Ornithine decarboxylase

Overview
NameOrnithine decarboxylase
Smed IDSMED30025830
Length (bp)2027
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ornithine decarboxylase (SMED30025830) t-SNE clustered cells

Violin plots show distribution of expression levels for Ornithine decarboxylase (SMED30025830) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ornithine decarboxylase (SMED30025830) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ornithine decarboxylase (SMED30025830) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025830

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025830SMESG000057261.1 Contig1882GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 Contig1882GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v6_280_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v6_280_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v6_280_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 Contig7114newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 Contig7114uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30025830SMESG000015244.1 SMESG000015241.1 SMESG000004848.1 SMESG000004822.1 SMESG000004820.1 SMESG000004806.1 dd_Smed_v4_280_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: ODC1 (ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:8109])

HSP 1 Score: 291.197 bits (744), Expect = 1.176e-90
Identity = 168/467 (35.97%), Postives = 246/467 (52.68%), Query Frame = 3
Query:  342 HFSSSMESNLHIIKQRIMNCDA-----PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            HF     +   I+ Q+I    +      FY  +LG I  + +RW   LPRV PF+AVKC     ++  L   G GFDCASK EI+ ++ ++     +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL+++VVG+SFHVGSGC + + F + +     V ++  ++GF+  +LDIGGGFPG   +      +++FEE+   +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  + +               K+   + D  E+S Q  M                                    Y +NDGVY SFNCI++DHA   P          +    + + Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   12 HFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQ-LVQSLGVPPER----IIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDV------KLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIV--------------LKEQTGSDDEDESSEQTFM------------------------------------YYVNDGVYGSFNCILYDHAHVKPL-------LQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM 409          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: ODC1 (ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:HGNC:8109])

HSP 1 Score: 291.197 bits (744), Expect = 1.176e-90
Identity = 168/467 (35.97%), Postives = 246/467 (52.68%), Query Frame = 3
Query:  342 HFSSSMESNLHIIKQRIMNCDA-----PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            HF     +   I+ Q+I    +      FY  +LG I  + +RW   LPRV PF+AVKC     ++  L   G GFDCASK EI+ ++ ++     +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL+++VVG+SFHVGSGC + + F + +     V ++  ++GF+  +LDIGGGFPG   +      +++FEE+   +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  + +               K+   + D  E+S Q  M                                    Y +NDGVY SFNCI++DHA   P          +    + + Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   12 HFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQ-LVQSLGVPPER----IIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDV------KLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIV--------------LKEQTGSDDEDESSEQTFM------------------------------------YYVNDGVYGSFNCILYDHAHVKPL-------LQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM 409          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 237.269 bits (604), Expect = 4.927e-70
Identity = 146/465 (31.40%), Postives = 231/465 (49.68%), Query Frame = 3
Query:  405 APFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGI 1799
            A F+  +LG+I  +   +   LPRV+PF+AVKC   P V+ +L +LG GF CA+K E++ V           A+ II ANP K    I YA++ G+  ++FD E EL K+ +  PS ++VL ++T  +++ +C L  KFG        LL+ A +  + VVG+SFH+GSGC +  A+ +++     V E+  ++G    +LD+GGGFPG          +++FEE+ + +N  LD YFPE     I AE GRY+V  A+T+   +I  + + +  P         H     A       S+ S P                        + N    K   Y +++GVY  FN ++FD+  P P          ++ + E  +Y S+++GP  DG DC+ +   LP++ +G+W+V+ NMGAYT+   S F G       Y M +     L + L     +D   G+
Sbjct:   39 AAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHI-----GIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSC-LSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTE------GAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQPGREAPLPPPHIATCAA-------SEPSPPA-----------------------EENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPI-------LQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGV 454          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 234.572 bits (597), Expect = 3.659e-69
Identity = 141/465 (30.32%), Postives = 226/465 (48.60%), Query Frame = 3
Query:  405 APFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGI 1799
            A F+  +LG+I  +   +   LPRV+PF+AVKC   P V+ +L +LG GF CA+K E++ V           A+ II ANP K    I YA++ G+  ++FD E EL K+ +  PS ++VL ++T  +++ +C L  KFG        LL+ A +  + VVG+SFH+GSGC +  A+ +++     V E+  ++G    +LD+GGGFPG          +++FEE+ + +N  LD YFPE     I AE GRY+V  A+T+   +I  + + +  P                                                   + + N    K   Y +++GVY  FN ++FD+  P P          ++ + E  +Y S+++GP  DG DC+ +   LP++ +G+W+V+ NMGAYT+   S F G       Y M +     L + L     +D   G+
Sbjct:   39 AAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHI-----GIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSC-LSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTE------GAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQP--------------------------------------------------GREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPI-------LQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGV 434          
BLAST of Ornithine decarboxylase vs. Ensembl Human
Match: AZIN2 (antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:29957])

HSP 1 Score: 234.572 bits (597), Expect = 3.659e-69
Identity = 141/465 (30.32%), Postives = 226/465 (48.60%), Query Frame = 3
Query:  405 APFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGI 1799
            A F+  +LG+I  +   +   LPRV+PF+AVKC   P V+ +L +LG GF CA+K E++ V           A+ II ANP K    I YA++ G+  ++FD E EL K+ +  PS ++VL ++T  +++ +C L  KFG        LL+ A +  + VVG+SFH+GSGC +  A+ +++     V E+  ++G    +LD+GGGFPG          +++FEE+ + +N  LD YFPE     I AE GRY+V  A+T+   +I  + + +  P                                                   + + N    K   Y +++GVY  FN ++FD+  P P          ++ + E  +Y S+++GP  DG DC+ +   LP++ +G+W+V+ NMGAYT+   S F G       Y M +     L + L     +D   G+
Sbjct:   39 AAFFVADLGAIVRKHFCFLKCLPRVRPFYAVKCNSSPGVLKVLAQLGLGFSCANKAEMELVQHI-----GIPASKIICANPCKQIAQIKYAAKHGIQLLSFDNEMELAKVVKSHPSAKMVLCIATDDSHSLSC-LSLKFGVSLKSCRHLLENAKKHHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFEMGTELGHKMHVLDLGGGFPGTE------GAKVRFEEIASVINSALDLYFPEGCGVDIFAELGRYYVTSAFTVAVSIIAKKEVLLDQP--------------------------------------------------GREEENGSTSKTIVYHLDEGVYGIFNSVLFDNICPTPI-------LQKKPSTEQPLYSSSLWGPAVDGCDCVAEGLWLPQLHVGDWLVFDNMGAYTVGMGSPFWGTQACHITYAMSRVAWEALRRQLMAAEQEDDVEGV 434          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: odc-1 (Ornithine decarboxylase [Source:UniProtKB/Swiss-Prot;Acc:P41931])

HSP 1 Score: 284.648 bits (727), Expect = 5.249e-89
Identity = 164/446 (36.77%), Postives = 234/446 (52.47%), Query Frame = 3
Query:  402 DAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADAD-EVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQE 1736
            D+ F  ++L  I  +F  WK  LP ++PF+AVKC  D  +I +L  LG GFDCASK EI  V+ T       +A  II+ANP K +  I +A    V  +TFD   EL+K+++  P+ +++LR++      ATC L  KFGAD     P LL+ A E  +NVVG+SFHVGSGCN+  A+   + +   + E+   +GF   I+D+GGGFPG    N        FE++   +   LD +FP+  N R+IAEPGR+F  G ++LV  +I    +    P S +      KD  +  D+                                          GY Y INDGVY SFNCI+FDHA P+   +FD +          E ++STI+GPTCD  D +  ++ +PKM +G W+ +P+MGAYT+AA++ FNG       Y M +E
Sbjct:   39 DSSFMLVDLDKIIERFQLWKRELPMIEPFYAVKCNTDLVLIRILASLGCGFDCASKDEIDIVMGT-----GVSAERIIYANPCKTRSFIAHAMDRDVKMMTFDNPEELLKIAKLHPNAEMILRIAVSDP-TATCPLNLKFGADPIIAAPQLLKTASEEGINVVGISFHVGSGCNDASAYRNALQHAKNLCEIGEGLGFKMDIIDMGGGFPGAEHHN-------PFEKIAETIRDALDEFFPDT-NKRLIAEPGRFFAAGPFSLVANIIHATEV----PASKIT-----KDPKDCADH------------------------------------------GYMYYINDGVYGSFNCILFDHAHPIGSPLFDTD--------RNEKFMSTIWGPTCDSLDLVEDKKLMPKMNVGEWLYYPDMGAYTLAAATTFNGFSKPVPMYVMSEE 411          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3832239:3834124:1 gene:WBGene00018764.1 transcript:F53F10.2a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.204e-21
Identity = 104/436 (23.85%), Postives = 170/436 (38.99%), Query Frame = 3
Query:  408 PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGK-LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELA-------RKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPV--PFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASS 1685
            PF+ +++ +I  +    + +LPRV+P +AV C  DP +  +L   +   F+ ++  E++ V  +M+ + ++A    +F +    +K I  A   G +T   ++E ++  +    P  +++L +    +          FG   DE+  +L  A  L  NV G+   +G     ++ +  +V     + E A       R++ F    +  G           D A   +F   C  LN+V+D  F  E N    A  GR+       LVT    L     TN I      A    N +  D V                                         G+ Y  NDGVY SF C   D  KP+  P  +        E   E +++  TI GPT DG D   +     ++ +G W+VW  MGA+TI   S
Sbjct:   56 PFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELELV--SMNVEPSRA----VFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-----PFGCSVDEIEEILDMAHLLGANVTGIYLELGLRAT-LEDYITSVHDARSIFETADQKFLTLRRVCFGNLSVPTGA----------DGAVNNEFMSFCNSLNNVIDDLF--ESNIDFSASIGRF-------LVTNAFTL----CTNVIGKRAMDAKFITNDDFDDGV-----------------------------------------GFVYQTNDGVYGSFGCKQMD-IKPLCKPLDV--------ENDSEEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDS 406          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3831117:3834124:1 gene:WBGene00018764.1 transcript:F53F10.2a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.204e-21
Identity = 104/436 (23.85%), Postives = 170/436 (38.99%), Query Frame = 3
Query:  408 PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGK-LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELA-------RKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPV--PFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASS 1685
            PF+ +++ +I  +    + +LPRV+P +AV C  DP +  +L   +   F+ ++  E++ V  +M+ + ++A    +F +    +K I  A   G +T   ++E ++  +    P  +++L +    +          FG   DE+  +L  A  L  NV G+   +G     ++ +  +V     + E A       R++ F    +  G           D A   +F   C  LN+V+D  F  E N    A  GR+       LVT    L     TN I      A    N +  D V                                         G+ Y  NDGVY SF C   D  KP+  P  +        E   E +++  TI GPT DG D   +     ++ +G W+VW  MGA+TI   S
Sbjct:   56 PFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELELV--SMNVEPSRA----VFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-----PFGCSVDEIEEILDMAHLLGANVTGIYLELGLRAT-LEDYITSVHDARSIFETADQKFLTLRRVCFGNLSVPTGA----------DGAVNNEFMSFCNSLNNVIDDLF--ESNIDFSASIGRF-------LVTNAFTL----CTNVIGKRAMDAKFITNDDFDDGV-----------------------------------------GFVYQTNDGVYGSFGCKQMD-IKPLCKPLDV--------ENDSEEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDS 406          
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Match: F53F10.2 (pep chromosome:WBcel235:I:3830562:3834120:1 gene:WBGene00018764.1 transcript:F53F10.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53F10.2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.204e-21
Identity = 104/436 (23.85%), Postives = 170/436 (38.99%), Query Frame = 3
Query:  408 PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGK-LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELA-------RKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPV--PFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASS 1685
            PF+ +++ +I  +    + +LPRV+P +AV C  DP +  +L   +   F+ ++  E++ V  +M+ + ++A    +F +    +K I  A   G +T   ++E ++  +    P  +++L +    +          FG   DE+  +L  A  L  NV G+   +G     ++ +  +V     + E A       R++ F    +  G           D A   +F   C  LN+V+D  F  E N    A  GR+       LVT    L     TN I      A    N +  D V                                         G+ Y  NDGVY SF C   D  KP+  P  +        E   E +++  TI GPT DG D   +     ++ +G W+VW  MGA+TI   S
Sbjct:   56 PFFVMDVAAIERRLEALRVMLPRVRPNYAVACNADPVLARVLSNNIDVNFEVSNTAELELV--SMNVEPSRA----VFCSQLMTRKAIKNAVLAGCSTFVVESEKQVTDVMNASPEAEIILAVCLPYSTGEV-----PFGCSVDEIEEILDMAHLLGANVTGIYLELGLRAT-LEDYITSVHDARSIFETADQKFLTLRRVCFGNLSVPTGA----------DGAVNNEFMSFCNSLNNVIDDLF--ESNIDFSASIGRF-------LVTNAFTL----CTNVIGKRAMDAKFITNDDFDDGV-----------------------------------------GFVYQTNDGVYGSFGCKQMD-IKPLCKPLDV--------ENDSEEQLHFGTILGPTLDGTDVAQRLMKSRQLRVGEWLVWEQMGAFTIPVDS 406          
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Match: Odc1 (gene:FBgn0013307 transcript:FBtr0088863)

