CEP76

Overview
NameCEP76 (AFB74716.1)
Smed IDSMED30025823
Length (bp)2168
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CEP76 (SMED30025823) t-SNE clustered cells

Violin plots show distribution of expression levels for CEP76 (SMED30025823) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CEP76 (SMED30025823) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CEP76 (SMED30025823) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025823

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025823SMESG000002127.1 SmedASXL_002647SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30025823SMESG000002127.1 dd_Smed_v6_9101_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30025823SMESG000002127.1 dd_Smed_v4_9101_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30025823SMESG000002127.1 dd_Smed_v4_9101_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CEP76 vs. Ensembl Human
Match: CEP76 (centrosomal protein 76 [Source:HGNC Symbol;Acc:HGNC:25727])

HSP 1 Score: 405.216 bits (1040), Expect = 2.108e-131
Identity = 249/654 (38.07%), Postives = 365/654 (55.81%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRT-----KIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L   T     ++ +   Q +  DR         + P    +++ + V+ G  F +HL                  P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG          PH+WV+T   +      FWE+ TG ++  +      PP   + +    Y TIGC+FNH  F  N   + ++ETC+FDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R   LG  +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIKALRRRGIIDDVMKELNFVTDSVEQELPSSPKQPICFDRQS-TLKKTNIDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPPLNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGV----PHAWVMTCGTD--GAITFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRKD-LG--LTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 656          
BLAST of CEP76 vs. Ensembl Human
Match: CEP76 (centrosomal protein 76 [Source:HGNC Symbol;Acc:HGNC:25727])

HSP 1 Score: 386.726 bits (992), Expect = 2.661e-125
Identity = 228/547 (41.68%), Postives = 322/547 (58.87%), Query Frame = 2
Query:  512 QFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            Q   S  KQ IC            ++Q  +K +DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG          PH+WV+T   +      FWE+ TG ++  +      PP   + +    Y TIGC+FNH  F  N   + ++ETC+FDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R   LG  +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   78 QELPSSPKQPIC-----------FDRQSTLKKSDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPPLNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGV----PHAWVMTCGTD--GAITFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRK-DLG--LTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 581          
BLAST of CEP76 vs. Ensembl Human
Match: CEP76 (centrosomal protein 76 [Source:HGNC Symbol;Acc:HGNC:25727])

HSP 1 Score: 124.02 bits (310), Expect = 4.575e-32
Identity = 67/164 (40.85%), Postives = 95/164 (57.93%), Query Frame = 2
Query: 1031 QDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFA 1510
            QDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG          PH+WV+T   +      FWE+ TG ++  +      PP   + +    Y TIGC+FNH  F  
Sbjct:   22 QDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGV----PHAWVMTCGTD--GAITFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLG 178          
BLAST of CEP76 vs. Ensembl Human
Match: CEP76 (centrosomal protein 76 [Source:HGNC Symbol;Acc:HGNC:25727])

HSP 1 Score: 120.553 bits (301), Expect = 1.091e-30
Identity = 76/188 (40.43%), Postives = 111/188 (59.04%), Query Frame = 2
Query:  488 PNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQ 1033
            P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQ
Sbjct:    4 PGQVCSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPPLNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQ 186          
BLAST of CEP76 vs. Ensembl Human
Match: CEP76 (centrosomal protein 76 [Source:HGNC Symbol;Acc:HGNC:25727])

HSP 1 Score: 75.485 bits (184), Expect = 5.732e-16
Identity = 45/100 (45.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  737 WRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQ 1033
            WR VL SE+  T + ++L G   ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQ
Sbjct:    2 WRSVLGSENGVTSLTVELMGT--ESKVSVGILNIKLEMYPPLNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQ 96          
BLAST of CEP76 vs. Ensembl Zebrafish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:564926])

HSP 1 Score: 379.022 bits (972), Expect = 1.876e-121
Identity = 220/559 (39.36%), Postives = 321/559 (57.42%), Query Frame = 2
Query:  488 PNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTS----VSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            P ++   F   + ++ QR  SK IPC  +P I + F +++    P + S     +T+L + +P+H+VLIK D  + +  LVSS  ++WR VL + +    ++ +L GV  E+KV  G + + L+L P     L  + DV   Q  +E     +EKER FLVYAKQWWQEF         + VKIFAQDENG+NR VC YV  +RAGR+L+SP QAARFV+ ++ + +  +G      + W S + FL  N+G+ ++H+ LLCSLLLGFG++AYV VG    +     PH+WV+T   +      FWE+ T  ++  R     +P    + +    Y T+GC+FNH  F AN   + ++E C+FD  + +RWK MSEE +  V D  +           N S     PL  S LV + +     SN LE ++R L+S  R   LG  + + WDD L Y+L  AL +YELE+  G+S  GN+EF+ +++R V DG+TFKAFP++ LH NAR    T L+SP  +EI+ CRG  V LA+RV+VF Y E +   W++F C Y+
Sbjct:  132 PGQVCSTFTLHVHFRNQRFRSKPIPCACEPDIQEGFLLEIHRDGPGDASKMADATTMLSICDPVHMVLIKTD-TSGDTTLVSSYFLDWRTVLSAPNGKISVSAELLGVGAEAKVPAGVLNLKLELYPPLTETL--SPDVVTMQKSLER-QKTAEKERLFLVYAKQWWQEFLDIRPSNKSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESPRQAARFVSLLAQERAPVVGGGVR-QEQWASMMVFLCRNKGDCEDHATLLCSLLLGFGLDAYVCVGTKVKNI----PHTWVMTCGTD--GSITFWESFTAHRYLHRPIDPDAPSMILQPKPVHPYQTLGCVFNHKIFLANCQVSDAVERCVFDFTDGSRWKAMSEEAVRSVCDPGF-----------NASLPPTPPLCSSSLVPNEA-----SNQLELEMRYLLSEHRK-DLG--LATVWDDHLSYLLSAALSAYELERCAGVS-YGNEEFQDAVRRAVPDGHTFKAFPINFLHCNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFGYPESACAVWIMFACKYR 659          
BLAST of CEP76 vs. Ensembl Zebrafish
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 74.7146 bits (182), Expect = 2.816e-13
Identity = 99/444 (22.30%), Postives = 177/444 (39.86%), Query Frame = 2
Query:  830 IEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRIL---------DSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFS-FRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCF 2131
            I +  QLVP         ++ F++Q  +E V   SE      V+ K+  + F       +RP      D NG   FV  ++ P+   + L         DS    AR+V+ I +   S   +     D+W +   FL    G+ + H+VLLC+  L  G  A++ +G        + P ++V+T+++   ++ + W ASTG+ +  +  F        C ++  TIGC+ N    + N     +     FD++  N WK              +F +A    G +++  +  +     R  A     +++ + +E  LR  +  WR         ++W+      L Q L   E   L+G   V  +E +  +Q  + + Y    FP+H+     R I++    + + +        +V  AL V V  Y  +    WV     
Sbjct: 1297 ITIEPQLVPG-----DTVREKFDSQ-EVERVLLASE------VFEKEASRRFS------DRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSLIPSLPDSVSFAGVC--DLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGKRAWLIIGSA----IPEGPTAYVLTYEQ---SRYVIWNASTGQHYGQYDVF--------CPLQ--TIGCLINADNVWFNIQPYAAPVRMSFDISKPNLWK-------------PFFSRAFPDPGLSSVQPDALVYRRTDRTAA-----VELQDRIEKVLREKLMEWRPRH-----PTRWNRYCISTLRQFLPKLE---LSGGREVA-EEHRLELQSLLGE-YRISGFPLHLPFSELRPIIEAVHSTGVHK----VESPNVEFALAVYVHPYPSNVLSVWVYIASL 1671          
BLAST of CEP76 vs. Ensembl Zebrafish
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 74.7146 bits (182), Expect = 2.953e-13
Identity = 99/444 (22.30%), Postives = 177/444 (39.86%), Query Frame = 2
Query:  830 IEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRIL---------DSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFS-FRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCF 2131
            I +  QLVP         ++ F++Q  +E V   SE      V+ K+  + F       +RP      D NG   FV  ++ P+   + L         DS    AR+V+ I +   S   +     D+W +   FL    G+ + H+VLLC+  L  G  A++ +G        + P ++V+T+++   ++ + W ASTG+ +  +  F        C ++  TIGC+ N    + N     +     FD++  N WK              +F +A    G +++  +  +     R  A     +++ + +E  LR  +  WR         ++W+      L Q L   E   L+G   V  +E +  +Q  + + Y    FP+H+     R I++    + + +        +V  AL V V  Y  +    WV     
Sbjct: 1269 ITIEPQLVPG-----DTVREKFDSQ-EVERVLLASE------VFEKEASRRFS------DRPCITTVIDINGKTVFVTRFIRPLNPPQELLDASPNGTQDSTELVARYVSLIPSLPDSVSFAGVC--DLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGKRAWLIIGSA----IPEGPTAYVLTYEQ---SRYVIWNASTGQHYGQYDVF--------CPLQ--TIGCLINADNVWFNIQPYAAPVRMSFDISKPNLWK-------------PFFSRAFPDPGLSSVQPDALVYRRTDRTAA-----VELQDRIEKVLREKLMEWRPRH-----PTRWNRYCISTLRQFLPKLE---LSGGREVA-EEHRLELQSLLGE-YRISGFPLHLPFSELRPIIEAVHSTGVHK----VESPNVEFALAVYVHPYPSNVLSVWVYIASL 1643          
BLAST of CEP76 vs. Ensembl Xenopus
Match: cep76 (centrosomal protein 76kDa [Source:NCBI gene;Acc:549585])

