralog, APE2, that arose from the whole genome duplication [Source:SGD;Acc:S000001089])

HSP 1 Score: 83.9593 bits (206), Expect = 3.158e-17
Identity = 86/318 (27.04%), Postives = 135/318 (42.45%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRST---VWSEP--EMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLL--VGDKSL------VFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYI----------ERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTT-DEWKAF 1369
            +Q +A  AR  FPC D P +K+T++  + + +    L +     +  KEG      F     +S+YLVA +  +L   + +N      V+S P  E   + A   A    L    ++   EY     D++ +   F  G MEN   +T+    LL  + + SL        V+ HE+ H W GNLVT   WE  WLNEG   ++          E  + E+Y    L R L           +L++    H     VPV    + +  F  + Y KGS+LL  +    G++  ++ +  Y   +KY +  T D W A 
Sbjct:  129 TQMEATDARRAFPCFDEPNLKATFAVTLVSESFLTHLSNMDVRNETIKEGKKYT-TFNTTPKMSTYLVAFIVADLRYVESNNFRIPVRVYSTPGDEKFGQFAANLA-ARTLRFFEDTFNIEYPLPKMDMVAVH-EFSAGAMENWGLVTYRVIDLLLDIENSSLDRIQRVAEVIQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNKFQPEWKVWEQYVTDNLQRAL-----------NLDSLRSSHPIE--VPVNNADEINQIFDAISYSKGSSLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTGDLWDAL 430          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Yeast
Match: APE2 (Aminopeptidase yscII; may have a role in obtaining leucine from dipeptide substrates; APE2 has a paralog, AAP1, that arose from the whole genome duplication [Source:SGD;Acc:S000001640])

HSP 1 Score: 80.8777 bits (198), Expect = 3.070e-16
Identity = 117/442 (26.47%), Postives = 181/442 (40.95%), Query Frame = 2
Query:  140 EDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIG-ISDEKFSVCIQYATTA----NCTALQWLIPEATVGKKHPYLFS-QCQAIHARSLFPCQDSPCVKSTYSAK-VKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLA---GKKLSNRSTVWSEPEMVEKAAHEFAD-TENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMENPCLTF--VTPTLLVGDKS-------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYI----------ERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTT-DEWKAF 1369
            ++ V  H D     DF     EGSV ++LK        + L+T   DI    + G  T  +I+  + E   +    P G +S  K +  +    T     N         E  +  +  Y+ + Q +   AR  FPC D P +K++++   V  P+  ++    +KNE   K+G   +  F     +S+YLVA +   L     K       V++ P   EK     AD T   L+  E   G +Y     D + +   F  G MEN  L    V   LL  D S       +  VV HE+ H W GNLVT   WE  WLNEG   ++          E  + E+Y  ++ ++H L          SL++    H     VPV    + +  F  + Y KG++LL  +    G++  ++ +  Y   +KY +  T D W A 
Sbjct:  104 DNVVPLHYDLTVEPDFKTFKFEGSVKIELKINNPAIDTVTLNTVDTDIHSAKI-GDVTSSEII-SEEEQQVTTFAFPKGTMSSFKGNAFLDIKFTGILNDNMAGFYRAKYEDKLTGETKYMATTQMEPTDARRAFPCFDEPNLKASFAITLVSDPSLTHLSNMDVKNE-YVKDGKK-VTLFNTTPKMSTYLVAFIVAELKYVESKNFRIPVRVYATPGN-EKHGQFAADLTAKTLAFFEKTFGIQYPLPKMDNVAVH-EFSAGAMENWGLVTYRVVDLLLDKDNSTLDRIQRVAEVVQHELAHQWFGNLVTMDWWEGLWLNEGFATWMSWYSCNEFQPEWKVWEQYV-TDTLQHAL----------SLDSLRSSHPIE--VPVKKADEINQIFDAISYSKGASLLRMISKWLGEETFIKGVSQYLNKFKYGNAKTEDLWDAL 526          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Yeast
Match: TMA108 (Ribosome-associated, nascent chain binding factor; binds N-terminal region of nascent peptides during translation; recognizes target proteins via its putative metallopeptidase peptide-binding pocket [Source:SGD;Acc:S000001399])

HSP 1 Score: 60.4622 bits (145), Expect = 6.563e-10
Identity = 73/312 (23.40%), Postives = 124/312 (39.74%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQF----NVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNL----AGKKLSNRSTVWSE---PEMVEKAAHEFADTENLLSIAESICGEYVWGIYDL----LVLPPSFPYGGMEN-PCLTFVTPTLLVGDKSLV---------FVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEK------YYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYK 1333
            + CQ   A ++FPC D P  KST+   +    Q+    N  +  ++  D +++  HL+ KF +   +++ +     G+L       KL    T+      P  +  AA      +  L + ES    Y    Y L     VL P      MEN   +T     LL+   +L           ++ HE+ H W GN ++  +WE  W NE    ++   I+E+      Y+ SE   +LL  +     +++ +  G            ++    D F    Y KG  +L  L+   G+  + + L+  FE  K
Sbjct:  152 THCQPFSASNIFPCIDEPSNKSTFQLNIATDAQYKAVSNTPVEMVEALDSSQK--HLV-KFAKTPLMTTSVFGFSIGDLEFLKTEIKLEGDRTIPVSIYAPWDIANAAFTLDTVQKYLPLLES----YFKCPYPLPKLDFVLLPYLSDMAMENFGMITIQLNHLLIPPNALANETVREQAQQLIVHELVHQWMGNYISFDSWESLWFNESFATWLACHILEQNGDLSHYWTSE--PYLLQQVEPTMCRDAADVNGRSIFQIAQRNTGIDSQTSDIFDPEAYTKGIIMLRSLQLATGESHLQKGLESVFEDTK 454          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Nematostella
Match: EDO33493 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS27])