HSP 1 Score: 199.519 bits (506), Expect = 3.988e-57
Identity = 114/287 (39.72%), Postives = 164/287 (57.14%), Query Frame = 3
Query:  360 ESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADAD-EVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSL 1217
            E +L  + Q +  CD       L S+  +   W+ LLPR++PF+AVKC  DP V+ LL +LGAGFDCASK E+K V   + FD +     IIFANP +    + YA    V+  T D E E+ KL   +P+  L++R  ++ A  A C LG+KFG DAD +   L+  A  L + V G SFHVGSGC+E+ A+   +     + +    +G++   LDIGGGFPG    +DD    ++FE++   +N  +  +FP+E    IIAEPGR+FV  A TLV ++   R +
Sbjct:   23 ECDLQRLDQALNICD-------LSSVERKLRLWQKLLPRIKPFYAVKCNDDPMVVRLLAQLGAGFDCASKNEVKLV---LGFDVS--PERIIFANPCRPVSHLEYAKEHQVSNGTVDNEFEVYKLHTHYPNSNLIVRFKSE-AKEAQCPLGDKFGCDADVDAAALMLLAKSLELKVTGTSFHVGSGCSELQAYDRAIKKAKNLFKFGALLGYDMDFLDIGGGFPG----SDD----VKFEKIAESVNTSVQRHFPDE-RVHIIAEPGRFFVAAACTLVCKIHAKREI 287          

HSP 2 Score: 77.7962 bits (190), Expect = 5.737e-15
Identity = 39/100 (39.00%), Postives = 55/100 (55.00%), Query Frame = 3
Query: 1425 YVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYF 1724
            Y +NDGVY SFNCI++DH   +     DN      +        S I+GP+CD  D I +   LP +  G+ + + NMGAYT+  +S FNG  + +T YF
Sbjct:  299 YYLNDGVYGSFNCILYDHQVVIAEHYLDNAESLPHLK-------SLIWGPSCDALDKISEDLHLPNLNRGDLLGFRNMGAYTMPIASAFNGFEVPKTLYF 391          
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Match: Odc2 (gene:FBgn0013308 transcript:FBtr0088864)

HSP 1 Score: 175.637 bits (444), Expect = 1.684e-48
Identity = 103/299 (34.45%), Postives = 161/299 (53.85%), Query Frame = 3
Query:  324 SDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGAD-ADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSL 1217
             D+ + ++   +     I +  + + D      +L S+  +   W  L+PR++P +AVKC  DP V+  L  LG GFDCASK E+K V+         +   IIFA+P +    + YA    V   T D E E+ KL + +P   L++R  ++ A  A C LG+K+G D   +   L+  A  L + V G SFHVGSGC+E++A+   +     + ++   IG    +LD+GGGFPG   I+D++     FEE+   +N  ++  FP++   RII+EPGR+FV  AYTL+ +V   R +
Sbjct:    4 GDLRIQYYDEELNIRKVIEQADLEHLDQALNICDLSSLERKLRLWHKLMPRIEPHYAVKCNDDPVVVKFLADLGTGFDCASKNELKLVL-----GLGVSPERIIFAHPCRPASHLRYAKEQQVVNGTVDNEYEIYKLRKHYPDSNLIVRFKSE-AKKALCPLGDKYGCDAEADAAALMLLAKALGLKVTGTSFHVGSGCSEVEAYDRAIEKAENIFKVGEMIGHKMELLDVGGGFPG---IDDEM-----FEEIAQSVNTSVELRFPDK-RIRIISEPGRFFVEAAYTLICKVHAKREV 287          

HSP 2 Score: 53.9138 bits (128), Expect = 2.636e-7
Identity = 33/100 (33.00%), Postives = 52/100 (52.00%), Query Frame = 3
Query: 1425 YVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYF 1724
            Y +NDG++ +F  + +   +  P      E Y  E     ++  S I+GP+CD  D I     LP +  G+ + + NMGAYT+  +S FNG  + ET +F
Sbjct:  299 YYLNDGIFGAFAGMFYYPEEVAP------ELYLDEAESLPKLK-SVIWGPSCDAMDKI-SDLLLPNLNPGDLLGFRNMGAYTMPIASPFNGFDVPETRFF 390          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 301.982 bits (772), Expect = 5.543e-95
Identity = 165/439 (37.59%), Postives = 244/439 (55.58%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG +  + +RW  +LPR+ PF+AVKC     V++ L  LGAGFDCASK EI+ ++ ++  D ++    II+ANP K    I YAS  GV  +TFD+E EL+K+++   + +LVLR++T  +  A C L  KFGA       LL+RA EL ++V+G+SFHVGSGC + + + + +     V ++  ++G+N ++LDIGGGFPG    ++D   +++FEE+   +N  LD YFP +   RIIAEPGRY+V  AYTL   +I  + +                    A D  E  S                                   ++   Y +NDGVY SFNCI++DHA  +P          ++   +  MY  +I+GPTCDG D I++Q  LP M++G+W+++ NMGAYT+AASS FNG    + +Y M
Sbjct:   40 FYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQ-IVQSVGVDPSR----IIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPG----SED--TKLKFEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVI---------------MKEQSASDEEEDVSN----------------------------------DRTLMYYVNDGVYGSFNCILYDHAHVLP-------TLHKKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 301.982 bits (772), Expect = 5.543e-95
Identity = 165/439 (37.59%), Postives = 244/439 (55.58%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG +  + +RW  +LPR+ PF+AVKC     V++ L  LGAGFDCASK EI+ ++ ++  D ++    II+ANP K    I YAS  GV  +TFD+E EL+K+++   + +LVLR++T  +  A C L  KFGA       LL+RA EL ++V+G+SFHVGSGC + + + + +     V ++  ++G+N ++LDIGGGFPG    ++D   +++FEE+   +N  LD YFP +   RIIAEPGRY+V  AYTL   +I  + +                    A D  E  S                                   ++   Y +NDGVY SFNCI++DHA  +P          ++   +  MY  +I+GPTCDG D I++Q  LP M++G+W+++ NMGAYT+AASS FNG    + +Y M
Sbjct:   40 FYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQ-IVQSVGVDPSR----IIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPG----SED--TKLKFEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVI---------------MKEQSASDEEEDVSN----------------------------------DRTLMYYVNDGVYGSFNCILYDHAHVLP-------TLHKKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: odc1 (ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GENE-010816-1])

HSP 1 Score: 301.982 bits (772), Expect = 5.543e-95
Identity = 165/439 (37.59%), Postives = 244/439 (55.58%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG +  + +RW  +LPR+ PF+AVKC     V++ L  LGAGFDCASK EI+ ++ ++  D ++    II+ANP K    I YAS  GV  +TFD+E EL+K+++   + +LVLR++T  +  A C L  KFGA       LL+RA EL ++V+G+SFHVGSGC + + + + +     V ++  ++G+N ++LDIGGGFPG    ++D   +++FEE+   +N  LD YFP +   RIIAEPGRY+V  AYTL   +I  + +                    A D  E  S                                   ++   Y +NDGVY SFNCI++DHA  +P          ++   +  MY  +I+GPTCDG D I++Q  LP M++G+W+++ NMGAYT+AASS FNG    + +Y M
Sbjct:   40 FYVADLGDVLKKHLRWLRVLPRITPFYAVKCNDSRAVVTTLASLGAGFDCASKTEIQ-IVQSVGVDPSR----IIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHENAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARYVFDIGAELGYNMSLLDIGGGFPG----SED--TKLKFEEIAAVINPALDKYFPVDSGVRIIAEPGRYYVASAYTLAVNIIAKKVI---------------MKEQSASDEEEDVSN----------------------------------DRTLMYYVNDGVYGSFNCILYDHAHVLP-------TLHKKPKPDERMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIYYIM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 197.978 bits (502), Expect = 4.424e-56
Identity = 131/478 (27.41%), Postives = 232/478 (48.54%), Query Frame = 3
Query:  330 IELVHFSSSMESNL--HIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDK 1757
            IEL+   +++E+ +  HI +Q +   +A F   +LG++  Q + WK+ +P V+PF+ V C   P VI LL  LG GF CA+K E   V   +S D      +II +   K    I +A++TG+N +  + E+EL K+++  P  +L+L++ST+       V     G        LL+ A EL+++V G++F V + C +  A+   +     + ++ +++GF+  ILDIGGGF G          + Q +++ + +  +L+ YFP E    IIAEPG +FV+  +TL   VIG ++                     AY N+ TS+   +                     +  P+        + Y +NDGVY SF   +F +    P        +   +  +  ++ S+++GP+CD  D ++++  LP++ +G+W+V+ NMGA      + F+       +Y +  +D  E+ +
Sbjct:   12 IELLEGGTTLENVIDNHIYEQNLAEKNA-FVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLV---LSHDV--PPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVSTEAQIEEASV---TIGCSLKGCRHLLELAKELNVSVAGVTFQVPASCKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSG---------SEFQLKQVHSVIRPLLEAYFPSESGVSIIAEPGNFFVFSCFTLAVNVIGKKA---------------------AYRNLHTSTHDKL-------------------TSSDAPE--------FVYYMNDGVYGSFMGRLFGNIISTP------SVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTISTDDWFEMQE 417          
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 197.978 bits (502), Expect = 4.424e-56
Identity = 131/478 (27.41%), Postives = 232/478 (48.54%), Query Frame = 3
Query:  330 IELVHFSSSMESNL--HIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDK 1757
            IEL+   +++E+ +  HI +Q +   +A F   +LG++  Q + WK+ +P V+PF+ V C   P VI LL  LG GF CA+K E   V   +S D      +II +   K    I +A++TG+N +  + E+EL K+++  P  +L+L++ST+       V     G        LL+ A EL+++V G++F V + C +  A+   +     + ++ +++GF+  ILDIGGGF G          + Q +++ + +  +L+ YFP E    IIAEPG +FV+  +TL   VIG ++                     AY N+ TS+   +                     +  P+        + Y +NDGVY SF   +F +    P        +   +  +  ++ S+++GP+CD  D ++++  LP++ +G+W+V+ NMGA      + F+       +Y +  +D  E+ +
Sbjct:   12 IELLEGGTTLENVIDNHIYEQNLAEKNA-FVVADLGALMRQHVVWKTTMPLVRPFYPVSCNSSPVVIELLSALGVGFVCANKAETTLV---LSHDV--PPENIILSGVCKQLSLIKHAAKTGINFLLCENEAELRKIARAHPEAKLLLQVSTEAQIEEASV---TIGCSLKGCRHLLELAKELNVSVAGVTFQVPASCKDPQAYTHALSDARCIFDMGKELGFDMNILDIGGGFSG---------SEFQLKQVHSVIRPLLEAYFPSESGVSIIAEPGNFFVFSCFTLAVNVIGKKA---------------------AYRNLHTSTHDKL-------------------TSSDAPE--------FVYYMNDGVYGSFMGRLFGNIISTP------SVHKMSLTLDEPVFSSSLWGPSCDPLDQVVERCLLPELAVGDWLVFSNMGASGQEGPATFSDTDQPPVYYTISTDDWFEMQE 417          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 292.738 bits (748), Expect = 1.401e-91
Identity = 163/439 (37.13%), Postives = 241/439 (54.90%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++  L  LGAGFDCASK EI+ ++ ++   + +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P+ +LVLR++T  +  A C L  KFGA       LL+RA EL+++++G+SFHVGSGC +   + + V     V ++  ++GFN  +LDIGGGFPG   +      +++FEE+ + +N  LD YFP +    IIAEPGRY+V  A+TL   +I  + +        VN  +   D  +A +                                         +K   Y +NDGVY SFNCI+FDHA   P          ++   +   Y S+I+GPTCDG D I+++  LP++++G+W+++ NMGAYT+AASS FNG      +Y M
Sbjct:   40 FYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQ-LVQSIGVSSER----IIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSEDV------KLKFEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVM--------VNEQSGSDDEEDAAN-----------------------------------------DKTLMYYVNDGVYGSFNCILFDHAHVKPV-------LTKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 293.123 bits (749), Expect = 1.879e-91
Identity = 163/439 (37.13%), Postives = 241/439 (54.90%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++  L  LGAGFDCASK EI+ ++ ++   + +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P+ +LVLR++T  +  A C L  KFGA       LL+RA EL+++++G+SFHVGSGC +   + + V     V ++  ++GFN  +LDIGGGFPG   +      +++FEE+ + +N  LD YFP +    IIAEPGRY+V  A+TL   +I  + +        VN  +   D  +A +                                         +K   Y +NDGVY SFNCI+FDHA   P          ++   +   Y S+I+GPTCDG D I+++  LP++++G+W+++ NMGAYT+AASS FNG      +Y M
Sbjct:   40 FYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQ-LVQSIGVSSER----IIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSEDV------KLKFEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVM--------VNEQSGSDDEEDAAN-----------------------------------------DKTLMYYVNDGVYGSFNCILFDHAHVKPV-------LTKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: dym (dymeclin [Source:Xenbase;Acc:XB-GENE-5729291])