HSP 1 Score: 394.43 bits (1012), Expect = 1.189e-127
Identity = 248/664 (37.35%), Postives = 356/664 (53.61%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQ---------------FIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G+VD ++  L            H +     +  T        PGQ               ++ + V+ G  F +HL        +D        P +    F   L ++ QR  SK +PC  +P     F ++     L DG       +T+L + +P+ LVL+K D  + E  LVSS  +EWR VL +E  +T + ++L GV  E KV+VG + V L+L P  ++ L  +Q+V N Q  +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDEN +NR VC Y+ P+RAGR+LD+P QAARFV ++     +         + W + LAFL  N+G+ ++H  LLCSLLLGFG++AYV VG       GQ  H+WV+T   +      FWE+ TG ++  +      PP          Y TIGC+FNH +F AN+    ++E C+FDL++ +RWK MSEE I          K++   G+   S     PL  S L A+T      SN++E QLR LV   R       +T+ WDDQL Y+L  AL SYE+E+ TG+S  GN+EF+  I+R V DG+TFK FP+H +H NAR    T L+SP   EII+CRG  + LA+RV+V++Y E +   W++F C Y+
Sbjct:   29 EDLMKALRQRGIVDEVMKEL------------HFMEVNMEIQITERHFMKKSPGQKYFVFFPANVDPTRRYLHLQVLSGKAFLEHL------QESDPL------PGQACSTFTLCLHFRNQRFRSKPVPCACEPDFQDGFLLEVHKDSLGDGS-RMADATTMLSICDPVQLVLLKTD-TSGETSLVSSHFLEWRSVLGTEKGATSLVVELLGVGAECKVSVGILNVKLELYPLLNKTL--SQEVINTQFTLER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENWVNRPVCSYIRPLRAGRLLDTPRQAARFV-NVLGYERAPTVGGGGKQEQWCTLLAFLCRNKGDCEDHCNLLCSLLLGFGLDAYVCVGT---KGRGQ-AHTWVMTCGTD--GAITFWESLTGHRYVHKPINPDDPPMVEQPKPLYPYKTIGCVFNHKRFLANSQPLDAVEVCVFDLHDESRWKPMSEEAI----------KSVCSPGSI-ASLPPFPPLCGSLLDAATE-----SNEIELQLRVLVLEHRK---DLGLTTVWDDQLSYLLSPALASYEIERTTGIS-AGNEEFQDCIRRAVPDGHTFKGFPIHFVHRNARRAFATCLRSPFCDEIISCRGDQMRLAVRVRVYTYPEAACAVWIMFACKYR 636          
BLAST of CEP76 vs. Ensembl Xenopus
Match: cep76 (centrosomal protein 76kDa [Source:NCBI gene;Acc:549585])

HSP 1 Score: 394.43 bits (1012), Expect = 2.238e-127
Identity = 250/669 (37.37%), Postives = 359/669 (53.66%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPG--------------------QFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G+VD ++  L            H + DR     T E  + P P                     +++ + V+ G  F +HL        +D        P +    F   L ++ QR  SK +PC  +P     F ++     L DG       +T+L + +P+ LVL+K D  + E  LVSS  +EWR VL +E  +T + ++L GV  E KV+VG + V L+L P  ++ L  +Q+V N Q  +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDEN +NR VC Y+ P+RAGR+LD+P QAARFV ++     +         + W + LAFL  N+G+ ++H  LLCSLLLGFG++AYV VG       GQ  H+WV+T   +      FWE+ TG ++  +      PP          Y TIGC+FNH +F AN+    ++E C+FDL++ +RWK MSEE I          K++   G+   S     PL  S L A+T      SN++E QLR LV   R       +T+ WDDQL Y+L  AL SYE+E+ TG+S  GN+EF+  I+R V DG+TFK FP+H +H NAR    T L+SP   EII+CRG  + LA+RV+V++Y E +   W++F C Y+
Sbjct:   50 EDLMKALRQRGIVDEVMKEL------------HFMEDRN----TRELTSTPKPATHFIDKEPRTLKKTNVDPTRRYLHLQVLSGKAFLEHL------QESDPL------PGQACSTFTLCLHFRNQRFRSKPVPCACEPDFQDGFLLEVHKDSLGDGS-RMADATTMLSICDPVQLVLLKTD-TSGETSLVSSHFLEWRSVLGTEKGATSLVVELLGVGAECKVSVGILNVKLELYPLLNKTL--SQEVINTQFTLER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENWVNRPVCSYIRPLRAGRLLDTPRQAARFV-NVLGYERAPTVGGGGKQEQWCTLLAFLCRNKGDCEDHCNLLCSLLLGFGLDAYVCVGT---KGRGQ-AHTWVMTCGTD--GAITFWESLTGHRYVHKPINPDDPPMVEQPKPLYPYKTIGCVFNHKRFLANSQPLDAVEVCVFDLHDESRWKPMSEEAI----------KSVCSPGSI-ASLPPFPPLCGSLLDAATE-----SNEIELQLRVLVLEHRK---DLGLTTVWDDQLSYLLSPALASYEIERTTGIS-AGNEEFQDCIRRAVPDGHTFKGFPIHFVHRNARRAFATCLRSPFCDEIISCRGDQMRLAVRVRVYTYPEAACAVWIMFACKYR 658          
BLAST of CEP76 vs. Ensembl Xenopus
Match: cep76 (centrosomal protein 76kDa [Source:NCBI gene;Acc:549585])

HSP 1 Score: 348.206 bits (892), Expect = 7.968e-110
Identity = 231/627 (36.84%), Postives = 330/627 (52.63%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPG--------------------QFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALK 2011
            E ++ +LR  G+VD ++  L            H + DR     T E  + P P                     +++ + V+ G  F +HL        +D        P +    F   L ++ QR  SK +PC  +P     F ++     L DG       +T+L + +P+ LVL+K D  + E  LVSS  +EWR VL +E  +T + ++L GV  E KV+VG + V L+L P  ++ L  +Q+V N Q  +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDEN +NR VC Y+ P+RAGR+LD+P QAARFV ++     +         + W + LAFL  N+G+ ++H  LLCSLLLGFG++AYV VG       GQ  H+WV+T   +      FWE+ TG ++  +      PP          Y TIGC+FNH +F AN+    ++E C+FDL++ +RWK MSEE I          K++   G +  S     PL  S L A+T      SN++E QLR LV   R       +T+ WDDQL Y+L  AL SYE+E+ TG+S  GN+EF+  I+R V DG+TFK FP+H +H NAR    T L+
Sbjct:   50 EDLMKALRQRGIVDEVMKEL------------HFMEDRN----TRELTSTPKPATHFIDKEPRTLKKTNVDPTRRYLHLQVLSGKAFLEHL------QESDPL------PGQACSTFTLCLHFRNQRFRSKPVPCACEPDFQDGFLLEVHKDSLGDGS-RMADATTMLSICDPVQLVLLKTD-TSGETSLVSSHFLEWRSVLGTEKGATSLVVELLGVGAECKVSVGILNVKLELYPLLNKTL--SQEVINTQFTLER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENWVNRPVCSYIRPLRAGRLLDTPRQAARFV-NVLGYERAPTVGGGGKQEQWCTLLAFLCRNKGDCEDHCNLLCSLLLGFGLDAYVCVGT---KGRGQA-HTWVMTCGTD--GAITFWESLTGHRYVHKPINPDDPPMVEQPKPLYPYKTIGCVFNHKRFLANSQPLDAVEVCVFDLHDESRWKPMSEEAI----------KSVCSPG-SIASLPPFPPLCGSLLDAATE-----SNEIELQLRVLVLEHRK---DLGLTTVWDDQLSYLLSPALASYEIERTTGIS-AGNEEFQDCIRRAVPDGHTFKGFPIHFVHRNARRAFATCLR 616          
BLAST of CEP76 vs. Ensembl Xenopus
Match: dhcr7 (7-dehydrocholesterol reductase [Source:Xenbase;Acc:XB-GENE-920362])