HSP 1 Score: 502.286 bits (1292), Expect = 1.105e-170
Identity = 272/618 (44.01%), Postives = 381/618 (61.65%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDI-VDCKIEALGSCLKI--PIGI-SDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIK--NEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR-WLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDH--GDASERLADKWINLN-PEISDSDQKDLLLEYESFLPHQKYYFL-QVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            ++DP S++  E+ +  ++ ++  +DF  K++   V L         A L LDT+ L+++ V+V+ +  +    +  K +A G+ L+I  P G+ S  + S+ I Y T+ + +ALQWL PE T GKKHPY+F+QCQAIHARS+ PCQDSP VK+TYSAKV  P     LMSA +  +E   ++ + + ++FEQKV I SYL+A+V G L G+++  RS VW+E EMVE+ A+EFA+ E ++S AES+ GEYVWG YDLL+LPPSFPYGGMENPCLTFVTPTLL GD+SL  V+AHEI+HSWTGNLVTN TWE FWLNEG T ++ER I+ +    E +R      G   L ++++ + +     +LV  L + DPDD+FS VPYEKGS  L +LE + G  ++   + + Y + YKYK+ TTDEWK F + Y  DK NI    L+ VDW+ W       PV+ + + D    DA   L  KWIN +  E++    +D+     SF   QK  FL Q+L     + L    ++ M N YQ+ +  NSEI F W+ LC+RS    A     DFL SQGR+K+T+P+Y  L  +  +  K L V  F K+    HPI +  +
Sbjct:    1 MSDPCSFSRPEECLCTNITWNVSVDFASKVLVCDVELDFLVKKDNVASLVLDTRDLNVQSVAVRPSNDQLTFSLGSKHKAFGTPLEISLPPGLKSGARLSIAISYRTSPDASALQWLTPEQTSGKKHPYMFTQCQAIHARSIIPCQDSPGVKATYSAKVSVPKDLVALMSAARTGSELDHQKQDLMTYQFEQKVAIPSYLIALVVGALKGRQVGPRSHVWTEQEMVEECAYEFAEMEQMISAAESLVGEYVWGPYDLLILPPSFPYGGMENPCLTFVTPTLLAGDRSLTGVIAHEISHSWTGNLVTNSTWEHFWLNEGFTVFLERKIIGR-MKGEQMRQFGFIGGWKTLMDAVSKFADNMSLTKLVVSLKDTDPDDAFSSVPYEKGSCFLVYLEQLLGGPEVFEPFFRKYIDTYKYKTCTTDEWKTFLFDYFKDKTNI----LETVDWEAWLRKPGMPPVNMIERYDSSLADACISLCQKWINASEKELNSFSSQDI----ASFTSPQKVEFLAQLLAKTSSSPLSVAHLQAMQNAYQFNSYKNSEIKFRWLRLCVRSGWADAFQPTVDFLLSQGRMKFTRPLYEEL--FKCEKSKDLAVTTFKKHRAFYHPICSAMV 607          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Nematostella
Match: EDO41732 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3I6])

HSP 1 Score: 125.176 bits (313), Expect = 4.503e-30
Identity = 123/515 (23.88%), Postives = 213/515 (41.36%), Query Frame = 2
Query:  398 VCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSA-----IKNEDPTKEGNHLIHKFEQKVNISSYLV---------AIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFAD-TENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYD----------------SELIRHLLISIGIAELQESLNAYGEGHKFN---QLVPVLVECDP---DDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDK-ENISKAKLDNVDWKKWFYGRW----KIPVDHVLKRDHGDASERLA---------DKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFL 1789
            V I+Y T+    +L W    AT     P +FS    I+ RSL PCQ+ P   ST+ A +  P+    LMS            T +G +         +  +  V         + +C    G        + + P ++++A+ E        +  +  + G Y +   DLL+LP  F   G++NP L F++ ++L GD S+   VAHEI+H+W G L+  K W + WL+EG + YIE  I  +                    +L+R+  +S  + E  E+L         +   +  P  V  +       +++V Y KG  LL H+  + G +   R+L  Y +HY+ + +T+++    F++Y + K  N+S++  D       F+  W     +P     K+ +   +  +A          K  N+N      + K         L H +   L +    +   L    +  +   Y ++T  N EI   W  L +++  TP +D +  FL
Sbjct:   19 VVIKYHTSPEGQSLSW----ATDQDGRPCVFSPGAYINNRSLMPCQEPPIAMSTWQAAIHVPHGCMALMSGNPVTMETTATDTDKGRYCTMDVPLPCSTLAMAVGYFESMEGRSAICPTKDGPAEPVECRMIAVPSIIDRASDELLSYVPGFIEASCELLGPYPFSRLDLLILPKCFACMGLKNPNLVFLSQSVLAGDGSIRVRVAHEISHAWFGLLIGAKDWTEEWLSEGFSTYIEERIQARAEKVNPGCAKKKNNSLRELRQLLRYRALSAEMDETDENLQCLRSRASLSPNEEAKPFTVVKNGQICSKKWTQVHYLKGYFLLHHMAAMVGLENFERFLYEYVQHYQGQLVTSED----FFQYFVCKFPNVSQSVKDE------FFLEWLESPGLPKCLRSKKFNVKENALIAAALKQFEFWRKQDNINKRNKTMNIKRRKQPEAEPLEHSEQIVLMLEKLVERDALMHTTLRQLNRCYNFST-RNCEIRHRWCELVVKNKFTPFLDDVKHFL 518          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Nematostella
Match: EDO30265 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1A0])