HSP 1 Score: 292.352 bits (747), Expect = 4.575e-91
Identity = 163/439 (37.13%), Postives = 241/439 (54.90%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++  L  LGAGFDCASK EI+ ++ ++   + +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P+ +LVLR++T  +  A C L  KFGA       LL+RA EL+++++G+SFHVGSGC +   + + V     V ++  ++GFN  +LDIGGGFPG   +      +++FEE+ + +N  LD YFP +    IIAEPGRY+V  A+TL   +I  + +        VN  +   D  +A +                                         +K   Y +NDGVY SFNCI+FDHA   P          ++   +   Y S+I+GPTCDG D I+++  LP++++G+W+++ NMGAYT+AASS FNG      +Y M
Sbjct:   40 FYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQ-LVQSIGVSSER----IIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSEDV------KLKFEEITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVM--------VNEQSGSDDEEDAAN-----------------------------------------DKTLMYYVNDGVYGSFNCILFDHAHVKPV-------LTKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: slc20a2 (solute carrier family 20 (phosphate transporter), member 2 [Source:Xenbase;Acc:XB-GENE-1015057])

HSP 1 Score: 288.115 bits (736), Expect = 1.412e-89
Identity = 162/439 (36.90%), Postives = 237/439 (53.99%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            F+  +LG +  + +R+   LPRV+PF+AVKC     V+ +L +LGAGFDCASK EI+ V D            II+ANP K    I +A++TGV  +TFD E EL K+S+  P+ ++VLR++T  +  ++  L  KFGA       LL+ A  LS++V+G+SFHVGSGC +  A+ + +     V E+A + G+N  +LDIGGGFPG          +++FEEM   +N  LD YFPE  + +IIAEPGRY+V  A++L   +I  + + +                +   D+ E     ++  Y+                                   NDGVY SFNC+VFDHA P P          ++ + +  +Y S+++GPTCDG D I +   LP+  +G+W+++ NMGAYTIAASS FNG   +  HY M
Sbjct:   39 FFVADLGDVVKKHLRFLKALPRVKPFYAVKCNSSRGVVKILAELGAGFDCASKTEIELVQDI-----GVTPERIIYANPCKQISQIKFAAKTGVQMMTFDNEVELSKVSRNHPNARMVLRIATDDS-KSSARLSVKFGAPLKSCRRLLEMAKNLSVDVIGVSFHVGSGCTDSKAYTQAIADARLVFEMASEFGYNMWLLDIGGGFPGTED------SKIRFEEMAGVINPALDLYFPEGSDVQIIAEPGRYYVTSAFSLAVNIIAKKEVLM---------------EHSGSDDEENGPNKNIMYYV-----------------------------------NDGVYGSFNCLVFDHAHPKPI-------LHKKPSPDQPLYTSSLWGPTCDGLDQIAENLLLPEHHVGDWLLFENMGAYTIAASSNFNGFQQSPVHYAM 408          
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:Xenbase;Acc:XB-GENE-979047])

HSP 1 Score: 236.884 bits (603), Expect = 1.304e-70
Identity = 144/461 (31.24%), Postives = 229/461 (49.67%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREM---ACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKV-LSCEVGK 1781
            FY  +LG I  +  R+   LPRV+PF+AVKC    +V+ +L  LG GFDCAS  EI      M       A  I++ANP K    I YA+  GV  +TFD E+EL K++   P  +++LR++T     A C L +K+GA  ++   LL+ A  L++ V+G+SFH GSGC    +F + +    +V E+ +K+G+   +LDIGGGF G S        +  FEE    +   L+ YFP      II+EPGRY+V  A+T+                    NI   K+ YE                                  NS+ K++        Y++NDGVY +F          + F +   +   + +    C+ +++ S ++GPTC   D ++ +  LP++E G+W+++PNMGAY+I+ S+ FNG P  + ++ +     +++  V + C+ G+
Sbjct:   33 FYVADLGDIKQKHWRFMKELPRVKPFYAVKCNSTNEVLQMLATLGTGFDCASMGEI-----DMVLRMGVPAADIVYANPCKQVSHIKYAAAHGVCKMTFDCEAELFKIAAFHPKAEMILRIATDDR-DAWCALSSKYGALVEQCEDLLKTAKNLNIQVIGVSFHTGSGCKNTHSFCKAIEDARKVFEIGKKLGYQMRLLDIGGGFSGNSEF------RPTFEEFADVIRQSLNQYFPNNKEVEIISEPGRYYVESAFTVAL------------------NIITKKEVYEK-------------------------------DGNSRRKFS--------YILNDGVYGTF----------LDFYLVKEKQKLKPLLGKVCDQKLFPSNLWGPTCTNVDKLVNEFYLPELETGDWVIFPNMGAYSISMSTTFNGFPQPKVYFVLKSPSGIQIKTVDVQCKKGE 414          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Odc1 (ornithine decarboxylase, structural 1 [Source:MGI Symbol;Acc:MGI:97402])

HSP 1 Score: 294.664 bits (753), Expect = 4.145e-92
Identity = 168/447 (37.58%), Postives = 242/447 (54.14%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHA--------KPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++S L  +G GFDCASK EI+ ++  +       A  +I+ANP K    I YA+  GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL+++V+G+SFHVGSGC + + F + V     V ++A ++GF+  +LDIGGGFPG          +++FEE+ + +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  +++    P S+              D  E++ Q  M                                    Y +NDGVY SFNCI++DHA        +P P     +E Y          Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   40 FYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQ-LVQGLGV----PAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSEDT------KLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQPGSD--------------DEDESNEQTFM------------------------------------YYVNDGVYGSFNCILYDHAHVKALLQKRPKP-----DEKY----------YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVM 409          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin2 (antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:2442093])

HSP 1 Score: 228.409 bits (581), Expect = 4.385e-67
Identity = 136/442 (30.77%), Postives = 220/442 (49.77%), Query Frame = 3
Query:  405 APFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQ-GSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            A F+  +LG++  +   +   LPRV+PF+AV C     V+ +L +LG GF CA+K E++ V           A+ II ANP K    I YA++ GV  ++FD E EL K+ +  PS ++VL ++TQ +++    L  +FGA       LL+ A +  + VVG+SFH+GSGC +  A+ +++     V ++  ++G    ILD+GGGFPGL         +++FEEM + +N  LD YFPE     I+AE GRY+V  A+T+   ++  R                     E  D      Q G+ P+ ++                               Y +++GVY  FN ++FD+  P P          ++ + +  +Y S+++GP  +G DC+ +   LP++++G+W+V+ NMGAYT+   S   G       Y M
Sbjct:   39 AAFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHI-----GVPASKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLN-HLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPGLE------GAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKR---------------------EVLDQASREEQTGAAPKSIV-------------------------------YYLDEGVYGVFNSVLFDNTCPTP-------ALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAM 409          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin2 (antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:2442093])

HSP 1 Score: 228.409 bits (581), Expect = 4.385e-67
Identity = 136/442 (30.77%), Postives = 220/442 (49.77%), Query Frame = 3
Query:  405 APFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQ-GSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            A F+  +LG++  +   +   LPRV+PF+AV C     V+ +L +LG GF CA+K E++ V           A+ II ANP K    I YA++ GV  ++FD E EL K+ +  PS ++VL ++TQ +++    L  +FGA       LL+ A +  + VVG+SFH+GSGC +  A+ +++     V ++  ++G    ILD+GGGFPGL         +++FEEM + +N  LD YFPE     I+AE GRY+V  A+T+   ++  R                     E  D      Q G+ P+ ++                               Y +++GVY  FN ++FD+  P P          ++ + +  +Y S+++GP  +G DC+ +   LP++++G+W+V+ NMGAYT+   S   G       Y M
Sbjct:   39 AAFFVADLGAVVRKHFCFLKHLPRVRPFYAVGCNSSLGVLKVLAELGLGFSCANKAEMELVQHI-----GVPASKIICANPCKQVAQIKYAAKHGVRLLSFDNEVELAKVVKSHPSAKMVLCIATQDSHSLN-HLSLRFGASLKSCRHLLENAKKSHVEVVGVSFHIGSGCPDPQAYAQSIADARLVFQMGEELGHTMNILDLGGGFPGLE------GAKVRFEEMASVINSALDLYFPEGCGVDILAELGRYYVTSAFTVAVSIVAKR---------------------EVLDQASREEQTGAAPKSIV-------------------------------YYLDEGVYGVFNSVLFDNTCPTP-------ALQKKPSADQPLYSSSLWGPAVEGCDCVAEGLWLPQLQVGDWLVFDNMGAYTVDTKSLLGGTQARRVTYAM 409          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin1 (antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:1859169])

HSP 1 Score: 199.134 bits (505), Expect = 2.478e-56
Identity = 125/448 (27.90%), Postives = 215/448 (47.99%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGN-KFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALEL 1751
            F+  +LG I  +  +W++++ +++PF+ VKC   P V+ +L  LG GF C+SK E+  V +        +  +IIF +P K    I YA++ GVN +T D E EL K+++  P+ +++L ++T+         GN KFG        LL+ A EL + ++G+ FHV S C E   +   +     V ++A + GF   +LDIGGGF G          ++Q EE+   ++ +LD YFPE    +II+EPG Y+V  A+TL   +I  + ++                                                 + + +S  + N   E  + Y +NDGVY SF   + +    +P    +    ++E   +  ++ S+++GP+CD  D I++   LP++ +G+W+++ NMGA +    S FN       ++ M   D  E+
Sbjct:   40 FFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQEL-----GVSPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGED--GNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG---------TEIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVE-------------------------------------------------NDKFSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIP----EVHKKYKE---DEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEM 415          
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Match: Azin1 (antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:1859169])

HSP 1 Score: 199.134 bits (505), Expect = 2.478e-56
Identity = 125/448 (27.90%), Postives = 215/448 (47.99%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGN-KFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALEL 1751
            F+  +LG I  +  +W++++ +++PF+ VKC   P V+ +L  LG GF C+SK E+  V +        +  +IIF +P K    I YA++ GVN +T D E EL K+++  P+ +++L ++T+         GN KFG        LL+ A EL + ++G+ FHV S C E   +   +     V ++A + GF   +LDIGGGF G          ++Q EE+   ++ +LD YFPE    +II+EPG Y+V  A+TL   +I  + ++                                                 + + +S  + N   E  + Y +NDGVY SF   + +    +P    +    ++E   +  ++ S+++GP+CD  D I++   LP++ +G+W+++ NMGA +    S FN       ++ M   D  E+
Sbjct:   40 FFVGDLGKIVKKHSQWQTVVAQIKPFYTVKCNSTPAVLEILAALGTGFACSSKNEMALVQEL-----GVSPENIIFTSPCKQVSQIKYAAKVGVNIMTCDNEIELKKIARNHPNAKVLLHIATEDNIGGED--GNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKEYQVYVHALSDARCVFDMAGEFGFTMNMLDIGGGFTG---------TEIQLEEVNHVISPLLDIYFPEGSGIQIISEPGSYYVSSAFTLAVNIIAKKVVE-------------------------------------------------NDKFSSGVEKNGSDEPAFVYYMNDGVYGSFASKLSEDLNTIP----EVHKKYKE---DEPLFTSSLWGPSCDELDQIVESCLLPELNVGDWLIFDNMGADSFHEPSAFNDFQRPAIYFMMSFSDWYEM 415          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|Q9I8S4|AZIN2_XENLA (Antizyme inhibitor 2 OS=Xenopus laevis OX=8355 GN=azin2 PE=2 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 6.240e-92
Identity = 164/439 (37.36%), Postives = 239/439 (54.44%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            F+  +LG +  + +R+   LPRV+PF+AVKC     V+ +L +LGAGFDCASK EI+ V D        A   II+ANP K    I YA++ GV  +TFD E EL K+S+  P+ ++VLR++T  +  ++  L  KFGA       LL+ A  LS++V+G+SFHVGSGC +  A+ + +     V E+A + G+   +LDIGGGFPG          +++FEE+   +N  LD YFPE  + +IIAEPGRY+V  A++L   VI  + ++                 +   D+ E  S  S+                                    Y +NDGVY SFNC+VFDHA P P          ++ + +  +Y S+++GPTCDG D I ++  LP++ +G+W+++ NMGAYTIAASS FNG   +  HY M
Sbjct:   39 FFVADLGDVVRKHLRFLKALPRVKPFYAVKCNSSKGVVKILAELGAGFDCASKTEIELVQDV-----GVAPERIIYANPCKQISQIKYAAKNGVQMMTFDNEVELSKVSRSHPNARMVLRIATDDS-KSSARLSVKFGAPLKSCRRLLEMAKNLSVDVIGVSFHVGSGCTDSKAYTQAISDARLVFEMASEFGYKMWLLDIGGGFPGTED------SKIRFEEIAGVINPALDMYFPESSDVQIIAEPGRYYVASAFSLAVNVIAKKEVE-----------------HSVSDDEENESSKSI-----------------------------------MYYVNDGVYGSFNCLVFDHAHPKPI-------LHKKPSPDQPLYTSSLWGPTCDGLDQIAERVQLPELHVGDWLLFENMGAYTIAASSNFNGFQQSPVHYAM 406          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P00860|DCOR_MOUSE (Ornithine decarboxylase OS=Mus musculus OX=10090 GN=Odc1 PE=1 SV=2)