HSP 1 Score: 77.0258 bits (188), Expect = 9.603e-14
Identity = 105/479 (21.92%), Postives = 201/479 (41.96%), Query Frame = 2
Query:  728 VIEWRMVLCSESWSTRINMDLQGVFDESK-VNVGS-----IEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGR-ILDSP---AQAARFVAXXXXXXXXXXXXNTAAHDI---WKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGND---EFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWV 2116
            +IE   VL    +S + +  ++G +D ++ ++ GS     I +  QLVP      P+ + + +  L    V++ S ++ K L  A+++  E   ++    R       D NG   FV  Y+ P+   + +LD+     QAA  + +    L   +  N +   I   W +   FL    G+ + H+VLLC+  L  G  A++ +G    +   + P ++V+T ++   N+ I W  STG     R +  Y   + C ++  ++GC+ N    + N  +  +  +  FD +  N WK              +F ++    G +++     +   + +  A+     ++ + +E  L+  +  WR         ++W+      L   L   EL       N G D   + ++ +QR + D Y F  FP+H+     R +++    +     + N    +V  AL V V  Y ++    WV
Sbjct:  967 LIETPPVLLG--YSKQRSAGIEGGYDATRGLSQGSFLTLFITIEPQLVPGE----PVREKLHSDSL----VSFESREDEKLLQAAEKYQSEGVQKY--PNRQCLTTVTDINGTTVFVTRYIKPLNPPQELLDAHPNNTQAASELVAHYVSLIPFLPDNVSFAGICNLWSTADQFLDLLAGDEEEHAVLLCNYFLAMGKKAWLLIG----NAVPEGPTTYVLTLEQ---NQYIIWNPSTG-----RFYGQYD--TFCPLQ--SVGCLINADNIWFNTQQYDAPVSMTFDTSRTNMWK-------------PFFSRSYPHPGLSSVQPEELMYQRIDKAAAA-----ELQDRIEKILKEKIMEWRPRH-----PTRWNRFCTSTLRHFLPLLEL-------NRGRDVEEDHRAELQRQLGD-YRFSGFPIHMAFSEVRPLIEAVYST----GVQNSEVPNVEFALAVYVHPYPKNIYSVWV 1382          
BLAST of CEP76 vs. Ensembl Xenopus
Match: dhcr7 (7-dehydrocholesterol reductase [Source:Xenbase;Acc:XB-GENE-920362])

HSP 1 Score: 72.0182 bits (175), Expect = 2.963e-12
Identity = 88/407 (21.62%), Postives = 167/407 (41.03%), Query Frame = 2
Query:  926 YGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGR-ILDSP---AQAARFVAXXXXXXXXXXXXNTAAHDI---WKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGND---EFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWV 2116
            + S ++ K L  A+++  E   ++    R       D NG   FV  Y+ P+   + +LD+     QAA  + +    L   +  N +   I   W +   FL    G+ + H+VLLC+  L  G  A++ +G    +   + P ++V+T ++   N+ I W  STG     R +  Y   + C ++  ++GC+ N    + N  +  +  +  FD +  N WK              +F ++    G +++     +   + +  A+     ++ + +E  L+  +  WR         ++W+      L   L   EL       N G D   + ++ +QR + D Y F  FP+H+     R +++    +     + N    +V  AL V V  Y ++    WV
Sbjct: 1010 FESREDEKLLQAAEKYQSEGVQKY--PNRQCLTTVTDINGTTVFVTRYIKPLNPPQELLDAHPNNTQAASELVAHYVSLIPFLPDNVSFAGICNLWSTADQFLDLLAGDEEEHAVLLCNYFLAMGKKAWLLIG----NAVPEGPTTYVLTLEQ---NQYIIWNPSTG-----RFYGQYD--TFCPLQ--SVGCLINADNIWFNTQQYDAPVSMTFDTSRTNMWK-------------PFFSRSYPHPGLSSVQPEELMYQRIDKAAAA-----ELQDRIEKILKEKIMEWRPRH-----PTRWNRFCTSTLRHFLPLLEL-------NRGRDVEEDHRAELQRQLGD-YRFSGFPIHMAFSEVRPLIEAVYST----GVQNSEVPNVEFALAVYVHPYPKNIYSVWV 1363          
BLAST of CEP76 vs. Ensembl Mouse
Match: Cep76 (centrosomal protein 76 [Source:MGI Symbol;Acc:MGI:1923401])

HSP 1 Score: 404.831 bits (1039), Expect = 2.173e-131
Identity = 247/653 (37.83%), Postives = 360/653 (55.13%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQ----SSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L   T   +Q    S +  +            + P    +++ + V+ G  F +HL                  P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P   + L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG      +   PH+WV+T   +     +FWE+ TG ++  +      PP          Y TIGC+FNH  F  N   + ++ETCIFDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R       +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIKALRRRGIIDDVMKELNFVTDSVDQELPSSPKQTVGFDKQSTLKKTNVDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQICSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTNLTVELMGVGTESKVSVGILNIKLEMYPPLSQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTK----AKGAPHAWVMTCGTD--GTIMFWESLTGHRYIHKPTNPDGPPLAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCIFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRK---DLGLTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 656          
BLAST of CEP76 vs. Ensembl Mouse
Match: Cc2d2a (coiled-coil and C2 domain containing 2A [Source:MGI Symbol;Acc:MGI:1924487])

HSP 1 Score: 55.8398 bits (133), Expect = 2.108e-7
Identity = 73/369 (19.78%), Postives = 147/369 (39.84%), Query Frame = 2
Query: 1034 DENGLNRFVCDYVSPVRAGRIL-----DSPAQAARFVAXXXXXXXXXXXXNTAAH--DIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFS-FRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWV 2116
            D  G   F+  Y+ P+   + L     ++P   A  VA   + +     S + A   D+W +   FL    G+ + H+VLLC+  L  G  A++ +G        + P ++V+T+++   N  + W   +G  +  F AF        C ++  ++GC+      + N     S     FD+     WK              +F +++   G +++     I     + VA+     ++ + +E  L+  +  WR   L     ++W+      L   L   E  Q   +     D+ ++ + + + D Y F  FP+H+ +   + +++    + +     N    +V  AL V +  Y ++    W+
Sbjct: 1305 DMTGKTVFITRYLKPLNPPQELLHVYPNNPQATAELVARYVSLIPFLPDSVSFAGVCDLWSTSDQFLDLLAGDEEEHAVLLCNYFLFLGKKAWLVMGSA----IPEGPTAYVLTWEK---NYYLIWNPCSGHCYGQFDAF--------CPLK--SVGCLIGPDNIWFNIQHHDSPLRINFDVTKPKLWK-------------SFFSRSLPYPGLSSVQPEELIYQHTDKAVAA-----ELQDRIEKILKEKIMDWRPRHL-----TRWNRYCTSTLRHFLPLLERSQGEDI----EDDHRAELLKQLGD-YRFSGFPLHMPYSEVKPLVEAVYSTGVH----NIDLPNVEFALAVYIHPYPKNVLSVWI 1624          
BLAST of CEP76 vs. Ensembl Mouse
Match: Cc2d2b (coiled-coil and C2 domain containing 2B [Source:MGI Symbol;Acc:MGI:3645359])