HSP 1 Score: 109.768 bits (273), Expect = 1.408e-25
Identity = 81/309 (26.21%), Postives = 142/309 (45.95%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKL----SNRSTVWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLL-------VGDKS-LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYY-DSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDE-WKAF 1369
            +Q ++  AR+ FPC D P  K+ +   +        + +  +++    +  +++ +F+Q V +S+YLVA +  +    +       +  VW++ E ++      +  +N+LS  E      Y     DL+ +P  F  G MEN   +TF    LL         DK  +  VV+HE+ H W GNLVT K W D WLNEG   Y+E +  + +  D +++   +       LQ  +++    H  +  VPV       + F  + Y KGS+++  L N  G     + L+ Y + + Y +   D+ W+A 
Sbjct:  133 TQFESTDARAAFPCFDEPEFKAVFVISMIHEKGMRAISNMPQSKRVQMDDGNVLTRFKQSVKMSTYLVAFIVSDFESTEAETPNGTKVRVWAQKEALDSTKLALSVAKNVLSYYEKFFNIPYPLPKIDLVAVP-DFAAGAMENWGLMTFREHYLLSNPLSASAADKQDVAIVVSHELAHQWFGNLVTMKWWNDLWLNEGFANYVEYMGTDHFAKDWKVLDQFVSETHQVALQ--VDSMANTHPIS--VPVTNPSQITEIFDAISYNKGSSVIRMLRNFLGDKAFQKGLEHYLKKHAYGNAEADDLWQAL 436          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Nematostella
Match: EDO26623 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBI5])

HSP 1 Score: 100.138 bits (248), Expect = 1.200e-23
Identity = 61/164 (37.20%), Postives = 87/164 (53.05%), Query Frame = 2
Query: 1148 LNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR-WLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDH--GDASERLADKWINLN-PEISDSDQKDLLLEYESFLPHQKYYFLQVL 1627
            ++ + +     +LV  L + DPDD+FS VPYEKGS  L +LE + G  ++   + + Y + YKYK+ TTDEWK F + Y  DK NI    L+ VDW+ W       PV+ + + D    DA   L  KWIN +  E++    +D+     SF   QK  FL  L
Sbjct:    1 MSKFADNMSLTKLVVSLKDTDPDDAFSSVPYEKGSCFLVYLEQLLGGPEVFEPFFRKYIDTYKYKTCTTDEWKTFLFDYFKDKTNI----LETVDWEAWLRKPGMPPVNMIERYDSSLADACISLCQKWINASEKELNSFSSQDI----ASFTSPQKVEFLAQL 156          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Nematostella
Match: EDO41846 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S394])

HSP 1 Score: 105.916 bits (263), Expect = 1.422e-23
Identity = 83/302 (27.48%), Postives = 140/302 (46.36%), Query Frame = 2
Query:  512 ARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVA-IVCGNLAGKKLSNRST---VWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSL---------VFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERL-IMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDE-WKAF 1369
            AR+ FPC D P +K+ ++  +    +   L +    E    E   +I  FE  V +S+YLVA +VC   + +  + R T   VW+  + +++  +  ++   +LS  E      Y     DL+ +P  F  G MEN  L     T L+ D  +           VVAHE+ H W GNLVT K W D WLNEG   ++E + +     +  ++   L+     +L  +L+     H  + +V    E   +  F  + Y+KG+ ++  L++  G D   + L+ Y   +K+ +  T++ W AF
Sbjct:  144 ARAAFPCFDEPALKAVFNMVIYRKAEHVSLSNMPIKE---TESGQVIDVFEPSVKMSTYLVAFVVCDFKSKEATTKRGTLVRVWAPEDNIDEGDYALSEAVKILSYYEKFFAVRYPLPKQDLIAIP-DFAAGAMENWGLITYRLTSLLYDPEVSSDSNKQWVAVVVAHELAHQWFGNLVTMKWWNDLWLNEGFASFVENIGVNHTTPEWRMMEQFLLD--KTQLSMNLDQLSNSHPISVVVKDPAEI--NSLFDTISYDKGAAIIRMLKSFLGDDVFQKGLQKYLNKHKFGNAETNQLWDAF 437          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Medaka
Match: lta4h (leukotriene A4 hydrolase [Source:NCBI gene;Acc:101172215])

HSP 1 Score: 492.271 bits (1266), Expect = 2.707e-166
Identity = 265/615 (43.09%), Postives = 366/615 (59.51%), Query Frame = 2
Query:  110 LNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKI--PIGIS-DEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKN---EDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM-LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE----ISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITA 1921
            ++DP S+++    VT+HL+    +DF R++I G+V L ++ L    + L LDT+ L++  VS      RF +   K    G+ L I  P  +S  +   V + Y T+ + +ALQWL PE T GKK PYLFSQCQA H RS+ PCQD+P VK TY A+V  P     +MSA+++   EDP ++ + ++++F Q V + SYL+AIV G L  +++  RS VWSE E V+KAA EF++TE +L  AE + G YVWG YD+LVLPPSFPYGGMENPCLTF TPTLL GDKSL  V+AHEI+HSWTGNLVTNKTWE FWLNEGHT Y+ER+I  + Y  E  R      G  +LQ+S+N +G  +    LVP L + DPDD+FS VPYEKG  LL+HLE + G  ++ + ++K Y + Y Y S+TTD+WK + + Y  D+       L+ VDW  W +     PV         DA   L+ +W     +     S+SD K L         HQ   FL +L    E  L    ++ M  +Y   T +NSEI F W+ LC+RS    A+         QGR+K+T+P++R + N+  +  +   V+ F  +   MHP+TA
Sbjct:    1 MSDPCSFSSPSRCVTKHLNLHLRVDFRRRVIAGTVELTVEALEDNFSLLTLDTRDLNVVSVSANQQPARFTLAS-KHSFKGTQLDITLPFHLSRGQHVIVQVVYETSPSASALQWLTPEQTAGKKQPYLFSQCQAHHCRSMVPCQDTPSVKHTYYAQVSVPKDLVAVMSAVRDGQEEDP-EDSSRIVYRFRQPVPMPSYLIAIVVGALESREIGPRSRVWSEKEFVDKAAFEFSETETMLKTAEDLAGPYVWGQYDILVLPPSFPYGGMENPCLTFATPTLLAGDKSLSTVIAHEISHSWTGNLVTNKTWEHFWLNEGHTVYLERMIGRQMY-GEQFRQFKAMGGWKDLQDSVNTFGPNNPLTNLVPSLQDVDPDDAFSSVPYEKGFALLYHLEELMGGPEVFMGFVKSYIQLYAYGSVTTDDWKNYLFTYFKDQAE----ALNRVDWNAWMFTPGMPPVKPQYDTTLADACIALSQRWTKAGDQDLDGFSESDVKTL-------SSHQLIEFLSLL--LHENPLPLTHVKKMQEVYGLNTCTNSEIRFRWLKLCVRSKWEEAVPLALKMATEQGRMKFTRPLFREVFNF--NKYRDEAVQVFAAHRTAMHPVTA 597          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Medaka
Match: lnpep (leucyl and cystinyl aminopeptidase [Source:NCBI gene;Acc:101154957])