HSP 1 Score: 294.664 bits (753), Expect = 2.900e-91
Identity = 168/447 (37.58%), Postives = 242/447 (54.14%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHA--------KPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++S L  +G GFDCASK EI+ ++  +       A  +I+ANP K    I YA+  GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL+++V+G+SFHVGSGC + + F + V     V ++A ++GF+  +LDIGGGFPG          +++FEE+ + +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  +++    P S+              D  E++ Q  M                                    Y +NDGVY SFNCI++DHA        +P P     +E Y          Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   40 FYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAAIGTGFDCASKTEIQ-LVQGLGV----PAERVIYANPCKQVSQIKYAASNGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMATEVGFSMHLLDIGGGFPGSEDT------KLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQPGSD--------------DEDESNEQTFM------------------------------------YYVNDGVYGSFNCILYDHAHVKALLQKRPKP-----DEKY----------YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVM 409          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27117|DCOR_BOVIN (Ornithine decarboxylase OS=Bos taurus OX=9913 GN=ODC1 PE=2 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 3.396e-90
Identity = 160/439 (36.45%), Postives = 239/439 (54.44%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++  L  +G GFDCASK EI+ ++ ++     +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL ++V+G+SFHVGSGC + + F + +     V ++  ++GFN  +LDIGGGFPG   +      +++FEE+ + +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  + +               K+   + D  E++                                    ++ + Y +NDGVY SFNCI++DHA   P          +    + + Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   40 FYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRTIVKTLAAIGTGFDCASKTEIQ-LVQSLGVPPER----IIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELDIDVIGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFNMYLLDIGGGFPGSEDV------KLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKLV--------------LKEQTGSDDEEEST------------------------------------DRTFMYYVNDGVYGSFNCILYDHAHVKPL-------LQKRPKPDEKYYSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM 409          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P11926|DCOR_HUMAN (Ornithine decarboxylase OS=Homo sapiens OX=9606 GN=ODC1 PE=1 SV=2)

HSP 1 Score: 291.197 bits (744), Expect = 5.648e-90
Identity = 168/467 (35.97%), Postives = 246/467 (52.68%), Query Frame = 3
Query:  342 HFSSSMESNLHIIKQRIMNCDA-----PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            HF     +   I+ Q+I    +      FY  +LG I  + +RW   LPRV PF+AVKC     ++  L   G GFDCASK EI+ ++ ++     +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL+++VVG+SFHVGSGC + + F + +     V ++  ++GF+  +LDIGGGFPG   +      +++FEE+   +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  + +               K+   + D  E+S Q  M                                    Y +NDGVY SFNCI++DHA   P          +    + + Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   12 HFLDEGFTAKDILDQKINEVSSSDDKDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTGFDCASKTEIQ-LVQSLGVPPER----IIYANPCKQVSQIKYAANNGVQMMTFDSEVELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLRTSRLLLERAKELNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGGGFPGSEDV------KLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKIV--------------LKEQTGSDDEDESSEQTFM------------------------------------YYVNDGVYGSFNCILYDHAHVKPL-------LQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPTIYYVM 409          
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Match: sp|P27119|DCOR_MUSPA (Ornithine decarboxylase OS=Mus pahari OX=10093 GN=Odc1 PE=2 SV=1)

HSP 1 Score: 291.197 bits (744), Expect = 5.831e-90
Identity = 167/447 (37.36%), Postives = 241/447 (53.91%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHA--------KPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG I  + +RW   LPRV PF+AVKC     ++S L   G GFDCASK EI+ ++  +     +    II+ANP K    I YA+ +GV  +TFD+E EL+K+++  P  +LVLR++T  +  A C L  KFGA       LL+RA EL+++V+G+SFHVGSGC + + F + V     V ++  ++GF+  +LDIGGGFPG          +++FEE+ + +N  LD YFP +   RIIAEPGRY+V  A+TL   +I  +++    P S+              D  E++ Q  M                                    Y +NDGVY SFNCI++DHA        +P P     +E Y          Y S+I+GPTCDG D I+++  LP+M +G+W+++ NMGAYT+AA+S FNG      +Y M
Sbjct:   40 FYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSRAIVSTLAATGTGFDCASKTEIQ-LVQGLGVPPER----IIYANPCKQVSQIKYAASSGVQMMTFDSEIELMKVARAHPKAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNIDVIGVSFHVGSGCTDPETFVQAVSDARCVFDMGTEVGFSMYLLDIGGGFPGSEDT------KLKFEEITSVINPALDKYFPSDSGVRIIAEPGRYYVASAFTLAVNIIAKKTVWKEQPGSD--------------DEDESNEQTFM------------------------------------YYVNDGVYGSFNCILYDHAHVKALLQKRPKP-----DEKY----------YSSSIWGPTCDGLDRIVERCNLPEMHVGDWMLFENMGAYTVAAASTFNGFQRPNIYYVM 409          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A507C446 (Uncharacterized protein OS=Synchytrium microbalum OX=1806994 GN=SmJEL517_g03068 PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 6.699e-96
Identity = 171/425 (40.24%), Postives = 235/425 (55.29%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASS 1685
            F+  +LG I  Q+ +WK++LPRV+PF+AVKC PDP ++  L  +GA FDCASK EI++V+D M  D ++    II+ANP K    I +A+   VN VTFD   ELVK+    P  ++VLR+    +++  C  G KFGA  + VP LLQ A +L +++VG+SFHVGSGC    AF + V     V ++A   GFN +ILDIGGGFPG       +   + F E+ T L   LDTYFP E   RIIAEPGRYFV  AYTL   ++  R             +  H+    A D+    +   M                    +N  P         + Y +NDG+Y SFNC+ FDHA   P  +  N  Y  +   + E+Y  +I+GPTCD  DCI +   LP+++IG+W+ + NMGAYT  A+S
Sbjct:  106 FFIADLGCIQRQYFQWKTMLPRVEPFYAVKCNPDPTIVKTLASVGANFDCASKAEIQTVLD-MGVDPSR----IIYANPCKQLSYIKWAATRNVNMVTFDNADELVKIKAAHPHCKVVLRILADDSHS-VCKFGVKFGASQEVVPLLLQTARDLDLDLVGVSFHVGSGCGSATAFSDAVALARSVFDVAENYGFNLSILDIGGGFPG------RVTDGVTFPEIATVLRPALDTYFPAEMGVRIIAEPGRYFVSSAYTLAVNIVARR-------------VVQHQVIAPASDSFAVPNTDGM-----------------LVDENVNPNVTVDEHPTFMYYVNDGMYGSFNCLTFDHAVVTPRVLSKNGVYLYDATPKEEVYGCSIWGPTCDSIDCISKSSFLPQLDIGDWLYFENMGAYTCTAAS 488          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A367IST7 (Uncharacterized protein OS=Rhizopus stolonifer OX=4846 GN=CU098_002136 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 7.167e-96
Identity = 173/437 (39.59%), Postives = 241/437 (55.15%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHY 1721
            F+  +LG +F Q +RWK+LLPR++PFFAVKC PDP V+ LL  LG GFDCASK EI+ V+D         +  II+ANP K    I YA++  V+ +TFD   EL K+ + +P  +LVLR+ T  + ++ C LG KFGA  D V  LL+ A EL +NV+G+SFHVGSGC +  AF + V+   +V +  + +GFN T+LD+GGGFPG      D+   + FE++   L  ++D+ FP E   R+IAEPGRY+V  A+T+ T +IG R+            IA  K         E S Q                                     Y Y +NDG+Y SFNCI+FDH    P  +  +  +      +   Y S+++GPTCD  DC+ +   LP +E G+W+ + NMGAYTI A+S FNG   +E  Y
Sbjct:   59 FFVGDLGEVFRQHLRWKALLPRIEPFFAVKCNPDPMVVKLLASLGTGFDCASKSEIQQVLDA-----GVESNRIIYANPCKQASFIRYAAQHNVSRMTFDNTEELYKIKKLYPDAELVLRILTDDS-SSLCQLGLKFGAPLDTVEDLLRTAKELELNVMGVSFHVGSGCLDASAFGDAVLRARRVFDQGQAMGFNFTLLDVGGGFPG-----SDIKDGITFEKVAAILGPMVDSMFPPE--IRVIAEPGRYYVSSAFTICTNIIGRRT------------IAAPK-------TAEQSQQ-------------------------------------YMYYVNDGMYGSFNCIIFDHQVVYPKVLVKDNNFVYGQQLQEPHYESSVWGPTCDSIDCLNKSAQLPVLEAGDWLYYENMGAYTICAASQFNGFRKSEVLY 426          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A1X0RVE1 (Uncharacterized protein OS=Rhizopus microsporus OX=58291 GN=BCV71DRAFT_27584 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 7.651e-96
Identity = 170/437 (38.90%), Postives = 244/437 (55.84%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHY 1721
            F+  +LG +F Q +RWK+LLPR++PFFAVKC PDP +I LL  LG GFDCASK EI+ V+     D    +  II+ANP K    I YA++  V+ +TFD   EL K+ + +P  +LVLR+ T  +  + C LG KFGA  D V  LL+ A EL +NV+G+SFHVGSGC +  AF + V+   +V + A ++GF+ T+LD+GGGFPG     +D+   + FE++ + L  ++D+ F    + R+IAEPGRY+V  A+T+ T +IG R+                         V   S+G  P ++                                Y INDG+Y SFNCI+FDH    P  +  N+ +      + E + S+++GPTCD  DC+ +   LP +E G+W+ + NMGAYTI A+S FNG   +E  Y
Sbjct:   59 FFVGDLGEVFRQHLRWKALLPRIEPFFAVKCNPDPMIIRLLASLGCGFDCASKSEIQQVL-----DAGVESNRIIYANPCKQASFIRYAAQQNVSRMTFDNAEELYKIKKFYPDAELVLRILTDDS-NSLCQLGLKFGAPLDTVEHLLKTAKELDLNVMGVSFHVGSGCLDASAFGDAVLRARRVFDQAEQMGFHFTLLDVGGGFPG-----NDVKDGITFEKVASILGPMVDSLF--SPDIRVIAEPGRYYVASAFTICTNIIGRRT-------------------------VAPKSEGEQPRFM--------------------------------YYINDGMYGSFNCIMFDHQVVHPKVLVKNDEFVYGQEIQEEQFESSVWGPTCDSIDCLNKSTALPMLEPGDWLYYENMGAYTICAASQFNGFRKSEVIY 425          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A433P9I8 (Ornithine decarboxylase OS=Endogone sp. FLAS-F59071 OX=2340872 GN=BC937DRAFT_94191 PE=3 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 1.718e-95
Identity = 182/468 (38.89%), Postives = 263/468 (56.20%), Query Frame = 3
Query:  348 SSSMESNLHIIKQRIMNCD--AP-------FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGY-FREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHY 1721
            S S  S   II++++ + D  AP       F+  +LG I+ Q  RWK LLPR++PFFAVKC PDP +  LL  LG GFDCASK EI+  + ++  D ++    II+ANP K    I YA++ GV  +TFD   EL K+ + +P  +LVLR+ T  +  + C LG KFGA  D   +LL+ A EL +NV+G+SFHVGSGC + +AF + V+   +V + A +IG+N T+LD+GGGFP  +++ D +     FE++   L  V+D  FPE  + R+IAEPGRY+V  A+TL T VI  R++                     +D   T   G+                      + +P         Y Y INDG+Y SFNC++FDH    P  +  +  + F E   E E +  +++GPTCD  DCI++   LP++E+G+WI + NMGAYT+ A+S FNG   ++ HY
Sbjct:   36 SISDRSVKEIIREQVESIDTEAPEADEENAFFVADLGEIYRQQQRWKRLLPRIEPFFAVKCNPDPMISRLLASLGTGFDCASKAEIQQTL-SLGVDPSR----IIYANPCKQASFIRYAAQHGVKKMTFDNAEELEKIKRFFPDAELVLRILTDDS-KSLCKLGLKFGASLDSTGYLLRTAKELELNVIGISFHVGSGCFDENAFGDAVVRARKVFDQAAEIGYNFTLLDVGGGFPA-ANVQDGIT----FEKVAAILGPVVDKLFPE--SVRVIAEPGRYYVASAFTLATNVIARRTV------------------LRDHDGSSTGEHGA-------------------PTGDDQPS--------YMYYINDGMYGSFNCVMFDHQVVSPQVLMKSSIFTFGEKFDEAE-FGCSVWGPTCDSIDCIVRNANLPQLEVGDWIYFENMGAYTVCAASQFNGFRKSKIHY 444          
BLAST of Ornithine decarboxylase vs. TrEMBL
Match: A0A0A1NSM0 (Putative ODC OS=Rhizopus microsporus OX=58291 GN=RMCBS344292_09712 PE=3 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 1.721e-95
Identity = 177/469 (37.74%), Postives = 251/469 (53.52%), Query Frame = 3
Query:  315 ERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHY 1721
            ERI  I    + S  ES               F+  +LG +F Q +RWK+LLPR++PFFAVKC PDP +I LL  LG GFDCASK EI+ V+     D    +  II+ANP K    I YA++  V  +TFD   EL K+ + +P  +LVLR+ T  +  + C LG KFGA  D V  LL+ A EL +NV+G+SFHVGSGC +  AF + V+   +V + A ++GF+ T+LD+GGGFPG     +D+   + FE++ + L  ++D+ F    + R+IAEPGRY+V  A+T+ T +IG R+                         V   S+G  P ++                                Y INDG+Y SFNCI+FDH    P  +  N+ +      + E + S+++GPTCD  DC+ +   LP +E G+W+ + NMGAYTI A+S FNG   +E  Y
Sbjct:   41 ERIQSISTQKWDSDQES--------------AFFVGDLGEVFRQHLRWKALLPRIEPFFAVKCNPDPMIIRLLASLGCGFDCASKSEIQQVL-----DAGVESNRIIYANPCKQASFIRYAAQQNVCRMTFDNAEELYKIKKFYPDAELVLRILTDDS-NSLCQLGLKFGAPLDTVEHLLKTAKELDLNVMGVSFHVGSGCLDASAFGDAVLRARRVFDQAEQMGFHFTLLDVGGGFPG-----NDVKDGITFEKVASILGPMVDSLF--SPDIRVIAEPGRYYVASAFTICTNIIGRRT-------------------------VAPKSEGEQPRFM--------------------------------YYINDGMYGSFNCIMFDHQVVHPKVLVKNDEFVYGQEIQEEQFESSVWGPTCDSIDCLNKSTALPMLEPGDWLYYENMGAYTICAASQFNGFRKSEVIY 425          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: odc1 (ornithine decarboxylase 1 [Source:NCBI gene;Acc:103026254])