HSP 1 Score: 51.6026 bits (122), Expect = 3.709e-6
Identity = 62/314 (19.75%), Postives = 114/314 (36.31%), Query Frame = 2
Query: 1184 DIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFG 2125
            DIW +    +    GN + H++LLC+  L FG  A V +G      S    H   V  QE   ++ + W  STG+    + F  + P         ++ C+FN    + N  +  +     FD +  + WK++               K + G    ++      P  +     + S V  + + +E  L+  +  WR         ++W+ Q   +L Q L   E    +  S      F+ S    +   Y    FP+ + + + + ++D   ++ +              AL V +  Y  +    WV   
Sbjct: 1135 DIWMTSECCISLAIGNKEEHAILLCNFFLYFGKKALVTLGT-----SVLEGHVAYVLTQET--DECLLWNPSTGQ--CHKQFDPFCP-------LQSVDCLFNDKNVWFNIQQNNTPMAVQFDYSKESFWKQL-------------LPKNVQGTKAQSVQ-----PEEIVYSDTNKSMVEDLKSRIERALKCKMMEWRPKH-----PTRWNRQCTSVLRQILPKLEFYPGSFAS------FEDSDLERLLQFYWVTGFPIQMPYTDVQAVIDAVYQTGLHAS----EFPQTEFALAVYIHPYPNNILSVWVYLA 1399          
BLAST of CEP76 vs. UniProt/SwissProt
Match: sp|Q5RCP7|CEP76_PONAB (Centrosomal protein of 76 kDa OS=Pongo abelii OX=9601 GN=CEP76 PE=2 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 9.321e-131
Identity = 249/654 (38.07%), Postives = 365/654 (55.81%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRT-----KIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L   T     ++ +   Q +  DR         + P    +++ + V+ G  F +HL                  P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG          PH+WV+T   +      FWE+ TG ++  +      PP   + +    Y TIGC+FNH  F  N   + ++ETC+FDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R   LG  +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   49 EDLIKALRRRGIIDDVMKELNFVTDSVERELPSSPKQPICFDRQS-TLKKTNIDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPPLNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGVNRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGV----PHAWVMTCGTD--GTTTFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRKD-LG--LTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 655          
BLAST of CEP76 vs. UniProt/SwissProt
Match: sp|Q8TAP6|CEP76_HUMAN (Centrosomal protein of 76 kDa OS=Homo sapiens OX=9606 GN=CEP76 PE=1 SV=1)

HSP 1 Score: 405.216 bits (1040), Expect = 1.012e-130
Identity = 249/654 (38.07%), Postives = 365/654 (55.81%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRT-----KIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L   T     ++ +   Q +  DR         + P    +++ + V+ G  F +HL                  P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG          PH+WV+T   +      FWE+ TG ++  +      PP   + +    Y TIGC+FNH  F  N   + ++ETC+FDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R   LG  +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIKALRRRGIIDDVMKELNFVTDSVEQELPSSPKQPICFDRQS-TLKKTNIDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPPLNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGV----PHAWVMTCGTD--GAITFWESLTGHRYIHKPTNPDEPPVAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRKD-LG--LTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 656          
BLAST of CEP76 vs. UniProt/SwissProt
Match: sp|Q0VEJ0|CEP76_MOUSE (Centrosomal protein of 76 kDa OS=Mus musculus OX=10090 GN=Cep76 PE=1 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 1.520e-130
Identity = 247/653 (37.83%), Postives = 360/653 (55.13%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQ----SSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L   T   +Q    S +  +            + P    +++ + V+ G  F +HL                  P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  LV+S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P   + L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG      +   PH+WV+T   +     +FWE+ TG ++  +      PP          Y TIGC+FNH  F  N   + ++ETCIFDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R       +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIKALRRRGIIDDVMKELNFVTDSVDQELPSSPKQTVGFDKQSTLKKTNVDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQICSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLVASYFLEWRSVLGSENGVTNLTVELMGVGTESKVSVGILNIKLEMYPPLSQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTK----AKGAPHAWVMTCGTD--GTIMFWESLTGHRYIHKPTNPDGPPLAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCIFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRK---DLGLTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 656          
BLAST of CEP76 vs. UniProt/SwissProt
Match: sp|Q28DH9|CEP76_XENTR (Centrosomal protein of 76 kDa OS=Xenopus tropicalis OX=8364 GN=cep76 PE=2 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 1.186e-126
Identity = 250/669 (37.37%), Postives = 359/669 (53.66%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPG--------------------QFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G+VD ++  L            H + DR     T E  + P P                     +++ + V+ G  F +HL        +D        P +    F   L ++ QR  SK +PC  +P     F ++     L DG       +T+L + +P+ LVL+K D  + E  LVSS  +EWR VL +E  +T + ++L GV  E KV+VG + V L+L P  ++ L  +Q+V N Q  +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDEN +NR VC Y+ P+RAGR+LD+P QAARFV ++     +         + W + LAFL  N+G+ ++H  LLCSLLLGFG++AYV VG       GQ  H+WV+T   +      FWE+ TG ++  +      PP          Y TIGC+FNH +F AN+    ++E C+FDL++ +RWK MSEE I          K++   G+   S     PL  S L A+T      SN++E QLR LV   R       +T+ WDDQL Y+L  AL SYE+E+ TG+S  GN+EF+  I+R V DG+TFK FP+H +H NAR    T L+SP   EII+CRG  + LA+RV+V++Y E +   W++F C Y+
Sbjct:   50 EDLMKALRQRGIVDEVMKEL------------HFMEDRN----TRELTSTPKPATHFIDKEPRTLKKTNVDPTRRYLHLQVLSGKAFLEHL------QESDPL------PGQACSTFTLCLHFRNQRFRSKPVPCACEPDFQDGFLLEVHKDSLGDGS-RMADATTMLSICDPVQLVLLKTD-TSGETSLVSSHFLEWRSVLGTEKGATSLVVELLGVGAECKVSVGILNVKLELYPLLNKTL--SQEVINTQFTLER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENWVNRPVCSYIRPLRAGRLLDTPRQAARFV-NVLGYERAPTVGGGGKQEQWCTLLAFLCRNKGDCEDHCNLLCSLLLGFGLDAYVCVGT---KGRGQ-AHTWVMTCGTD--GAITFWESLTGHRYVHKPINPDDPPMVEQPKPLYPYKTIGCVFNHKRFLANSQPLDAVEVCVFDLHDESRWKPMSEEAI----------KSVCSPGSI-ASLPPFPPLCGSLLDAATE-----SNEIELQLRVLVLEHRK---DLGLTTVWDDQLSYLLSPALASYEIERTTGIS-AGNEEFQDCIRRAVPDGHTFKGFPIHFVHRNARRAFATCLRSPFCDEIISCRGDQMRLAVRVRVYTYPEAACAVWIMFACKYR 658          
BLAST of CEP76 vs. UniProt/SwissProt
Match: sp|A7E2V1|CEP76_DANRE (Centrosomal protein of 76 kDa OS=Danio rerio OX=7955 GN=cep76 PE=2 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 1.121e-120
Identity = 220/559 (39.36%), Postives = 321/559 (57.42%), Query Frame = 2
Query:  488 PNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTS----VSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            P ++   F   + ++ QR  SK IPC  +P I + F +++    P + S     +T+L + +P+H+VLIK D  + +  LVSS  ++WR VL + +    ++ +L GV  E+KV  G + + L+L P     L  + DV   Q  +E     +EKER FLVYAKQWWQEF         + VKIFAQDENG+NR VC YV  +RAGR+L+SP QAARFV+ ++ + +  +G      + W S + FL  N+G+ ++H+ LLCSLLLGFG++AYV VG    +     PH+WV+T   +      FWE+ T  ++  R     +P    + +    Y T+GC+FNH  F AN   + ++E C+FD  + +RWK MSEE +  V D  +           N S     PL  S LV + +     SN LE ++R L+S  R   LG  + + WDD L Y+L  AL +YELE+  G+S  GN+EF+ +++R V DG+TFKAFP++ LH NAR    T L+SP  +EI+ CRG  V LA+RV+VF Y E +   W++F C Y+
Sbjct:  132 PGQVCSTFTLHVHFRNQRFRSKPIPCACEPDIQEGFLLEIHRDGPGDASKMADATTMLSICDPVHMVLIKTD-TSGDTTLVSSYFLDWRTVLSAPNGKISVSAELLGVGAEAKVPAGVLNLKLELYPPLTETL--SPDVVTMQKSLER-QKTAEKERLFLVYAKQWWQEFLDIRPSNKSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESPRQAARFVSLLAQERAPVVGGGVR-QEQWASMMVFLCRNKGDCEDHATLLCSLLLGFGLDAYVCVGTKVKNI----PHTWVMTCGTD--GSITFWESFTAHRYLHRPIDPDAPSMILQPKPVHPYQTLGCVFNHKIFLANCQVSDAVERCVFDFTDGSRWKAMSEEAVRSVCDPGF-----------NTSLPPTPPLCSSSLVPNEA-----SNQLELEMRYLLSEHRK-DLG--LATVWDDHLSYLLSAALSAYELERCAGVS-YGNEEFQDAVRRAVPDGHTFKAFPINFLHCNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFGYPESACAVWIMFACKYR 659          
BLAST of CEP76 vs. TrEMBL
Match: H6WA34 (CEP76 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 502/502 (100.00%), Postives = 502/502 (100.00%), Query Frame = 2
Query:  641 TLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ 2146
            TLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVASISTQLSSSIGSNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ
Sbjct:    1 TLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVASISTQLSSSIGSNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ 502          
BLAST of CEP76 vs. TrEMBL
Match: A0A091EGX7 (Centrosomal protein of 76 kDa OS=Corvus brachyrhynchos OX=85066 GN=N302_08998 PE=4 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 5.374e-130
Identity = 247/657 (37.60%), Postives = 365/657 (55.56%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLL--------SRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L          RT     S+  V  +  +L  T+  + P    +++ + V+ G  F +HL                  P ++   F   L ++ QR  SK +PC  +P     F ++     L DG       +T+L + +P+H+VLIK D    E  LV+S  +EWR VL +E+  T + ++L GV  ESKV+VG + + L++ P  ++ L  + ++ + Q  +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV+ +  + +  IG  +   + W + LAFL  N+G+ ++H+ LLCSLLLGFG+ A+V VG          PH+WV+T   +      FWE+ TG ++  R      PP          Y TIGCIFNH +FF N   + ++E C+FDL+N ++WK MS E I          K++   G       + +P     L AST D    SN++E QLR LVS  R       +++ WDDQL Y+L  AL +YELE+ TG+S  GN+EF+ +++R V DG+TFK FP+H +H NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIKALRQRGIIDEVMKELKFVTDVNEKERTSAPKPSTHFVDREPPVLKKTN--IDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQICSTFTLCLHFRNQRFRSKPVPCACEPDFQDGFLLEIHKDSLGDGS-KMVDATTMLSICDPVHIVLIKTDTFG-ETTLVASYFLEWRSVLAAENGITNVAVELLGVGTESKVSVGVLNIRLEMYPQLNKTL--SSEITSTQFTLER-QKTAEKERLFLVYAKQWWREYLQIRPTHNTRLVKIFAQDENGVNRPVCSYVRPLRAGRLLDTPRQAARFVSVLGHERAPVIGGGSGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGFGLEAFVCVGTKAKGV----PHTWVMTCGSD--GTITFWESLTGHRYIHRPINPDDPPLVEQPKPLYPYRTIGCIFNHQKFFGNCQPSDAVEVCVFDLHNESKWKPMSGEAI----------KSVCPPGA-----TSSVP-PFPPLCASTIDAAVTSNEIEVQLRVLVSEHRK---DLGLSTVWDDQLSYLLSPALAAYELERTTGVS-AGNEEFQDAVRRAVPDGHTFKGFPIHFVHRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 659          
BLAST of CEP76 vs. TrEMBL
Match: A0A3L8T3C3 (CEP76-C2 domain-containing protein OS=Chloebia gouldiae OX=44316 GN=DV515_00000132 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.032e-129
Identity = 246/657 (37.44%), Postives = 366/657 (55.71%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNL--------LSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L          RT     S+  V  +  +L  T+  + P    +++ + V+ G  F +HL                  P ++   F   L ++ QR  SK +PC  +P     F ++     L DG       +T+L + +P+H+VLIK D    E  LV+S  +EWR VL +E+  T + ++L GV  ESKV+VG + + L++ P  ++ L  + ++ + Q  +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV+ +  + +  IG  +   + W + LAFL  N+G+ ++H+ LLCSLLLGFG+ A+V VG          PH+WV+T   +      FWE+ TG ++  R      PP          Y TIGCIFNH +FF N   + ++E C+FDL++ ++WK MS E I          K++   G       + +P S   L AST D    SN++E QLR LVS  R       +++ WDDQL Y+L  AL +YELE+ TG+   GN+EF+ +++R V DG+TFK FP+H +H NAR +  T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIRALRQRGIIDDVMKELKFVTDVNETERTLAPKPSTHFVDREPPVLKKTN--IDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQICSTFTLCLHFRNQRFRSKPVPCACEPDFQDGFLLEIHKDSLGDGS-KMVDATTMLSICDPVHMVLIKTDTFG-ETTLVASYFLEWRSVLAAENGITNVAVELLGVGTESKVSVGVLSIRLEMYPQLNKTL--SSEITSTQFTLER-QKTAEKERLFLVYAKQWWREYLQIRPTHNARLVKIFAQDENGVNRPVCSYVRPLRAGRLLDTPRQAARFVSVLGYERALVIGGGSGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGFGLEAFVCVGTKAKGV----PHTWVMTCGSD--GTITFWESLTGHRYVHRPINPDDPPLAEQPKPLYPYRTIGCIFNHEKFFGNCQPSDAVEVCVFDLHDESKWKPMSGEAI----------KSVCAPGA-----ASSVPPS-PPLCASTIDAAVTSNEIEVQLRILVSEHRK---DLGLSTVWDDQLSYLLSPALAAYELERTTGVC-AGNEEFQDAVRRAVPDGHTFKGFPIHFVHRNARRVFATCLRSPFCEEIICCRGDQVRLAVRVRVFAYPESACAVWIMFACKYR 659          
BLAST of CEP76 vs. TrEMBL
Match: A0A1S3G1P5 (centrosomal protein of 76 kDa isoform X1 OS=Dipodomys ordii OX=10020 GN=Cep76 PE=4 SV=1)