HSP 1 Score: 121.324 bits (303), Expect = 6.289e-28
Identity = 88/292 (30.14%), Postives = 134/292 (45.89%), Query Frame = 2
Query:  467 GKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQ-KVNISSYLVAIVCGNLAGKKLSNRST---VWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLLVGDKS-------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR 1303
            G KH    +Q + + AR  FPC D P  K+T+  K+     +  L +  ++E           +FE+  VN+S+YLVA V  N +  + +   T   V+S PE  E   +       LL    +    +Y     DL+ +P  F  G MEN   +TF   TLLVG  S       +  VVAHE+ H W GNLVT + W D WLNEG   Y++ L +++ +       L +S+    + +  +A    H  +    V+     ++ F  V YEKG+++L  L      +Q  R
Sbjct:  293 GTKHILAATQFEPLSARKAFPCFDEPAFKATFLIKINRKQNYTTLSNMPQSESRLLPSGLFQDEFERTSVNMSTYLVAFVVANFSAVRKNVSETLVSVYSVPEKTEHTRYALEAASKLLEFYNTFFDIDYPLKKLDLVAIP-DFLAGAMENWGLITFRETTLLVGKDSSPLEKQVVASVVAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYLSLQRVFPELQAEILFLSVRFRVMDK--DALISSHPVS--TAVVTPDQVEEMFDSVSYEKGASILLMLNAYLPGEQQFR 579          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Medaka
Match: lnpep (leucyl and cystinyl aminopeptidase [Source:NCBI gene;Acc:101154957])

HSP 1 Score: 121.324 bits (303), Expect = 6.622e-28
Identity = 88/292 (30.14%), Postives = 134/292 (45.89%), Query Frame = 2
Query:  467 GKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQ-KVNISSYLVAIVCGNLAGKKLSNRST---VWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLLVGDKS-------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLR 1303
            G KH    +Q + + AR  FPC D P  K+T+  K+     +  L +  ++E           +FE+  VN+S+YLVA V  N +  + +   T   V+S PE  E   +       LL    +    +Y     DL+ +P  F  G MEN   +TF   TLLVG  S       +  VVAHE+ H W GNLVT + W D WLNEG   Y++ L +++ +       L +S+    + +  +A    H  +    V+     ++ F  V YEKG+++L  L      +Q  R
Sbjct:  292 GTKHILAATQFEPLSARKAFPCFDEPAFKATFLIKINRKQNYTTLSNMPQSESRLLPSGLFQDEFERTSVNMSTYLVAFVVANFSAVRKNVSETLVSVYSVPEKTEHTRYALEAASKLLEFYNTFFDIDYPLKKLDLVAIP-DFLAGAMENWGLITFRETTLLVGKDSSPLEKQVVASVVAHELAHQWFGNLVTMRWWNDLWLNEGFATYMQYLSLQRVFPELQAEILFLSVRFRVMDK--DALISSHPVS--TAVVTPDQVEEMFDSVSYEKGASILLMLNAYLPGEQQFR 578          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Medaka
Match: enpep (glutamyl aminopeptidase [Source:NCBI gene;Acc:101155001])

HSP 1 Score: 99.7525 bits (247), Expect = 4.158e-21
Identity = 85/305 (27.87%), Postives = 136/305 (44.59%), Query Frame = 2
Query:  512 ARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDP-TKEGNHLIHKFEQKVNISSYLVAIVCGNLA-GKKLSNRST---VWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLP----PSFPYGGMEN-PCLTFVTPTLLVGDKS--------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSL-TTDEWKAF 1369
            AR  FPC D P  K+TY+  +     +  L +  +   P    GN L   F++ V +S+YLV          +K+S R     ++++P  +  A  EFA   N   +      EY    Y +  L     P F  G MEN   +T+    LL  D+         +  V+AHE+ H W GN+VT   W+D WLNEG   + E + +EK   S  +R ++I   +  +  + +A    H    +V V    +    F  + Y KG+++L  LE+  G+D      + Y + + +K+  T D W + 
Sbjct:  228 ARKSFPCFDEPNKKATYNISITHHKDYRALSNMPQEGQPEVLPGNKLKTSFQKSVPMSTYLVCFAVHQFEFVEKISKRGIPLRIYAQPSQLGTA--EFA--ANTTKVIFDYFEEYFDMFYSISKLDQIAIPDFGTGAMENWGLVTYRETNLLYDDRESSSSNKQRVASVIAHELVHQWFGNIVTMDWWDDLWLNEGFASFFEYIGVEKAEPSWGMRDIMIISDVLPVMVN-DALLSSHPI--IVDVSTPAEITSVFDAISYSKGASVLRMLEDWMGRDAFRDGCRKYLKDFYFKNAKTADFWASL 525          
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Medaka
Match: trhde.2 (thyrotropin releasing hormone degrading enzyme [Source:NCBI gene;Acc:101170139])