HSP 1 Score: 304.679 bits (779), Expect = 4.841e-96
Identity = 165/439 (37.59%), Postives = 244/439 (55.58%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG +  + +RW  +LPRV PF+AVKC     V+  L  LGAGFDCASK EI+ ++ ++  D ++    II+ANP K    I YAS  GV  +TFD+E EL+K+++   + +LVLR++T  +  A C L  KFGA       LL+RA EL ++V+G+SFHVGSGC + + + + +     V ++  ++G+N T+LDIGGGFPG    +DD   +++FE++   +N  LD YFP +   +IIAEPGRY+V  AYTL   +I  + +                   +     +   +G+    L+                               Y +NDGVY SFNCI++DHA  +P          ++   +  MY  +I+GPTCDG D I++Q  LP M++G+W+++ NMGAYT+AASS FNG    + HY M
Sbjct:   40 FYVADLGDVLKKHLRWARVLPRVTPFYAVKCNDSRTVVKTLASLGAGFDCASKTEIQ-IVQSLGVDPSR----IIYANPCKQVSQIKYASAHGVQMMTFDSEVELMKVARSHDNAKLVLRIATDDS-KAVCRLSVKFGATLKSSRLLLERAKELGLDVIGVSFHVGSGCTDPETYSQAISDARCVFDMGAELGYNMTLLDIGGGFPG----SDD--SKLKFEDITAVINPALDKYFPADSGVKIIAEPGRYYVASAYTLAVNIIAKKVI------------------MKEQSGSDEEDEGTSDRRLM-------------------------------YYVNDGVYGSFNCILYDHAHVMPV-------LHKKPKPDECMYPCSIWGPTCDGLDRIVEQCSLPDMQVGDWLLFENMGAYTVAASSTFNGFQKPDIHYIM 410          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: azin1b (antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-030121-1])

HSP 1 Score: 201.06 bits (510), Expect = 2.859e-57
Identity = 134/478 (28.03%), Postives = 229/478 (47.91%), Query Frame = 3
Query:  330 IELVHFSSSMESNL--HIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDK 1757
            +EL+   ++++  +  HI +Q +   +A F   NLG++  Q + W+S+LP V+PF+ VK    P VI +L  LG GF C++K EI  V+     +      +II +   K    I +A++ G+N +  D E+EL K+++  P+ +L+L+LST+   A T      FG        LL+ + EL ++VVG+ F V + C +   +   +     V ++  +IGFN  ILDIGGGF G          + Q +++   +  +L+ YFP     R+IAEPG ++V  ++TLV  VIG +             +A    + E  D   +      PE+L                                Y +NDGVY SF   +  +  P P      + +   +A +  M+ S+++GP+CD  D +++   LP++ +G+W+++ NMGA     S+  N       +Y +  +D  E+ +
Sbjct:   12 VELLEGGTTLKDVIDNHIYEQALAEKNA-FVVANLGALMQQHVLWQSMLPMVRPFYPVKYNSSPAVIEVLAALGVGFVCSNKAEISLVL-----NHDVPPENIILSGVCKQLSHIKHATKNGINYLVCDNEAELCKIARAHPNAKLLLQLSTE---AQTEEASMAFGCSLKSCRHLLETSKELGVDVVGVMFQVPASCRDPQVYTHALSDARCVFDMGAEIGFNMEILDIGGGFSG---------SEFQLKQIHAAIRPLLEAYFPVMSGVRVIAEPGTFYVSSSFTLVVNVIGKK-------------VAAGSLHVETKDLTPSDE----PEFL--------------------------------YYLNDGVYGSFMGKLLGNTIPSP------KVHKMSLAADEPMFPSSLWGPSCDALDQVVEHCLLPELTVGDWLIFNNMGASGQEESAAINNSDKPPVYYTISTDDWFEMQE 416          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: ENSAMXT00000043561.1 (antizyme inhibitor 1-like [Source:NCBI gene;Acc:111189228])

HSP 1 Score: 198.749 bits (504), Expect = 1.231e-56
Identity = 133/472 (28.18%), Postives = 226/472 (47.88%), Query Frame = 3
Query:  330 IELVHFSSSMESNL--HIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQED 1739
            +EL+   ++++  +  HI +Q +   +A F   NLG++  Q + W+S+LP V+PF+ VK    P VI +L  LG GF C++K EI  V+     +      +II +   K    I +A++ G+N +  D E+EL K+++  P+ +L+L+LST+   A T      FG        LL+ + EL ++VVG+ F V + C +   +   +     V ++  +IGFN  ILDIGGGF G          + Q +++   +  +L+ YFP     R+IAEPG ++V  ++TLV  VIG +             +A    + E  D   +      PE+L                                Y +NDGVY SF   +  +  P P      + +   +A +  M+ S+++GP+CD  D +++   LP++ +G+W+++ NMGA     S+  N       +Y +  +D
Sbjct:   12 VELLEGGTTLKDVIDNHIYEQALAEKNA-FVVANLGALMQQHVLWQSMLPMVRPFYPVKYNSSPAVIEVLAALGVGFVCSNKAEISLVL-----NHDVPPENIILSGVCKQLSHIKHATKNGINYLVCDNEAELCKIARAHPNAKLLLQLSTE---AQTEEASMAFGCSLKSCRHLLETSKELGVDVVGVMFQVPASCRDPQVYTHALSDARCVFDMGAEIGFNMEILDIGGGFSG---------SEFQLKQIHAAIRPLLEAYFPVMSGVRVIAEPGTFYVSSSFTLVVNVIGKK-------------VAAGSLHVETKDLTPSDE----PEFL--------------------------------YYLNDGVYGSFMGKLLGNTIPSP------KVHKMSLAADEPMFPSSLWGPSCDALDQVVEHCLLPELTVGDWLIFNNMGASGQEESAAINNSDKPPVYYTISTDD 410          
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Match: azin1 (Astyanax mexicanus antizyme inhibitor 1 (azin1), mRNA. [Source:RefSeq mRNA;Acc:NM_001292031])