HSP 1 Score: 408.297 bits (1048), Expect = 1.633e-129
Identity = 249/653 (38.13%), Postives = 364/653 (55.74%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQ----SSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIK-----LTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAF-PHYSPPSNCK---VEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L       +Q    S +H +       F    + P    +++ + V+ G  F +HL                  P ++   F   L Y+ QR  SK +PC  +P  +  F ++     L DG     S +T+L + +P+H+VLIK D    E  L++S  +EWR VL SE+  T + ++L GV  ESKV+VG + + L++ P  ++ L  +Q+V N QL +E     +EKER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC YV P+RAGR+LD+P QAARFV ++     + +       + W + LAFL  N+G+ ++H+ LLCSLLLG+G+ A+V VG          PH+WV+T   +      FWE+ TG ++  +   P   PP+        Y TIGC+FNH  F  N   + ++ETC+FDLN+ ++WK MSEE I          K++   G         +P     L AST D    SN++E QLR LVS  R   LG  +T+ W+DQL Y+L  AL SYE E+ T +S  GN+EF+ +I+R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDLIKALRRRGIIDDVMKELNFVPDSVDQELPSSPKHAVGFDKQSTFKKTNIDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTFTLCLHYRNQRFRSKPVPCACEPDFHDGFLLEVHRESLGDGTRMADS-TTMLSISDPIHMVLIKTDIFG-ETTLIASYFLEWRSVLGSENGVTSLTVELMGVGTESKVSVGILNIKLEMYPALNQTL--SQEVVNTQLALER-QKTAEKERLFLVYAKQWWREYLQIRPSHNSRLVKIFAQDENGINRPVCSYVKPLRAGRLLDTPRQAARFV-NVLGYERAPVIGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGYGLEAFVCVGTKAKGV----PHAWVMTCGTD--GTITFWESLTGHRYIHKPTNPDEPPPAEQPKPLYPYRTIGCVFNHQMFLGNCQPSDAVETCVFDLNDESKWKPMSEEAI----------KSVCAPGATT-----SLP-PFPPLCASTIDASVTSNEIEMQLRLLVSEHRKD-LG--LTTVWEDQLSYLLSPALASYEFERTTSIS-AGNEEFQDAIRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 656          
BLAST of CEP76 vs. TrEMBL
Match: A0A091WGB8 (Centrosomal protein of 76 kDa (Fragment) OS=Opisthocomus hoazin OX=30419 GN=N306_09010 PE=4 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 2.718e-129
Identity = 244/655 (37.25%), Postives = 366/655 (55.88%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNLLSRTKIQNQ-------SSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKL-TDGEPDNTSV---STLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E ++ +LR  G++D ++  L   T +  +       SS H + DR         + P    +++ + V+ G  F +HL                  P ++   F   L ++ QR  SK +PC  +P  +  F ++L  D   D + +   +T+L L +P+H+VLIK D    E  LV+S  +EWR VL +E+  T + ++L GV  ESKV+VG + + L++ P  ++ L  + ++ N Q  +E+    +E+ER FLVYAKQWW+E+ +     + R VKIFAQDENG+NR VC Y+ P+RAGR+LD+P QAARFV+ +  + +  IG      + W + LAFL  N+G+ ++H+ LLCSLLLGFG+ A+V VG          PH+WV+T   +      FWE+ TG ++  R      PP          Y TIGCIFNH +FF N   + ++E C+FDL++ ++WK MSEE I          K++   G  +      +P     L AS  D    SN++E QLR LVS  R       +++ WDD L Y+L  AL +YELE+ TG+S  GN+EF+ +++R V DG+TFK FP+H ++ NAR    T L+SP  +EII CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   30 EDLIKALRQRGIIDDVMKELKFVTDVNGKERTSAAKSSTHFV-DREPPALRKTNIDPTR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQICSTFTLCLHFRNQRFRSKPVPCACEPDFHDGFLLELHKDSLGDGSKMVDATTMLSLCDPVHMVLIKTDTFG-ETTLVASYFLEWRSVLAAENGVTNVAVELLGVGTESKVSVGVLNIRLEMYPQLNKTL--SPEITNTQFTLEH-QKTAERERLFLVYAKQWWREYLQIRPTHNVRLVKIFAQDENGVNRPVCSYIRPLRAGRLLDTPRQAARFVSVLGYERAPVIGGGGGKQEQWCTLLAFLCRNKGDCEDHANLLCSLLLGFGLEAFVCVGTKAKGV----PHTWVMTCGTD--GAITFWESLTGHRYIHRPINPDDPPLAEQPKPVYPYRTIGCIFNHQKFFGNCQPSDAVEVCVFDLHDESKWKPMSEEAI----------KSVCSPGTTS-----SVP-PFPPLCASAIDAAVTSNEIELQLRILVSEHRK---DLGLSAVWDDHLSYLLSPALAAYELERTTGVS-AGNEEFQDAVRRAVPDGHTFKGFPIHFVYRNARRAFATCLRSPFCEEIICCRGDQVRLAVRVRVFTYPESACAVWIMFACKYR 639          
BLAST of CEP76 vs. Ensembl Cavefish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:103041156])