HSP 1 Score: 98.5969 bits (244), Expect = 9.013e-21
Identity = 97/389 (24.94%), Postives = 171/389 (43.96%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMS-AIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTV----WSEPEMVEKAAHEFA--DTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMENPCLT-FVTPTLLVGDK--------SLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERL---IMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDE-WKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPE---ISDSDQKDLLLEYE 1585
            +Q   IHAR  FPC D P  K+T+S  ++   Q+  L +  ++    + E   + ++F +   +S+Y +A    N   ++    S V    ++ P+ +   A ++A   T+ LL   E     +Y     DLL +P   PY  MEN  L+ FV   +L+  +         L  VV HEI H W G+LVT   WED WL EG   + E +    +   ++ E  R L   +    L + L++    H  +Q   V    D D  F  + Y+KG+ L+  L N+ G+    + L  Y   + Y +   D+ W         +  +I+  ++ +         RW + + + +     + SE+    +I +N +     +  +K+L L+++
Sbjct:  246 TQFSPIHARKAFPCFDEPIYKATFSLTLRHDPQYISLSNMPVEASSLSDEDGWVTNRFARTPRMSTYYLAWAVCNFTYRETQTDSGVTIRLYARPDAISSGAGDYALHITKRLLGFYEDYFKVQYSLPKLDLLAVP-KHPYAAMENWGLSVFVEQKILLDAEVSSSSYQMELTMVVVHEICHQWFGDLVTPVWWEDVWLKEGFAHFFEYVGTDFLFPKWNMEKQRFLTDVLHEVMLLDGLSS---SHPISQ--EVERATDIDRVFDWIAYKKGAALIRMLANVMGQPLFQKGLNDYLLSHMYSNAARDDLWSKLSQAMHSEGRDINIGEMMD---------RWTLQMGYPVVTISKNQSEQRPTHYITINQKHFLYGEEARKNLSLQWQ 619          
BLAST of Leukotriene A(4) hydrolase vs. Planmine SMEST
Match: SMESG000053576.1 (SMESG000053576.1)

HSP 1 Score: 940.643 bits (2430), Expect = 0.000e+0
Identity = 463/509 (90.96%), Postives = 463/509 (90.96%), Query Frame = 2
Query:   98 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQV 1624
            MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKD                                              WKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQV
Sbjct:    1 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKD----------------------------------------------WKKWFYGRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQV 463          
BLAST of Leukotriene A(4) hydrolase vs. Planmine SMEST
Match: SMESG000049276.1 (SMESG000049276.1)

HSP 1 Score: 929.858 bits (2402), Expect = 0.000e+0
Identity = 448/449 (99.78%), Postives = 448/449 (99.78%), Query Frame = 2
Query:   98 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWF 1444
            MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKK F
Sbjct:    1 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKGF 449          
BLAST of Leukotriene A(4) hydrolase vs. Planmine SMEST
Match: SMESG000014392.1 (SMESG000014392.1)

HSP 1 Score: 631.713 bits (1628), Expect = 0.000e+0
Identity = 319/619 (51.53%), Postives = 419/619 (67.69%), Query Frame = 2
Query:   98 MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPI--GISDEKFSVCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVWGIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNA----YGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFYGRWKIPVDHVLKRDHGDASE--RLADKWINLNPEISDSDQKDLLLEYESFLPHQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIRSNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNENTMHPITAKSI 1930
            M  S ND  SYANSED++ +   F+W +DF+ + I GSV   +K L     +L LD + L+IK++ +   +  F  V+ K   LG  L IP+  G    KF V I+Y TT + TALQW+ PE T+GKKH +L+SQ QAI+ARSL+PCQD+P VK+TYSA ++AP+   V+MSA++ +  T   +   HKFEQK+ I SYLV+I CG+L G K+  RSTV+SEPE+ EKA  EF D E +L IAE +CG Y W I DLL+LPPSFPYGGMENPC+ F+TP LL GDKS +  +AHEI+HSWTGNLVTN TW+ FW+NEGHT Y+ERLI+EK   SE  RHL I +GI+EL+  LN     YG  H+F +LVP L   DPDDSFSRVPYEKGS LLF+LE + GKD+MLRWLK Y   ++ KS++TDEWK FF+KYMI+KE +  +KL+ + W  WFY    IP++H    D     E   L   WI  +     S + +LL  +   LP Q+YYF QVLN+ +  +L    ++ MGN+Y  T ++NSE+L GW +LC+RS++ PA+DQ+F+FLNSQGRLKY K +Y++L +W  D  K  TV+NF   +  MHPIT   I
Sbjct:    1 MEFSQNDKTSYANSEDFIVDKSHFNWKLDFENEQISGSVVHNVKVLNSASKELILDVRNLEIKRIVIDNEDVLFQYVNGK---LGGKLVIPLSLGTKRSKFQVIIEYNTTNDSTALQWMKPEMTMGKKHSFLYSQSQAINARSLYPCQDTPFVKTTYSATIEAPSDLEVVMSAVR-KSSTLSNDVRQHKFEQKIPIPSYLVSIACGHLVGSKIGPRSTVYSEPELNEKARLEFEDIEKILVIAEELCGPYEWEICDLLILPPSFPYGGMENPCIIFLTPCLLTGDKSQLNYIAHEISHSWTGNLVTNSTWDHFWVNEGHTNYLERLILEKLQSSEPYRHLHIYLGISELEGDLNMYQIIYGPDHEFTKLVPNLHGKDPDDSFSRVPYEKGSLLLFYLETLIGKDKMLRWLKTYIAAFRLKSVSTDEWKTFFFKYMIEKEKVEPSKLEGIKWDDWFYKPGPIPIEHHSLLDDSMIQECNELVKAWIGFHQ--FPSSENELLNRFSRMLPDQRYYFFQVLNEIQGVQLPESSLKVMGNIYGLTNTTNSELLHGWSLLCLRSHYMPAVDQVFEFLNSQGRLKYNKVLYKHLYDW--DDTKSRTVENFHIQKFAMHPITRGEI 611          
BLAST of Leukotriene A(4) hydrolase vs. Planmine SMEST
Match: SMESG000026219.1 (SMESG000026219.1)