HSP 1 Score: 194.512 bits (493), Expect = 1.098e-54
Identity = 133/464 (28.66%), Postives = 218/464 (46.98%), Query Frame = 3
Query:  372 HIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLST----QRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALEL 1751
            HI  Q +   +A F+  +LG+I  Q +RWKS + +V+PF+ +KC   P VI +L  LG GF C+SK E++ V    SF     +  II     K    I YA++ GV  +  D+E+EL K+++     +L+L+++T    +R   +       FG    +   +L+ A ELS++V G+ FH+ S C E  AF   V     V ++  ++GF   ILDIGGGF G          + Q E++   L  +LD YFP      +IAEPG Y+V  A++L   +I  +                          + +   G  P+  L                N +P+        ++Y +NDGV+ SF   + D + PVP          +E + E  ++ S+++GP+ DG D +++   LP++ +G+W+V+ + GA ++ A            HY +   D  E+
Sbjct:   28 HICDQTLAQKNA-FFVADLGAIIWQQIRWKSRMEQVRPFYVLKCNSSPVVIEILAALGTGFICSSKHELELV---KSFGVL--SQDIILGGMCKQLSLIKYAAKLGVQLLVCDSEAELRKIARCHSKAKLLLQVTTGGCCEREETSM-----PFGLTLKDCRHMLECAKELSLHVAGVKFHIPSCCAEPQAFTHAVSDARCVFDMGEELGFVMNILDIGGGFDG---------TEAQLEKVNRALKPMLDVYFPPSTGVSVIAEPGAYYVSAAFSLAVSIISKK--------------------------IVSRDAGQHPDDEL--------------SGNDEPE--------FQYYMNDGVFGSFAYKLLDESVPVP-------SLHKEKSLEEPLFSSSLWGPSSDGLDQVVESCLLPELSVGDWLVFSHSGANSLGAMGAHADGHRPPVHYVISAGDWYEI 416          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 296.204 bits (757), Expect = 1.212e-93
Identity = 163/443 (36.79%), Postives = 237/443 (53.50%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQED 1739
            FY  +LG +  +  RW   LP V PF+AVKC  +  V+  L  +GAGFDCASK E+  V+          A  II+ANP K    I YA+R GV+T+TFD E+EL K+++  P  +LVLR+    +  A C L  KFGA       LL+RA +L ++V+G+SFHVGSGC E + F   +     V ++A   G+  ++LDIGGGFPG          ++ FEE+   LN  L+ YFP E   R+IAEPGR++V  A+ L   +I  +++ V N + N                 E +S+   P Y+                                Y +NDGVY SFNCI+FDHA  +P          R++  +  ++ ++++GPTCDG DC+++   LP++ +G+W+++ +MGAYT+AA+S FNG      HY M  ED
Sbjct:   41 FYVADLGDVVQKHARWLEHLPLVSPFYAVKCNDELPVLRALAAMGAGFDCASKNEMALVLGL-----GVPAERIIYANPCKQVSHIKYAARHGVHTMTFDNEAELEKVARNHPHARLVLRIMADDS-KAVCRLSVKFGASLKSCRHLLERARQLGVDVIGVSFHVGSGCMEAETFALAIADARCVFDMAVDFGYCLSLLDIGGGFPGSPD------AKVTFEEIAGVLNGALERYFPAESGVRVIAEPGRFYVASAFMLAVGIIAKKAV-VQNSLDN-----------------EEASRDDQPAYM--------------------------------YYVNDGVYGSFNCILFDHANVLPLA-------HRKVDLDEPLFETSVWGPTCDGLDCVLECVQLPELHLGDWLIFQHMGAYTLAAASTFNGFQKPVVHYVMSSED 414          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 289.271 bits (739), Expect = 7.091e-91
Identity = 158/455 (34.73%), Postives = 245/455 (53.85%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDAL---ELDKVLS 1766
            FY ++LG I  + +RW   LPRV+PF+A+KC     ++  L  LGAGFDCASK EI +++ ++      +A  II+ANP K    + YA+  GVN +TFD ++EL K ++  P+ ++VLR+ T  +  + C    KFGA       LL+ A  L ++VVG+SFHVGSGC +   + +++     +  +A ++GFN  +LDIGGGFPG      D   ++ F+E+   +N  LD YFP+     IIAEPGRY+V  A+TL   +I  ++                        +  +++ G  P ++                                Y +NDGVY SFNCI+FDH +P P         ++ +  E  ++ S+++GPTCDG D ++++  LP++ +G+W+++ NMGAYT+AA+S FNG P    HY +   D +   EL + LS
Sbjct:   39 FYVVDLGDIVRKHLRWLGTLPRVRPFYAIKCNSTQTIVHTLATLGAGFDCASKAEI-ALVQSLGV----SADRIIYANPCKQASHVRYAAEHGVNLMTFDNDAELHKAARINPNAKMVLRIVTDDS-KSICRFSMKFGASLKASRHLLETARNLGVDVVGVSFHVGSGCQDAQTYAQSIADARVLFNIAAEMGFNMNLLDIGGGFPG-----SDTNAKLTFDEIAAVVNPALDLYFPKGCGVNIIAEPGRYYVTSAFTLAVNIIAKKTF-----------------------SKASANGGEEPVHM--------------------------------YYVNDGVYGSFNCILFDHVQPDPI-------VYKHVEPEEPVFESSLWGPTCDGLDRVVERMQLPELHVGDWLLFRNMGAYTMAAASNFNGFPKPPLHYVIRNADWIAIHELHRSLS 420          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 268.855 bits (686), Expect = 3.495e-84
Identity = 153/443 (34.54%), Postives = 247/443 (55.76%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQED 1739
            FY ++LG I  + +RW S LPRV+PF+AVKC     ++ +L  LGAGFDCASK+EI +++ ++      +A  II+ANP K    + YA++ GV+ +TFD+++EL K+++  P+ +LVLR+ T  +  +   + NKFG   +    LL+ A  L + VVG+SFHVGS CNE +AF +++    +V  +A  +G   T+LDIGGGFPG    N+ +  +  F+E+   +N  LDT+FP      II+EPGRY+V  A+TL T VIG +++               K + ++ DN                                    + + E  Y Y +NDG++ SF  ++ D  + V   +       + +  E  +  S+++GP+CDG+DC++++ PLP+M + +W+++ NMGAYT+A S+ FNG      HY + + +
Sbjct:    5 FYVVDLGDIVRKHLRWLSTLPRVRPFYAVKCNSTQTIVHILATLGAGFDCASKEEI-ALVQSIGV----SADRIIYANPCKQASHLRYAAKYGVDLMTFDSDAELHKIARINPNARLVLRILTNDS-RSVYRMSNKFGVSPESSRELLETAFGLGLLVVGVSFHVGSICNEPEAFAQSIADARRVFNIAADLGVKLTLLDIGGGFPGY---NEHV--RNNFDEIAAVVNSALDTHFPAGCGVNIISEPGRYYVMSAFTLATNVIGKKTV--------------WKYSAQSDDN------------------------------------DSVGEPVYMYYMNDGIHGSFQHVIHDIEEVVTEAL-------KPVGPEEPVLESSLWGPSCDGYDCVVKRMPLPEMHVDDWLLFRNMGAYTLAMSTEFNGFRRPMLHYVIRKTE 379          
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Match: AZIN1 (antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:16432])

HSP 1 Score: 267.314 bits (682), Expect = 4.719e-83
Identity = 154/452 (34.07%), Postives = 241/452 (53.32%), Query Frame = 3
Query:  378 IKQRIMNCDA--PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            I +R ++ D    FY ++LG I  + +RW   LPRV+PF+AVKC     ++  L  LG GFDCASK EI +++ ++      +A  II+ANP K    + YA+  GV+ +TFD ++EL K+++  P+ +LVLR++T  +  +   +  KFGA  +    LL+ A  L + VVG+SFHVGS C +  A+ E +    QV   A ++G + T+LDIGGGFPG +        ++ FEE+   +N  LDT+FP      II+EPGRY+V  A TL T VI  ++    NP+++V               + +++    P ++                                Y INDG + SFN + F      P  +       + +  E  ++ S+++GPTCDG DC+M++  L ++ +G+W+++ NMGAYT+  SS FNG P+   HY +
Sbjct:   29 INKRALHEDEKDAFYVVDLGDIVRKHLRWLGALPRVRPFYAVKCNNTQTIVQTLATLGTGFDCASKAEI-ALVQSLGV----SADRIIYANPCKQASHVRYAAEHGVDLMTFDNDAELHKIARVNPNARLVLRIATDDS-KSVYKMSRKFGASVESSHQLLETAQGLGLLVVGVSFHVGSCCQDGVAYTEAIANARQVFNNAAELGLSLTLLDIGGGFPGHNG-----ESKITFEEIAAVVNSALDTHFPAGCGVNIISEPGRYYVMSALTLATNVIAKKTF--VNPLADV---------------LTSATGEGQPVHM--------------------------------YYINDGNFGSFNFVFFKEKFTPPVAL-------KRVDPEEPVFESSVWGPTCDGLDCVMERTQLLELHVGDWLLFRNMGAYTLTLSSGFNGFPLPNIHYMI 413          
BLAST of Ornithine decarboxylase vs. Ensembl Yeast
Match: SPE1 (Ornithine decarboxylase; catalyzes the first step in polyamine biosynthesis; degraded in a proteasome-dependent manner in the presence of excess polyamines; deletion decreases lifespan, and increases necrotic cell death and ROS generation [Source:SGD;Acc:S000001667])

HSP 1 Score: 181.03 bits (458), Expect = 1.613e-50
Identity = 117/308 (37.99%), Postives = 161/308 (52.27%), Query Frame = 3
Query:  327 DIELVHFSSSMESNLHIIKQRI-----MNCDA----PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVME-LARKIGFNP-TILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSL 1217
            D+EL+    +       +K RI       CD      F+  +LG +   F  W   LPR++PF+AVKC PD KV+SLL +LG  FDCASK EI  V+ +M+     +   I++ANP K    I YA+   V   TFD   EL K+ +  P  QL+LR++T  +  A C L  K+G + + V  LL+   EL +N+ G+SFHVGSG ++  +  + V     V +  A + G  P  ILD+GGGF   S           F+E    L   L+ +FP      IIAEPGRYFV  A+TL + VI  R L
Sbjct:   50 DLELLPHEQAHPKIFQALKARIGRINNETCDPGEENSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPDTKVLSLLAELGVNFDCASKVEIDRVL-SMNI----SPDRIVYANPCKVASFIRYAASKNVMKSTFDNVEELHKIKKFHPESQLLLRIATDDS-TAQCRLSTKYGCEMENVDVLLKAIKELGLNLAGVSFHVGSGASDFTSLYKAVRDARTVFDKAANEYGLPPLKILDVGGGFQFES-----------FKESTAVLRLALEEFFPVGCGVDIIAEPGRYFVATAFTLASHVIAKRKL 340          

HSP 2 Score: 76.6406 bits (187), Expect = 2.998e-15
Identity = 38/102 (37.25%), Postives = 60/102 (58.82%), Query Frame = 3
Query: 1434 NDGVYNSFNCIVFDHAKPVPFGIFDN-EGYFREMACETEM------------YVSTIYGPTCDGFDCIMQQEPLPK-MEIGNWIVWPNMGAYTIAASSCFNG 1697
            NDGVY + NCI+FDH +P P  ++ N E ++ +    T +            Y  +I+GPTCDG DCI ++  +   + +G+W  +P +GAYT +A++ FNG
Sbjct:  350 NDGVYGNMNCILFDHQEPHPRTLYHNLEFHYDDFESTTAVLDSINKTRSEYPYKVSIWGPTCDGLDCIAKEYYMKHDVIVGDWFYFPALGAYTSSAATQFNG 451          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO44188 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWL7])

HSP 1 Score: 279.641 bits (714), Expect = 1.785e-87
Identity = 171/453 (37.75%), Postives = 233/453 (51.43%), Query Frame = 3
Query:  402 DAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSL--------DVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQE 1736
            D  FY ++L  +  +  +W  LLPRV+PF+A+KC  DP V+ LL  LG GFDCASK EI++++         +   I++ANP K    I YAS+  V   TFD E EL K+ + +P  QL+LR+ T  +  + C LG KFGA   +   LL+ A +L +NVVG+SFHVGSGC +  A+   VI    V  LA + GFN T+LDIGGGFPG      D    + FEE+CT +N +L+ +FP     RIIAEPGRY+   ++TL   V   R +        DVT P +N N                   QG M                                    Y +NDGVY SFNC++FDHA      + ++ G          +Y ++I+GPTCD  DCI +   LPK+E+G W+ +  MGAYT +A+S FNG       Y   +E
Sbjct:   37 DDAFYIVDLADVVLKHKKWVQLLPRVEPFYAMKCNNDPAVLKLLAGLGLGFDCASKGEIQTILGL-----GVSPKKIVYANPCKQASHIKYASQHDVAMTTFDNEMELHKIKKLYPDAQLILRIRTDDS-KSLCQLGIKFGAPLKQCRHLLKVAQDLGLNVVGVSFHVGSGCFDASAYATAVIAARSVFNLAVQFGFNCTLLDIGGGFPG------DPNAAITFEEICTTINPLLEEHFPPSSGVRIIAEPGRYYSSSSFTLAVNVYSRREVQSSSVLAEDVTAPENNGN-------------------QGFM------------------------------------YYVNDGVYGSFNCLIFDHATVEAIPVKESSG--------QPLYQTSIWGPTCDSMDCITKNMMLPKVEVGEWLFFKYMGAYTQSAASTFNGFKKPTKFYLCTEE 414          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO26406 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TC36])

HSP 1 Score: 181.8 bits (460), Expect = 9.429e-53
Identity = 94/226 (41.59%), Postives = 140/226 (61.95%), Query Frame = 3
Query:  408 PFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMC 1085
             FY  +LG I  + +RW   LPRV PF+AVKC     ++  L  LGAGFDCASK EI+ ++ ++   + +    II+ANP K    I YA+  GV  +TFD+E EL+K+++  P+ +LVLR++T  +  A C L  KFGA       LL+RA EL+++++G+SFHVGSGC +   + + V     V ++  ++GFN  +LDIGGGFPG   +      +++FEE+C
Sbjct:   39 AFYVADLGDIVKKHVRWFKALPRVTPFYAVKCNDSKAIVKTLSLLGAGFDCASKTEIQ-LVQSIGVSSER----IIYANPCKQVSQIKYAASCGVEKMTFDSEVELMKVARNHPNAKLVLRIATDDS-KAVCRLSVKFGATLKTSRLLLERAKELNVDIIGVSFHVGSGCTDPQTYVQAVSDARCVFDMGAELGFNMHLLDIGGGFPGSEDV------KLKFEEVC 252          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO28248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T706])

HSP 1 Score: 117.857 bits (294), Expect = 1.081e-30
Identity = 72/218 (33.03%), Postives = 105/218 (48.17%), Query Frame = 3
Query: 1080 MCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHA--KPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            + + +N  LD YFP +    IIAEPGRY+V  A+TL   +I  + +        VN  +   D  +A +                                         +K   Y +NDGVY SFNCI+FDHA  KPV           ++   +   Y S+I+GPTCDG D I+++  LP++++G+W+++ NMGAYT+AASS FNG      +Y M
Sbjct:    2 ITSVINPALDKYFPVDSGVTIIAEPGRYYVASAFTLAVNIIAKKVM--------VNEQSGSDDEEDAAN-----------------------------------------DKTLMYYVNDGVYGSFNCILFDHAHVKPV---------LTKKPKPDESFYSSSIWGPTCDGLDRIVERFDLPELQVGDWMLFENMGAYTVAASSTFNGFQRPTLYYVM 161          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO25932 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TDC0])