HSP 1 Score: 381.719 bits (979), Expect = 6.453e-123
Identity = 225/655 (34.35%), Postives = 362/655 (55.27%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNL----LSRTKIQNQ---SSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTS----VSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E  L +L+  G+V+  +  L    ++ ++I+     +SQ  ++++ +       ++P    +++ + V+ G  F +HL                  P ++       L ++ QR  SK +PC  +P + + F +++    P +       +T+L + +P+H+V+IK D  + +  LVSS  ++WR VL + S  T ++++L GV  E KV  G + + L++ P     L  + +V + Q  +E     +EKER FLVYAKQWW+EF +       + VKIFAQDENG+NR VC YV  +RAGR+L+SP QAARFV+ +  + +  +G   A  + W + +AFL  N+G+ ++H+ LLCSLLLGFG++AYV VG      S   PH+WV+T   +      FWE+ T  ++  +     +PP          Y TIGC+FNH  F AN   + S+E C+F+  + +RWK MSE+ +          +++   G+ +      +P  +  L +S+    + SN LE ++R L++  R       + + WDD L Y+L  AL +YELE+ TG+S  GN+EF+ +++R V DG+TFK FP+H LH NAR    T L+SP  +EI+ CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   29 EDFLTALQRRGIVEEAMKELSFVNVTESQIEADALNTSQPRLSEKNITQPKTMNISPLR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTLTLHLHFRNQRFRSKPVPCACEPDLQEGFLLEVHRDSPGDAGKMADATTMLSICDPVHMVMIKTD-TSGDTTLVSSYFLDWRSVLSAPSGKTTVSVELLGVGSECKVPAGVLNIKLEMYPPLSETL--SPEVISTQQSLER-QKTAEKERLFLVYAKQWWREFLEIRPSHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESPRQAARFVSLLVQERAPVVGGG-ARQEQWCTMMAFLCRNKGDCEDHATLLCSLLLGFGLDAYVCVGTK----SKNTPHTWVMTCGTD--GTVTFWESLTAHRYLHQPIDPEAPPMVPQPKPTYPYRTIGCVFNHKTFLANCQPSDSVELCVFEFTDGSRWKAMSEDAV----------RSVCAPGSTS-----SLP-PLPPLCSSSVQTSEASNQLELEMRFLLAEHRK---DLGLATVWDDHLSYLLSSALAAYELERCTGVS-CGNEEFQDAVRRAVPDGHTFKGFPIHFLHRNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFAYPESACAVWIMFACKYR 638          
BLAST of CEP76 vs. Ensembl Cavefish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:103041156])

HSP 1 Score: 381.333 bits (978), Expect = 1.100e-122
Identity = 215/594 (36.20%), Postives = 334/594 (56.23%), Query Frame = 2
Query:  383 QFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTS----VSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            +++ + V+ G  F +HL                  P ++       L ++ QR  SK +PC  +P + + F +++    P +       +T+L + +P+H+V+IK D  + +  LVSS  ++WR VL + S  T ++++L GV  E KV  G + + L++ P     L  + +V + Q  +E     +EKER FLVYAKQWW+EF +       + VKIFAQDENG+NR VC YV  +RAGR+L+SP QAARFV+ +  + +  +G   A  + W + +AFL  N+G+ ++H+ LLCSLLLGFG++AYV VG      S   PH+WV+T   +      FWE+ T  ++  +     +PP          Y TIGC+FNH  F AN   + S+E C+F+  + +RWK MSE+ +          +++   G+ +      +P  +  L +S+    + SN LE ++R L++  R       + + WDD L Y+L  AL +YELE+ TG+S  GN+EF+ +++R V DG+TFK FP+H LH NAR    T L+SP  +EI+ CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   91 RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTLTLHLHFRNQRFRSKPVPCACEPDLQEGFLLEVHRDSPGDAGKMADATTMLSICDPVHMVMIKTD-TSGDTTLVSSYFLDWRSVLSAPSGKTTVSVELLGVGSECKVPAGVLNIKLEMYPPLSETL--SPEVISTQQSLER-QKTAEKERLFLVYAKQWWREFLEIRPSHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESPRQAARFVSLLVQERAPVVGGG-ARQEQWCTMMAFLCRNKGDCEDHATLLCSLLLGFGLDAYVCVGTK----SKNTPHTWVMTCGTD--GTVTFWESLTAHRYLHQPIDPEAPPMVPQPKPTYPYRTIGCVFNHKTFLANCQPSDSVELCVFEFTDGSRWKAMSEDAV----------RSVCAPGSTS-----SLP-PLPPLCSSSVQTSEASNQLELEMRFLLAEHRK---DLGLATVWDDHLSYLLSSALAAYELERCTGVS-CGNEEFQDAVRRAVPDGHTFKGFPIHFLHRNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFAYPESACAVWIMFACKYR 641          
BLAST of CEP76 vs. Ensembl Cavefish
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:103041156])