HSP 1 Score: 100.908 bits (250), Expect = 1.198e-21
Identity = 84/323 (26.01%), Postives = 152/323 (47.06%), Query Frame = 2
Query:  464 VGKKHPYLFSQCQAIHARSLFPCQDSPCVKSTYSAK-VKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCG-----NLAGKKLSNRS--TVWSEPEMVEKAAHEFADTENLLSIAESICG-EYVWGIYDLLVLPPSFPYGGMEN-PCLTFVTPTLLVGDKS--------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSE--LIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYKSLTTDE-WKAF 1369
             G +   + +  +   AR  FPC D P  K+ +S + V+  +  ++    +++ +    G +    +E  V +S+YLVA +       +L G    N++   +++  +  +  +      + +L   E++ G +Y     D++ +P  F  G MEN   +T+   TLL+  KS        +  +++HEI H W GN+VT   W D WLNEG   Y E L  + Y + E  +I H  +   +  L  + ++    H     VPV    + +  F ++ Y KG++L+  LE + G + +   LK Y + Y+Y++  +D  W AF
Sbjct:  217 TGVEKTLITTHMEPTFARQAFPCFDEPYFKANFSLRMVRDKDHHSLFNMPLRSTEKLANGLY-CDSYETSVKMSTYLVAYMLLPLDYISLDGYASLNKTKIRIYAPKDQKDYTSFALEIAQKVLPFFENLFGIDYPLPKLDMIAIP-DFSAGAMENWGLITYKFFTLLLNPKSPKIQHKTSIAKIISHEIAHQWFGNIVTMDWWNDLWLNEGFATYSEYLAGD-YINREWGMIGHFYLEQFVDAL--NFDSLLNSHPIQ--VPVKDPQEIESIFDQISYGKGASLVRMLEGVLGLETLKVGLKIYLQRYRYQTAVSDNLWTAF 532          
BLAST of Leukotriene A(4) hydrolase vs. Planmine SMEST
Match: SMESG000039842.1 (SMESG000039842.1)