HSP 1 Score: 62.3882 bits (150), Expect = 2.851e-11
Identity = 49/189 (25.93%), Postives = 90/189 (47.62%), Query Frame = 3
Query:  489 FAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQE----WPSVQLVLRL-----STQRAYAATCVLGNKFGADADEVPFLLQRAMEL-SMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGF 1025
            +AVK   +  V+++L +LGAGFD  S  E++ V+   +         I+F+   K   +I  A   G+     ++E+EL +++Q       + ++  R+     +    Y +T +  NKFG    E   + Q A  L  ++VVG+  H+GS   E+  F + +     +++   ++G     LD+GGG 
Sbjct:    1 YAVKANSNLAVLNVLSRLGAGFDIVSVGELERVLRAGA-----KPERIVFSGVGKQPAEIRRALEVGILCFNVESEAELERVNQVAGECGKTAEISFRVNPDVDAGTHPYISTGLKENKFGIAIAEAKRIYQHAASLPHIHVVGMDCHIGSQLTELAPFMDALERLLGLIDELAEVGITIKHLDLGGGL 184          
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Match: EDO28678 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5T4])

HSP 1 Score: 56.9954 bits (136), Expect = 5.097e-9
Identity = 52/233 (22.32%), Postives = 100/233 (42.92%), Query Frame = 3
Query:  426 LGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQ-----RAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFP------GLSSINDDLAKQM--QFEEMC 1085
            + S +H+ +   S +  V+  +AVK   +  ++ L  +LGAG D  S+QE++     +      A  +IIF       ++I   ++ GV  +  D  S L    Q+ P + + +R++        +  +   + +KFG    +VP + +      M++ G+  H GS   ++D F         V      + F    +D G GF        +++  + L KQ+  +F + C
Sbjct:   25 ISSQYHRIIHAFSKVKSVKINYAVKALSNINILKLFHQLGAGLDTVSEQEVQ-----LGLTAGVAPENIIFTPNGVSLEEIEEVAKLGVQ-INIDNLSILELFGQKHPEIPVCIRINPHVMAGGNSKISVGHIDSKFGISIYQVPHIKRIVENTGMHINGIHMHTGSDILDIDTFIRATEILFNVASQFNTLDF----IDFGSGFKVPYKEGDIATDIEQLGKQLTKRFNQFC 247          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: odc1 (ornithine decarboxylase 1 [Source:NCBI gene;Acc:101170722])

HSP 1 Score: 270.396 bits (690), Expect = 5.102e-83
Identity = 163/440 (37.05%), Postives = 227/440 (51.59%), Query Frame = 3
Query:  411 FYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRS-LDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFM 1727
            FY  +LG +  + +RW   LPRV PF+AVKC     V+  L  LG GFDCASK EI+ ++ ++     +    II+ANP K    + YAS  GV  +TFD+E EL+K+++   + +LVLR++T  +  A C L  KFGA       LL+RA EL ++VVG+SFHVGSGC +   F + +     V ++  ++GF   +LDIGGGFPG          ++ FEE+   +N  LD YFP +   RIIAEPGR++V  AYTLV  +I  +  +D   PI   +N       Y   D V  S                               +N I+            Y+  +C    H KP P               +  MY  +I+GPTCDG D I++Q  LP M++G+W+V+ NMGAYT+AASS FNG    + HY M
Sbjct:   39 FYVCDLGDVLKKHLRWTRALPRVTPFYAVKCNDSRAVVMTLASLGTGFDCASKTEIQ-LVQSLGVHPNR----IIYANPCKQVSQMKYASAHGVEMMTFDSEVELMKVARYHDNAKLVLRIATDDS-KAVCRLSVKFGAPIKACRGLLERAKELGLDVVGVSFHVGSGCTDAGTFVKAIADARCVFDMGEELGFQMDLLDIGGGFPGSED------TELSFEEITATINPALDKYFPVDSGVRIIAEPGRFYVASAYTLVVNIIAKKVIIDEEAPIDEEDNKTLM---YYVNDGVYGS-------------------------------FNCIL------------YDHAHCYPVLHKKPKP---------------DETMYSCSIWGPTCDGLDRIVEQCCLPDMQVGDWLVFKNMGAYTVAASSTFNGFQRPDIHYVM 405          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: azin1b (antizyme inhibitor 1 [Source:NCBI gene;Acc:101162142])

HSP 1 Score: 185.267 bits (469), Expect = 1.469e-51
Identity = 124/480 (25.83%), Postives = 227/480 (47.29%), Query Frame = 3
Query:  330 IELVHFSSSMESNL--HIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMD-AFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETE-MYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDK 1757
            IEL+  S ++E  +  HI  Q +M   A F   +LG++  Q   W+S++PRV P++ VKC   P VI +L  LG GF CA+K E+  V+     +      +II ++ FK    I YA++  +  +  + E+EL K+++  PS +L+L+L+T+   A   +    FG        LL++A +L ++VVG +FH+ S C ++  A+   +     V ++   +GFN  ILDIGGGF G          + Q +++ + +N +LD YFP+    +++A+PG ++V  A++L   +IG                   K   ++++ +    +    E+L                                Y +N+GVY  F+  +  H    P          +   C  E +Y S+++GP+ D  D +++   LP++ + +W+++ NMG   +   +C +       +Y +   D  ++++
Sbjct:   12 IELLDGSVTLEDVIDGHICDQTVMEKSA-FVVGDLGALMQQHACWQSVVPRVLPYYPVKCNSSPVVIEVLASLGLGFVCANKAEVGLVL-----EHGVPPENIILSSGFKQLAHIKYAAKNNIQHLVCENEAELSKIARLHPSAKLLLQLTTESQAAENSM---AFGFSLKNCRHLLEKAKDLGIDVVGAAFHIPSSCEDLQPAYTHALSDARCVFDMGLDLGFNMHILDIGGGFTG---------SEFQLKQVESAINTLLDAYFPQLSGVQVLAQPGNFYVASAFSLAVNIIG------------------KKIKTQSWNCLSQGEKKEGTEFL--------------------------------YYMNEGVYGPFSHKLLGHPIAAP-------SLHKHAFCADEAVYPSSLWGPSLDQLDQVVEHCLLPELSVADWLIFSNMGTCGLEDLNCLSSSIDFPVYYIISTSDWYKMEE 416          
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Match: azin1a (antizyme inhibitor 1 [Source:NCBI gene;Acc:101166413])

HSP 1 Score: 158.688 bits (400), Expect = 8.820e-42
Identity = 89/277 (32.13%), Postives = 150/277 (54.15%), Query Frame = 3
Query:  378 IKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRA--YAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVI 1202
            I ++ ++    F+  +LG++  Q +RW++ +P ++P++AV+C   P VI LL  LG+GF C++K +++ V+         +   II++   K    I YA+  G++ +  D E+EL K+S+  P  +L+L++ST+ +     T V    FG    +   LLQRA EL + VVG+  ++ S C +   +   +     + +L  ++GFN  ILDIGGGF G          + Q + + + +  V+D YFP      +IAEPG +FV  A+TL   VI
Sbjct:   29 IDEQTVSEKNAFFVADLGAVMRQHVRWRTRMPLIRPYYAVRCNSSPAVIELLASLGSGFTCSNKSDLELVL-----SHGVSPEDIIYSGVCKQVSHIKYAATNGIDLLVCDNEAELRKISRCHPGAKLLLQVSTEASNPEEGTSV---TFGCSLKDSRCLLQRAKELGVQVVGVRSNISSSCEDDQVYLRAISDARCIYDLGAEMGFNVNILDIGGGFNG---------AEAQLDLIHSAVMSVVDLYFPSSSGVSLIAEPGSFFVSSAFTLAVSVI 288          

HSP 2 Score: 53.5286 bits (127), Expect = 4.647e-7
Identity = 28/111 (25.23%), Postives = 59/111 (53.15%), Query Frame = 3
Query: 1422 RYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFN-GIPMAETHYFMYQEDALEL 1751
            +YV+N+GVY SF+  + +     P G        ++   +  ++ S+++GP+ D  D +++   LP++ IG+W+V+ + GA+++      +   P     YF++  D  E+
Sbjct:  314 QYVLNEGVYGSFSSKLSE----TPIGA---PSVHKKTLVDAPLFSSSLWGPSGDDLDQVVEHCLLPELHIGDWLVFKHAGAFSLGQPLLASTDSPPPPIFYFIFSRDWFEM 417          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004848.1 (SMESG000004848.1)

HSP 1 Score: 1009.59 bits (2609), Expect = 0.000e+0
Identity = 502/514 (97.67%), Postives = 504/514 (98.05%), Query Frame = 3
Query:  288 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGIDSRQIIVEVI 1829
            MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLG LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYAS TGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSIN DLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPK    IEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIF NEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLS EVGKDQFN I+SRQIIVEV+
Sbjct:    1 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGILGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPKV--YIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSFEVGKDQFNEINSRQIIVEVV 512          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000015241.1 (SMESG000015241.1)

HSP 1 Score: 1007.28 bits (2603), Expect = 0.000e+0
Identity = 500/514 (97.28%), Postives = 503/514 (97.86%), Query Frame = 3
Query:  288 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGIDSRQIIVEVI 1829
            MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLG LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYAS TGVNTVTFDTESELVKLSQEWPSVQL+LRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSIN DLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPK    IEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIF NEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQF  I+S QIIVEV+
Sbjct:    1 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGILGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPKV--YIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFIEINSHQIIVEVV 512          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004820.1 (SMESG000004820.1)

HSP 1 Score: 1001.5 bits (2588), Expect = 0.000e+0
Identity = 497/514 (96.69%), Postives = 504/514 (98.05%), Query Frame = 3
Query:  288 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGIDSRQIIVEVI 1829
            MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQI+LGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLG LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYAS TGVNTVTFDTESELVKLSQEWPSVQL+LRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSIN DLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKP+    IEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIF NEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCE+GKDQFN I+S QIIV+V+
Sbjct:    1 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQIDLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGVLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINCDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPEL--YIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCELGKDQFNEINSCQIIVKVV 512          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004822.1 (SMESG000004822.1)

HSP 1 Score: 998.808 bits (2581), Expect = 0.000e+0
Identity = 496/514 (96.50%), Postives = 501/514 (97.47%), Query Frame = 3
Query:  288 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGIDSRQIIVEVI 1829
            MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQI+LGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLG LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYAS TGVNTVTFDTESELVKLSQEW SVQL+LRLSTQRAYAATCVLGNKFGADADEV FLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSIN DLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKP+    IEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIF NEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCE+GKDQFN I+S QIIVE I
Sbjct:    1 MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQIDLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGVLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWSSVQLILRLSTQRAYAATCVLGNKFGADADEVLFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINCDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPEL--YIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCELGKDQFNEINSHQIIVEAI 512          
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Match: SMESG000004806.1 (SMESG000004806.1)