HSP 1 Score: 381.719 bits (979), Expect = 1.206e-122
Identity = 225/655 (34.35%), Postives = 362/655 (55.27%), Query Frame = 2
Query:  221 EIVLDSLRNEGVVDFILSNL----LSRTKIQNQ---SSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTS----VSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPP----SNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            E  L +L+  G+V+  +  L    ++ ++I+     +SQ  ++++ +       ++P    +++ + V+ G  F +HL                  P ++       L ++ QR  SK +PC  +P + + F +++    P +       +T+L + +P+H+V+IK D  + +  LVSS  ++WR VL + S  T ++++L GV  E KV  G + + L++ P     L  + +V + Q  +E     +EKER FLVYAKQWW+EF +       + VKIFAQDENG+NR VC YV  +RAGR+L+SP QAARFV+ +  + +  +G   A  + W + +AFL  N+G+ ++H+ LLCSLLLGFG++AYV VG      S   PH+WV+T   +      FWE+ T  ++  +     +PP          Y TIGC+FNH  F AN   + S+E C+F+  + +RWK MSE+ +          +++   G+ +      +P  +  L +S+    + SN LE ++R L++  R       + + WDD L Y+L  AL +YELE+ TG+S  GN+EF+ +++R V DG+TFK FP+H LH NAR    T L+SP  +EI+ CRG  V LA+RV+VF+Y E +   W++F C Y+
Sbjct:   50 EDFLTALQRRGIVEEAMKELSFVNVTESQIEADALNTSQPRLSEKNITQPKTMNISPLR--RYLYLQVLGGKAFLEHLQEPEPL------------PGQVCSTLTLHLHFRNQRFRSKPVPCACEPDLQEGFLLEVHRDSPGDAGKMADATTMLSICDPVHMVMIKTD-TSGDTTLVSSYFLDWRSVLSAPSGKTTVSVELLGVGSECKVPAGVLNIKLEMYPPLSETL--SPEVISTQQSLER-QKTAEKERLFLVYAKQWWREFLEIRPSHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESPRQAARFVSLLVQERAPVVGGG-ARQEQWCTMMAFLCRNKGDCEDHATLLCSLLLGFGLDAYVCVGTK----SKNTPHTWVMTCGTD--GTVTFWESLTAHRYLHQPIDPEAPPMVPQPKPTYPYRTIGCVFNHKTFLANCQPSDSVELCVFEFTDGSRWKAMSEDAV----------RSVCAPGSTS-----SLP-PLPPLCSSSVQTSEASNQLELEMRFLLAEHRK---DLGLATVWDDHLSYLLSSALAAYELERCTGVS-CGNEEFQDAVRRAVPDGHTFKGFPIHFLHRNARRAFATCLRSPFCEEIVCCRGDHVRLAVRVRVFAYPESACAVWIMFACKYR 659          
BLAST of CEP76 vs. Ensembl Cavefish
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 61.6178 bits (148), Expect = 2.678e-9
Identity = 66/316 (20.89%), Postives = 122/316 (38.61%), Query Frame = 2
Query: 1184 DIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCF 2131
            D+W +   FL    G+ + H+VLLC+  L  G  A++ +G        + P ++V+T   ++ N+ + W  STG+ +           + C ++  T+GC+ N    + N     +     FD+     WK              +F ++    G +++   + +     +  A+         D+E  LR  +  WR         ++W+      L Q L   E   ++G   V  +E +  +Q  + D Y    FP+H+     R I++    + +     N    +V  AL V V  Y  +    WV     
Sbjct: 1300 DLWSTCDQFLTLLAGDEEEHAVLLCNYFLSMGKKAWLIIGTA----IPEGPTAYVLT---QEQNRYLIWNPSTGQYYGQHD-------TFCPLQ--TVGCLVNADNVWFNIQLYATPIRMSFDVTKPKFWK-------------PFFSRSFPDPGLSSVQPEDLVYRRTDKAYAAE------LQDIEKILREKIMEWRPRH-----PTRWNRYCTSTLRQFLPKLE---MSGGREVA-EEHRLELQSLLGD-YRISGFPLHLPFSEIRPIIEAVYSTGVH----NVEAPNVEFALAVYVHPYPSNVLSVWVYIASL 1566          
BLAST of CEP76 vs. Ensembl Sea Lamprey
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:564926])

HSP 1 Score: 387.882 bits (995), Expect = 1.423e-125
Identity = 239/655 (36.49%), Postives = 357/655 (54.50%), Query Frame = 2
Query:  227 VLDSLRNEGVVDFILSNLL---SRTKIQN--QSSQHVINDRALLNFTHEQLAPPGPGQ-FIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDN----TSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVL-CSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE------YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            +L +L   GVVD ++  L     RT+I +  + SQ ++  + + +   +      PG+ ++ + V+ G  F +HL    +T  +         P          L+++ QR  SK   C  +P +   F ++L DG           +TLLG+ +P+HLVL+K D ++ E  LV+S  +EWR VL C  +  T +  +LQGV  ES+V VG + + L+L P       I  DV N QL +E     +EKER FLVYAKQWW+E+ +   E + R VKIFAQDENG NR VC YV  +RAGR+LDSP QAARFV+ +  + + ++G   A H++W S  AFL   +G+ ++H+ LLCSLLLGFG++A+V VG      +   PH+WV T   +    A FWE+ TG +++ R      PP     +      Y T+GC +NH  F+AN   T +++    DL +  RWK MS + +A V          +G   + ++   R P         + D    +  +E +LR LV   R       + + WD  L Y+L  AL +YE E+  G++  GNDEF+ +++R V DG+TFK FP+H+L  NAR  L TAL+SP   EI++CRG +V LA+R +VF Y E++   W++F C Y+
Sbjct:   58 LLQALHQRGVVDQVMEQLAFRHVRTRILHSPRPSQSLLIQQLIKSPNID------PGRRYLHLRVLGGRAFLEHL----HTGPSPPASPPAGTPGRPGPTLTLHLNFRSQRFRSKPAACACEPDLRDSFLLELHDGSRGEGGKMADTTTLLGMSDPVHLVLVKTDHVSVETTLVTSHRLEWRHVLACPTAMDTAV--ELQGVGSESRVAVGVLHLRLELHPRLIHT--ITPDVLNTQLGLER-QRAAEKERLFLVYAKQWWREYLQIRPEHNSRLVKIFAQDENGTNRPVCAYVRLLRAGRLLDSPRQAARFVSLLGYERAQAVGGG-ARHEMWSSAFAFLCRGKGDCEDHANLLCSLLLGFGLDAFVCVGTK----AKGEPHAWVATRSTD--GTATFWESLTGHRYAHRPINLDDPPLPRAQQHQQHHPYRTLGCAYNHRAFYANCGPTHAVDATHLDLADGTRWKAMSRDAVASVT--------TAGLATSALAPPLRPP---------SIDPADAARRVETELRLLVEDHRK---DLGLQTAWDPALAYLLSPALAAYECERAVGVAP-GNDEFQDAVRRFVPDGHTFKGFPIHLLSRNARRALATALRSPFCDEIVSCRGDEVRLAVRTRVFVYPENACAVWIMFACTYR 669          
BLAST of CEP76 vs. Ensembl Sea Lamprey
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 70.0922 bits (170), Expect = 4.908e-13
Identity = 78/369 (21.14%), Postives = 152/369 (41.19%), Query Frame = 2
Query: 1034 DENGLNRFVCDYVSPVR--AGRILDSP------AQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWV 2116
            D NG   FVC ++ P++  A  +  +P      A  AR+V+ I     S   S     D+W +   FL    G+ + H+VLLC+  L  G+ A++ +G    + S     ++V+T +E   N+ + W  STG+  S+    H+ P         ++GC+ +    + N           F ++NA+ WK              +F ++       ++      P  ++ +    +  +++   +E  L+  +  WR  +      ++W+  +   L   L + E     G+     ++ ++ +   + D Y    FP+H+     + +++    S +    I+  G++   AL V V  YA H    WV
Sbjct:   42 DLNGQAVFVCRFIRPIQPPAELLQANPGNLQLTALLARYVSLIPFIPDSVSFSGVC--DLWSTSDQFLELQCGDEEEHAVLLCNFFLAQGIKAWLLLGTAVPEGST----AYVLTQEEGSYNQFVIWNPSTGR--SYNQHDHFCP-------LQSVGCLISADNIWFNIQLYDLPARMNFAVSNASLWK-------------PFFTRSFPIPNLPSVQ-----PAELNHVPPDKTSAMELQARIEKILKERMMEWRPRQ-----PTRWNRHVTAALRDLLPALE----RGMGRAVEEQHRAELAHTLAD-YRVSGFPIHMAFTELQRLVEAVYGSGVHS--IDLPGTE--FALAVYVHPYANHVMSVWV 363          
BLAST of CEP76 vs. Ensembl Sea Lamprey
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:ZFIN;Acc:ZDB-GENE-030131-2291])