HSP 1 Score: 93.2041 bits (230), Expect = 2.560e-19
Identity = 85/314 (27.07%), Postives = 132/314 (42.04%), Query Frame = 2
Query:  491 SQCQAIHARSLFPCQDSPCVKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVAIVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESIC-------GEYVWGIYDL----LVLPPSFPYGGMENPCLTFVTPTLLVGDKS---------LVFVVAHEITHSWTGNLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQESLNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQMLRWLKCYFEHYKYK-SLTTDEWKAF 1369
            +Q +A  AR  FPC D P +K+T+   +  P     L +  +       G+ +  ++E+   +S+YL+A V G L   +  + + V           +   D  N    A  +C         Y   +Y L    LV  P F  G MEN  L     T+L+ D+          +  VV HE  H W GNLVT   W D WLNEG   +IE L ++  Y    I     S   A    +L+A    H     V V    + D+ F  + Y KG+ ++  L +    ++  + L  Y + ++Y+ ++T D W A 
Sbjct:  126 TQFEASDARRAFPCWDEPNIKATFDITLVVPKTKTALSNMPEKCRTEVSGSLVKIEYEKSPIMSTYLLAFVIGELDYVESHDSNGV-------RVRVYTAKDKSNRGRFALDVCCRTLPFYATYFDIVYPLPKMDLVAIPDFAAGAMENWGLVTYRETMLLVDEHESSSLSKQIVALVVGHECAHMWFGNLVTMDWWTDLWLNEGFATWIEYLCVDYCYPEFDIWTNFSSDEYARAL-NLDALRSSHPIQ--VTVHKPSEIDEIFDAISYSKGACVIRMLNDYLTNEKFKKGLSIYLKRHRYQNAVTADLWAAL 429          
The following BLAST results are available for this feature:
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LTA4H1.162e-16644.10leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
LTA4H3.470e-16145.15leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
LTA4H9.029e-14247.45leukotriene A4 hydrolase [Source:HGNC Symbol;Acc:H... [more]
RNPEP4.625e-8930.74arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGN... [more]
RNPEP2.538e-8241.96arginyl aminopeptidase [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ltah-1.21.210e-14941.37LeukoTriene A4 Hydrolase homolog [Source:UniProtK... [more]
ltah-1.15.319e-14540.65Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.15.319e-14540.65Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.11.016e-14340.65Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
ltah-1.11.016e-14340.65Aminopeptidase ltah-1.1 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG106023.326e-14139.16gene:FBgn0032721 transcript:FBtr0089314[more]
CG106023.326e-14139.16gene:FBgn0032721 transcript:FBtr0089315[more]
CG106026.994e-14039.16gene:FBgn0032721 transcript:FBtr0347402[more]
CG314453.411e-2328.01gene:FBgn0051445 transcript:FBtr0085401[more]
CG314453.411e-2328.01gene:FBgn0051445 transcript:FBtr0332431[more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lta4h2.505e-16342.48leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
lta4h5.810e-16242.31leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
rnpep1.932e-11635.52arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
rnpep1.932e-11635.52arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
rnpepl11.140e-7629.14arginyl aminopeptidase like 1 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd373.276e-16343.51CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd373.091e-14741.48CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd377.934e-14742.01CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd371.382e-13741.19CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
cd378.511e-13743.63CD37 molecule [Source:Xenbase;Acc:XB-GENE-5831804][more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lta4h7.162e-16643.71leukotriene A4 hydrolase [Source:MGI Symbol;Acc:MG... [more]
Rnpep3.498e-9834.08arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
Rnpep1.326e-7931.14arginyl aminopeptidase (aminopeptidase B) [Source:... [more]
Rnpepl11.843e-7430.84arginyl aminopeptidase (aminopeptidase B)-like 1 [... [more]
Lnpep6.883e-2627.54leucyl/cystinyl aminopeptidase [Source:MGI Symbol;... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q3SZH7|LKHA4_BOVIN9.786e-16744.64Leukotriene A-4 hydrolase OS=Bos taurus OX=9913 GN... [more]
sp|Q6S9C8|LKHA4_CHILA1.000e-16644.79Leukotriene A-4 hydrolase OS=Chinchilla lanigera O... [more]
sp|P09960|LKHA4_HUMAN5.580e-16644.10Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 ... [more]
sp|P24527|LKHA4_MOUSE5.010e-16543.71Leukotriene A-4 hydrolase OS=Mus musculus OX=10090... [more]
sp|P30349|LKHA4_RAT7.681e-16043.39Leukotriene A-4 hydrolase OS=Rattus norvegicus OX=... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J1C44.735e-17344.03Leuk-A4-hydro_C domain-containing protein OS=Schis... [more]
A0A068WHC18.227e-17343.11Leukotriene A 4 hydrolase OS=Echinococcus granulos... [more]
A0A0X3PPR49.887e-17343.79Leuk-A4-hydro_C domain-containing protein OS=Schis... [more]
W6UMY41.460e-17243.11Leukotriene A-4 hydrolase OS=Echinococcus granulos... [more]
A0A5K3FS521.476e-17243.16Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lta4h8.553e-13438.86leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
lta4h3.780e-12937.93leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
lta4h1.392e-12737.72leukotriene A4 hydrolase [Source:ZFIN;Acc:ZDB-GENE... [more]
rnpep1.937e-10734.20arginyl aminopeptidase [Source:NCBI gene;Acc:10304... [more]
rnpep7.393e-10134.02arginyl aminopeptidase [Source:NCBI gene;Acc:10304... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000007860.14.771e-7663.54pep scaffold:Pmarinus_7.0:GL477456:228700:267302:1... [more]
ENSPMAT00000007859.14.979e-2836.79pep scaffold:Pmarinus_7.0:GL477456:174117:191217:1... [more]
lnpep2.212e-2025.00leucyl/cystinyl aminopeptidase [Source:ZFIN;Acc:ZD... [more]
ENSPMAT00000007869.11.411e-1926.08pep scaffold:Pmarinus_7.0:GL476743:229821:259612:1... [more]
ANPEP2.178e-1825.85alanyl aminopeptidase, membrane [Source:HGNC Symbo... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
LAP21.803e-12939.49Leucyl aminopeptidase yscIV with epoxide hydrolase... [more]
AAP13.158e-1727.04Arginine/alanine amino peptidase; overproduction s... [more]
APE23.070e-1626.47Aminopeptidase yscII; may have a role in obtaining... [more]
TMA1086.563e-1023.40Ribosome-associated, nascent chain binding factor;... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO334931.105e-17044.01Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO417324.503e-3023.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302651.408e-2526.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266231.200e-2337.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418461.422e-2327.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lta4h2.707e-16643.09leukotriene A4 hydrolase [Source:NCBI gene;Acc:101... [more]
lnpep6.289e-2830.14leucyl and cystinyl aminopeptidase [Source:NCBI ge... [more]
lnpep6.622e-2830.14leucyl and cystinyl aminopeptidase [Source:NCBI ge... [more]
enpep4.158e-2127.87glutamyl aminopeptidase [Source:NCBI gene;Acc:1011... [more]
trhde.29.013e-2124.94thyrotropin releasing hormone degrading enzyme [So... [more]
back to top
BLAST of Leukotriene A(4) hydrolase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053576.10.000e+090.96SMESG000053576.1[more]
SMESG000049276.10.000e+099.78SMESG000049276.1[more]
SMESG000014392.10.000e+051.53SMESG000014392.1[more]
SMESG000026219.11.198e-2126.01SMESG000026219.1[more]
SMESG000039842.12.560e-1927.07SMESG000039842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025839 ID=SMED30025839|Name=Leukotriene A(4) hydrolase|organism=Schmidtea mediterranea sexual|type=transcript|length=2129bp
AAATTATTGTTTAAATCTATTGTAAATCCTTGAATTATTTTTCAAAATTG
GTTTTGTTTTATAACTGCTCACAGTTGAAATAATACTTTTAGTTGATATG
GCCTTATCGCTAAACGATCCTGTGTCATATGCAAATTCAGAAGACTATGT
TACTGAACATTTGGATTTTGACTGGATAATAGATTTTGATAGAAAACTAA
TTGAAGGATCAGTAAATCTACAATTGAAAAACTTAACCAAAAAACAAGCT
GACTTAAAATTAGATACGAAATATCTTGATATTAAAAAAGTGTCAGTGAA
AGGAACGGAAACTAGATTTGATATTGTAGATTGTAAAATCGAAGCACTTG
GATCGTGTTTAAAAATTCCAATTGGAATTTCCGATGAAAAATTTTCGGTT
TGTATTCAATATGCCACTACCGCGAACTGTACAGCTCTTCAGTGGTTAAT
TCCGGAAGCAACTGTTGGAAAAAAACATCCCTATTTATTTAGTCAATGTC
AAGCCATACACGCTAGAAGTCTTTTTCCATGCCAAGATAGCCCGTGTGTA
AAATCGACTTATTCTGCAAAGGTAAAAGCTCCTAATCAATTCAATGTTTT
AATGAGTGCTATTAAAAATGAAGATCCTACTAAAGAAGGAAATCATTTGA
TACACAAATTCGAACAGAAAGTTAATATTTCTAGCTATCTTGTTGCTATT
GTATGTGGTAATTTGGCTGGAAAAAAGCTAAGTAACCGTTCAACTGTCTG
GTCAGAACCGGAAATGGTGGAAAAAGCCGCTCATGAGTTTGCAGACACTG
AAAACTTATTATCTATTGCTGAAAGCATATGCGGCGAGTATGTTTGGGGC
ATATATGACTTACTAGTATTGCCACCTTCGTTTCCATACGGGGGGATGGA
AAATCCATGTCTTACATTTGTTACTCCAACGCTTTTGGTTGGGGATAAAT
CCCTTGTGTTTGTAGTTGCGCATGAAATCACTCATTCGTGGACTGGAAAC
CTAGTAACTAATAAAACATGGGAAGATTTTTGGTTAAATGAGGGTCACAC
TCGATATATCGAAAGATTGATAATGGAGAAGTATTATGATTCCGAACTGA
TAAGGCATCTGCTAATTTCTATCGGCATAGCAGAACTTCAAGAATCACTT
AATGCATACGGAGAAGGTCATAAATTTAATCAACTCGTTCCAGTTCTTGT
TGAATGCGATCCAGACGATTCTTTCTCACGAGTGCCCTATGAGAAAGGCT
CCAATTTATTATTCCATTTAGAAAATATTTGTGGCAAAGATCAAATGTTG
CGCTGGTTGAAATGCTATTTTGAGCACTACAAATATAAATCTCTTACAAC
TGATGAGTGGAAGGCTTTCTTTTATAAATACATGATTGATAAGGAAAACA
TTTCAAAAGCTAAACTTGATAATGTAGATTGGAAGAAATGGTTTTATGGA
AGATGGAAAATTCCAGTTGACCACGTTCTCAAACGGGATCATGGTGATGC
CAGTGAGAGACTTGCCGATAAATGGATTAATTTGAACCCAGAAATATCAG
ATTCCGATCAAAAGGATTTATTATTGGAATATGAATCGTTCTTACCGCAT
CAAAAATATTACTTTTTGCAAGTGCTCAATGATTTTAAAGAGGCAAAGTT
ACATTCCAAAGTTATCGAGACAATGGGTAATTTGTACCAATACACCACTA
GTTCTAATAGTGAAATACTATTCGGTTGGGTAATGCTGTGCATTCGATCA
AATCACACGCCTGCAATTGATCAAATATTTGACTTTCTCAATTCACAAGG
CCGATTGAAATATACCAAGCCAATATATCGAAACCTTGCTAATTGGCCTA
ATGATCACATCAAACGATTAACTGTTAAAAATTTCCTGAAAAACGAAAAT
ACAATGCACCCAATAACTGCAAAAAGCATCAGACTTCTATTATGCCTCTG
ATTAATTGATTGGTGCTGCTTACTTTAGATTGACTGGACAATTTGATTTA
GTTCAATTACTATTAGTTTTATAATTTGCTGTGCTTGAAAAATTTGCTCA
CTTTTTATTTGTGTTTTTATAATTTTTGTATTTATTTCTTTTAATTATTA
CACAATATAATTTGGTAATCTAAAAAAAA
back to top