HSP 1 Score: 972.615 bits (2513), Expect = 0.000e+0
Identity = 482/500 (96.40%), Postives = 487/500 (97.40%), Query Frame = 3
Query:  306 KTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLSQEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLXXXXXXXXXXXXXXRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQFNGIDS 1805
            + +ERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLG LGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYAS TGVNTVTFDTESELVKLSQEWPSVQL+LRLSTQRAYAATCVLGNKFGADADEVPFLLQRAM+LSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSIN DLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIAC KDNYE YDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKP+    IEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIF NEGYFREMACETEMYVSTI GPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALEL KVLSCEVGKDQFNGIDS
Sbjct:   17 RITERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSIFHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGVLGAGFDCASKQEIKSVIDTMSFDTTQAATSIIFANPFKFKKDILYASSTGVNTVTFDTESELVKLSQEWPSVQLILRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMDLSMNVVGLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLSSINGDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTLVTQVIGLRSLDVTNPISNVNNIACRKDNYEVYDNVETSSQGSMPEYLLDSMSDVSEISSSDSRKNSKPEV--YIEKGYRYVINDGVYNSFNCIVFDHAKPVPFGIFGNEGYFREMACETEMYVSTICGPTCDGFDCIMQQEPLPKMEIGNWIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELGKVLSCEVGKDQFNGIDS 514          
The following BLAST results are available for this feature:
BLAST of Ornithine decarboxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ODC11.176e-9035.97ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
ODC11.176e-9035.97ornithine decarboxylase 1 [Source:HGNC Symbol;Acc:... [more]
AZIN24.927e-7031.40antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN23.659e-6930.32antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN23.659e-6930.32antizyme inhibitor 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
odc-15.249e-8936.77Ornithine decarboxylase [Source:UniProtKB/Swiss-P... [more]
F53F10.21.204e-2123.85pep chromosome:WBcel235:I:3832239:3834124:1 gene:W... [more]
F53F10.21.204e-2123.85pep chromosome:WBcel235:I:3831117:3834124:1 gene:W... [more]
F53F10.21.204e-2123.85pep chromosome:WBcel235:I:3830562:3834120:1 gene:W... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Odc13.988e-5739.72gene:FBgn0013307 transcript:FBtr0088863[more]
Odc21.684e-4834.45gene:FBgn0013308 transcript:FBtr0088864[more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
odc15.543e-9537.59ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
odc15.543e-9537.59ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
odc15.543e-9537.59ornithine decarboxylase 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
azin1b4.424e-5627.41antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
azin1b4.424e-5627.41antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dym1.401e-9137.13dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
dym1.879e-9137.13dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
dym4.575e-9137.13dymeclin [Source:Xenbase;Acc:XB-GENE-5729291][more]
slc20a21.412e-8936.90solute carrier family 20 (phosphate transporter), ... [more]
cstf21.304e-7031.24cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Odc14.145e-9237.58ornithine decarboxylase, structural 1 [Source:MGI ... [more]
Azin24.385e-6730.77antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:24... [more]
Azin24.385e-6730.77antizyme inhibitor 2 [Source:MGI Symbol;Acc:MGI:24... [more]
Azin12.478e-5627.90antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:18... [more]
Azin12.478e-5627.90antizyme inhibitor 1 [Source:MGI Symbol;Acc:MGI:18... [more]
back to top
BLAST of Ornithine decarboxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9I8S4|AZIN2_XENLA6.240e-9237.36Antizyme inhibitor 2 OS=Xenopus laevis OX=8355 GN=... [more]
sp|P00860|DCOR_MOUSE2.900e-9137.58Ornithine decarboxylase OS=Mus musculus OX=10090 G... [more]
sp|P27117|DCOR_BOVIN3.396e-9036.45Ornithine decarboxylase OS=Bos taurus OX=9913 GN=O... [more]
sp|P11926|DCOR_HUMAN5.648e-9035.97Ornithine decarboxylase OS=Homo sapiens OX=9606 GN... [more]
sp|P27119|DCOR_MUSPA5.831e-9037.36Ornithine decarboxylase OS=Mus pahari OX=10093 GN=... [more]
back to top
BLAST of Ornithine decarboxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A507C4466.699e-9640.24Uncharacterized protein OS=Synchytrium microbalum ... [more]
A0A367IST77.167e-9639.59Uncharacterized protein OS=Rhizopus stolonifer OX=... [more]
A0A1X0RVE17.651e-9638.90Uncharacterized protein OS=Rhizopus microsporus OX... [more]
A0A433P9I81.718e-9538.89Ornithine decarboxylase OS=Endogone sp. FLAS-F5907... [more]
A0A0A1NSM01.721e-9537.74Putative ODC OS=Rhizopus microsporus OX=58291 GN=R... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
odc14.841e-9637.59ornithine decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
azin1b2.859e-5728.03antizyme inhibitor 1b [Source:ZFIN;Acc:ZDB-GENE-03... [more]
ENSAMXT00000043561.11.231e-5628.18antizyme inhibitor 1-like [Source:NCBI gene;Acc:11... [more]
azin11.098e-5428.66Astyanax mexicanus antizyme inhibitor 1 (azin1), m... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AZIN11.212e-9336.79antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN17.091e-9134.73antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN13.495e-8434.54antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
AZIN14.719e-8334.07antizyme inhibitor 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SPE11.613e-5037.99Ornithine decarboxylase; catalyzes the first step ... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO441881.785e-8737.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO264069.429e-5341.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO282481.081e-3033.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO259322.851e-1125.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286785.097e-922.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ornithine decarboxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
odc15.102e-8337.05ornithine decarboxylase 1 [Source:NCBI gene;Acc:10... [more]
azin1b1.469e-5125.83antizyme inhibitor 1 [Source:NCBI gene;Acc:1011621... [more]
azin1a8.820e-4232.13antizyme inhibitor 1 [Source:NCBI gene;Acc:1011664... [more]
back to top
BLAST of Ornithine decarboxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004848.10.000e+097.67SMESG000004848.1[more]
SMESG000015241.10.000e+097.28SMESG000015241.1[more]
SMESG000004820.10.000e+096.69SMESG000004820.1[more]
SMESG000004822.10.000e+096.50SMESG000004822.1[more]
SMESG000004806.10.000e+096.40SMESG000004806.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025830 ID=SMED30025830|Name=Ornithine decarboxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=2027bp
TTTTACAACATTAAAAATAGTGTTAGGTGAACATTTAAATTAGTGGTTAT
AATTTTCCTATTTGGAAATCTGTTTTAAGTCTTAAGTTGTCACCAATATT
AAAAGGCGATTGCAAGTACATTGAATTTTTTGACAAATTGAAAGTTTTGC
CATTGAAAATTTCATTGTTTAAGTTAGTTGCACCGTTAAATACTTTCAAC
TACAACAGAGAACCGCCTTGGGATCCTGATCCACTCTGCTGAAGACTTTC
ATCAACAATATTTTGGAGAATTCTAGACTAGCATACAATGCCTAAAGTTT
GTAATAAAACATCTGAGAGAATCAGTGATATTGAATTGGTCCATTTTTCA
TCATCAATGGAATCCAATTTGCACATCATTAAACAACGAATCATGAACTG
CGATGCTCCATTTTATCAAATTAATCTTGGTAGCATTTTTCATCAATTTA
TGCGATGGAAAAGCCTTTTACCTCGCGTCCAACCGTTTTTTGCTGTAAAA
TGCCAGCCTGATCCAAAAGTCATATCATTATTGGGAAAACTTGGCGCTGG
ATTTGATTGTGCCAGCAAGCAAGAAATCAAATCAGTTATTGATACGATGT
CCTTTGATACTACTCAAGCCGCTACAAGCATCATATTCGCTAATCCTTTT
AAATTCAAAAAGGATATCTTATATGCCAGCCGTACTGGAGTCAACACTGT
AACATTCGATACCGAAAGTGAACTTGTGAAACTATCTCAAGAATGGCCAA
GCGTTCAATTAGTTTTGCGCTTGTCTACTCAAAGAGCTTATGCTGCCACT
TGTGTTCTTGGCAACAAATTCGGTGCTGATGCTGATGAAGTGCCATTCCT
TCTTCAACGAGCAATGGAATTATCAATGAATGTTGTTGGATTGAGTTTTC
ATGTTGGAAGCGGTTGCAATGAAATGGATGCGTTCCCAGAAACTGTCATT
TATTGTTCTCAAGTGATGGAATTAGCTCGGAAGATTGGCTTCAATCCTAC
AATTCTCGATATCGGAGGTGGATTTCCCGGGCTGAGCAGTATTAACGATG
ATCTGGCTAAACAAATGCAATTTGAAGAAATGTGCACCAAGCTCAATCAT
GTTCTCGATACTTATTTTCCAGAGGAGGACAATTATCGTATAATTGCTGA
ACCGGGCCGATACTTCGTTTACGGAGCTTACACGCTTGTCACTCAAGTAA
TTGGCCTACGTAGTCTCGATGTGACTAATCCGATCTCGAACGTGAATAAT
ATTGCGTGCCATAAAGATAATTACGAAGCATATGATAATGTAGAAACTTC
GAGCCAAGGATCAATGCCAGAATATTTATTAGATAGCATGAGCGACGTCT
CGGAAATTTCCAGCAGCGACTCGCGTAAAAACAGCAAGCCTAAGTACAAT
CAAATCATCGAAAAAGGCTACCGCTATGTTATCAATGATGGTGTTTATAA
TTCATTTAATTGTATTGTTTTCGATCATGCCAAACCAGTCCCTTTTGGAA
TTTTCGATAATGAAGGATATTTTAGAGAGATGGCTTGTGAAACTGAAATG
TACGTATCAACTATTTACGGGCCGACTTGTGATGGTTTCGACTGCATAAT
GCAACAAGAGCCCTTACCAAAAATGGAGATTGGAAATTGGATTGTATGGC
CAAACATGGGAGCCTATACAATTGCCGCCAGTAGCTGTTTCAATGGAATC
CCGATGGCAGAAACTCATTACTTTATGTATCAAGAAGACGCGTTGGAATT
GGACAAAGTTTTATCTTGTGAAGTAGGCAAGGATCAATTTAATGGAATTG
ATTCTCGTCAGATTATTGTGGAGGTCATTTAAATATTTTTAAACTGCTTT
TTGTAGTGTTAATAGAAAATTAGCTTCCGTATGTTTGTCTAGAATTCTCC
GTATTAATTAATAATTATGCTATATGATTATTAACAATCAATTGATAATT
TGTCTTTAACATTGTTGATGTTTTCATTCTTGTTTTAATGTTGTAGAGAC
AATAAATGATTTAATTTTCAAAAAAAA
back to top

protein sequence of SMED30025830-orf-1

>SMED30025830-orf-1 ID=SMED30025830-orf-1|Name=SMED30025830-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=515bp
MPKVCNKTSERISDIELVHFSSSMESNLHIIKQRIMNCDAPFYQINLGSI
FHQFMRWKSLLPRVQPFFAVKCQPDPKVISLLGKLGAGFDCASKQEIKSV
IDTMSFDTTQAATSIIFANPFKFKKDILYASRTGVNTVTFDTESELVKLS
QEWPSVQLVLRLSTQRAYAATCVLGNKFGADADEVPFLLQRAMELSMNVV
GLSFHVGSGCNEMDAFPETVIYCSQVMELARKIGFNPTILDIGGGFPGLS
SINDDLAKQMQFEEMCTKLNHVLDTYFPEEDNYRIIAEPGRYFVYGAYTL
VTQVIGLRSLDVTNPISNVNNIACHKDNYEAYDNVETSSQGSMPEYLLDS
MSDVSEISSSDSRKNSKPKYNQIIEKGYRYVINDGVYNSFNCIVFDHAKP
VPFGIFDNEGYFREMACETEMYVSTIYGPTCDGFDCIMQQEPLPKMEIGN
WIVWPNMGAYTIAASSCFNGIPMAETHYFMYQEDALELDKVLSCEVGKDQ
FNGIDSRQIIVEVI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002433Orn_de-COase
IPR000183Orn/DAP/Arg_de-COase
IPR029066PLP-binding_barrel
IPR009006Ala_racemase/Decarboxylase_C
IPR022643De-COase2_C
IPR022644De-COase2_N
IPR022657De-COase2_CS
Vocabulary: biological process
TermDefinition
GO:0006596polyamine biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002433Ornithine decarboxylasePRINTSPR01182ORNDCRBXLASEcoord: 66..93
score: 55.36
coord: 40..64
score: 34.93
coord: 145..167
score: 31.01
coord: 443..456
score: 37.62
coord: 423..433
score: 65.15
coord: 382..395
score: 66.67
IPR002433Ornithine decarboxylasePANTHERPTHR11482ARGININE/DIAMINOPIMELATE/ORNITHINE DECARBOXYLASEcoord: 13..484
IPR000183Ornithine/DAP/Arg decarboxylasePRINTSPR01179ODADCRBXLASEcoord: 196..209
score: 50.22
coord: 456..469
score: 50.45
coord: 88..100
score: 51.08
coord: 285..304
score: 46.48
coord: 68..86
score: 37.25
IPR022643Orn/DAP/Arg decarboxylase 2, C-terminalPFAMPF00278Orn_DAP_Arg_deCcoord: 364..456
e-value: 6.3E-12
score: 45.6
IPR022644Orn/DAP/Arg decarboxylase 2, N-terminalPFAMPF02784Orn_Arg_deC_Ncoord: 48..294
e-value: 2.5E-64
score: 217.0
NoneNo IPR availablePANTHERPTHR11482:SF6ORNITHINE DECARBOXYLASE 1-RELATEDcoord: 13..484
NoneNo IPR availableCDDcd00622PLPDE_III_ODCcoord: 39..477
e-value: 1.89739E-146
score: 422.288
IPR009006Alanine racemase/group IV decarboxylase, C-terminalSUPERFAMILYSSF50621Alanine racemase C-terminal domain-likecoord: 274..478
IPR029066PLP-binding barrelSUPERFAMILYSSF51419PLP-binding barrelcoord: 40..296