protein sequence of SMED30025839-orf-1

>SMED30025839-orf-1 ID=SMED30025839-orf-1|Name=SMED30025839-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=618bp
MALSLNDPVSYANSEDYVTEHLDFDWIIDFDRKLIEGSVNLQLKNLTKKQ
ADLKLDTKYLDIKKVSVKGTETRFDIVDCKIEALGSCLKIPIGISDEKFS
VCIQYATTANCTALQWLIPEATVGKKHPYLFSQCQAIHARSLFPCQDSPC
VKSTYSAKVKAPNQFNVLMSAIKNEDPTKEGNHLIHKFEQKVNISSYLVA
IVCGNLAGKKLSNRSTVWSEPEMVEKAAHEFADTENLLSIAESICGEYVW
GIYDLLVLPPSFPYGGMENPCLTFVTPTLLVGDKSLVFVVAHEITHSWTG
NLVTNKTWEDFWLNEGHTRYIERLIMEKYYDSELIRHLLISIGIAELQES
LNAYGEGHKFNQLVPVLVECDPDDSFSRVPYEKGSNLLFHLENICGKDQM
LRWLKCYFEHYKYKSLTTDEWKAFFYKYMIDKENISKAKLDNVDWKKWFY
GRWKIPVDHVLKRDHGDASERLADKWINLNPEISDSDQKDLLLEYESFLP
HQKYYFLQVLNDFKEAKLHSKVIETMGNLYQYTTSSNSEILFGWVMLCIR
SNHTPAIDQIFDFLNSQGRLKYTKPIYRNLANWPNDHIKRLTVKNFLKNE
NTMHPITAKSIRLLLCL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR014782Peptidase_M1_dom
IPR015211Peptidase_M1_C
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0008237metallopeptidase activity
GO:0008270zinc ion binding
GO:0005488binding
GO:0003723RNA binding
GO:0004177aminopeptidase activity
GO:0004301epoxide hydrolase activity
GO:0004463leukotriene-A4 hydrolase activity
GO:0008233peptidase activity
GO:0016787hydrolase activity
GO:0042277peptide binding
GO:0046872metal ion binding
GO:0070006metalloaminopeptidase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005654nucleoplasm
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0019370leukotriene biosynthetic process
GO:0043171peptide catabolic process