HSP 1 Score: 67.781 bits (164), Expect = 6.490e-12
Identity = 77/371 (20.75%), Postives = 151/371 (40.70%), Query Frame = 2
Query: 1034 DENGLNRFVCDYVSPVR--AGRILDSPAQA--------ARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWV 2116
            D NG   FVC ++ P++  A  +  +P           AR+V+ I     S   S     D+W +   FL    G+ + H+VLLC+  L  G+ A++ +G    + S     ++V+T +E   N+ + W  STG+  S+    H+ P         ++GC+ +    + N           F ++NA+ WK              +F ++       ++      P  ++ +    +  +++   +E  L+  +  WR  +      ++W+  +   L   L + E     G+     ++ ++ +   + D Y    FP+H+     + +++    S +    I+  G++   AL V V  YA H    WV
Sbjct: 1077 DLNGQAVFVCRFIRPIQPPAELLQANPGNLQLTATNLLARYVSLIPFIPDSVSFSGVC--DLWSTSDQFLELQCGDEEEHAVLLCNFFLAQGIKAWLLLGTAVPEGST----AYVLTQEEGSYNQFVIWNPSTGR--SYNQHDHFCP-------LQSVGCLISADNIWFNIQLYDLPARMNFAVSNASLWK-------------PFFTRSFPIPNLPSVQ-----PAELNHVPPDKTSAMELQARIEKILKERMMEWRPRQ-----PTRWNRHVTAALRDLLPALE----RGMGRAVEEQHRAELAHTLAD-YRVSGFPIHMAFTELQRLVEAVYGSGVHS--IDLPGTE--FALAVYVHPYANHVMSVWV 1400          
BLAST of CEP76 vs. Ensembl Nematostella
Match: EDO30922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZE6])

HSP 1 Score: 371.703 bits (953), Expect = 2.295e-119
Identity = 226/650 (34.77%), Postives = 359/650 (55.23%), Query Frame = 2
Query:  227 VLDSLRNEGVVDFILSNL----LSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFV---CDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVE-----YVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            +L++L+ +G+VD ++ +L    L R K + +        R +      ++      +++ ++V+ G  F +HL         D        P  +   F   + ++ QR  S  +PC  +P + + F ++L   +      +TLL   + +H+VLIK D    +  L+ S  +EWR +L + +     ++++ GV  E+KV VG ++V  +++P   + L   ++V  AQ+ +E+    +E+ER FLVYAKQWW+EF +      +R VKIFAQDE   NR V   C +V P+R GR+LD+P QAARFV+ +  + + S+G   A  ++W S  A L + +G+ ++H+ LLCSLLLGFG+NAYV  G      +    H+WVVT   E   +A FWE+ T  ++  R      PP + +       Y T+GC+FNH +F+AN+  T  +E C F+L+N   WK MSE+ +  +   K                       +  L   T D   +SND+E++LR LV+  R       +++ WDD+LC++L  AL SYELE  TG+S VGN+EF+ +I+R + DG+TFK FP+  +H NAR    T L+SPI +EII+CRG +V LA+RV+VF+Y E++  TW++F   Y+
Sbjct:   48 LLNALKEKGIVDEVMRSLRFEGLEREKRKAKLGG---EKREVEKEEATRVGVDPTRRYLYMHVLGGKAFLEHL--------QDPEPL----PGRVTSTFTLHVHFRGQRFRSCPVPCACEPDLTEGFLLELQHDKSKMADAATLLSHSDTIHIVLIKTD-TAGDTTLLGSHFLEWRNILFNPTGRMTCSVEINGVGAEAKVPVGILDVKFEMIPRFSKIL--TEEVIKAQINLEH-NRVAERERLFLVYAKQWWREFLQIRPSHSKRLVKIFAQDECATNRHVMPVCSFVHPLRTGRLLDTPRQAARFVSLLGYERTPSVGGGKA--EMWSSFHALLCKRKGDCEDHATLLCSLLLGFGLNAYVCGGTKSKGVA----HTWVVTISPE--GEATFWESLTAHRYVHRPINPDDPPLDKQQARPVHPYHTVGCVFNHQEFYANSQPTDVVEVCQFELHNEALWKAMSEDALKSICGTKILPPMPP----------------LPPLFPPTIDSALISNDMEHELRGLVADHRK---DLGLSTSWDDELCHILSPALASYELEHSTGVS-VGNEEFQHAIRRAIPDGHTFKGFPIQFVHRNARRAFATCLRSPICEEIISCRGDNVRLAVRVRVFTYPENACATWIMFAVKYK 650          
BLAST of CEP76 vs. Ensembl Medaka
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:101161918])

HSP 1 Score: 390.193 bits (1001), Expect = 6.006e-126
Identity = 234/652 (35.89%), Postives = 354/652 (54.29%), Query Frame = 2
Query:  236 SLRNEGVVDFIL---------SNLLSRTKIQNQSSQHVINDRALLNFTH-EQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSV---STLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAF----PHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            +L+  G++D ++         S L  R+ ++N+    + +     NF++  Q+      Q++ + V+ G  F +HL                  P ++   F  +L ++ QR  SK +PC  +P + + F ++L     D   V   +++L + +P+H VLIK D ++ E  LVSS  ++WR VL S +  T   ++L GV  E KV  G + V L+L P     + ++ DV + Q  +E  T  +EK+R FLVYAKQWW+EF +       + VKIFAQDENG+NR VC YV  +RAGR+L+S   AARFV+ ++ + +  +G  T   + W + +AFL   +G+ ++H+ LLCSLLLGFG++AYV +G          PH+WV+T   +      FWE+ T  ++  R      P  SP       Y T+GC+FNH  F AN   + S+E C+FD  N +RWK MSEE +          +++ G G+            +  L A + D    SN LE ++R LV   R      ++ + WDD LCY+L  AL +YE+E+ TG+S  GN+EF+ +++R V DG TFK FP+H LH NAR    T L+SP  +EII CRG  V LA+RV VF Y E++   W++F C Y+
Sbjct:   53 ALQRRGIIDDVMKDLRFSQVFSPLTDRSHVRNEEMSCLCH--TCFNFSYFLQINVDPSRQYLHLQVLGGKAFLEHLQEPQPL------------PGQVSSTFTLYLHFRDQRFGSKPVPCTCEPDMRENFLLELCRDNADGGKVMDAASMLSICDPIHFVLIKTD-ISGETTLVSSYFLDWRPVLSSTNSKTCFAVELMGVGSECKVPAGVLTVNLELYPP--PAVNLSADVISTQQSLER-TRTAEKDRLFLVYAKQWWREFLEIRASHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESSRHAARFVSLLAHERAPMLGGGTGKQEQWCTLMAFLCRGKGDCEDHATLLCSLLLGFGLDAYVCMGTKAKGV----PHTWVMTRGTD--GTITFWESLTAHRYLHRPVDPDAPPLSPQPKPSSPYRTVGCVFNHQTFMANCQPSDSVELCVFDFQNPSRWKAMSEEAL----------RSVCGPGSCTSL------PPLPPLCAPSLDPSAASNQLEMEMRYLVYEHRK---DLDLGTVWDDHLCYLLSSALSAYEMERCTGVS-CGNEEFQDAVRRAVPDGQTFKGFPIHFLHRNARRAFATCLRSPFCEEIICCRGDSVRLAVRVWVFIYPENACAVWLMFACKYR 660          
BLAST of CEP76 vs. Ensembl Medaka
Match: cep76 (centrosomal protein 76 [Source:NCBI gene;Acc:101161918])

HSP 1 Score: 388.267 bits (996), Expect = 2.886e-125
Identity = 224/593 (37.77%), Postives = 329/593 (55.48%), Query Frame = 2
Query:  383 QFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSV---STLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEF-KTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAF----PHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQ 2137
            Q++ + V+ G  F +HL                  P ++   F  +L ++ QR  SK +PC  +P + + F ++L     D   V   +++L + +P+H VLIK D ++ E  LVSS  ++WR VL S +  T   ++L GV  E KV  G + V L+L P     + ++ DV + Q  +E  T  +EK+R FLVYAKQWW+EF +       + VKIFAQDENG+NR VC YV  +RAGR+L+S   AARFV+ ++ + +  +G  T   + W + +AFL   +G+ ++H+ LLCSLLLGFG++AYV +G          PH+WV+T   +      FWE+ T  ++  R      P  SP       Y T+GC+FNH  F AN   + S+E C+FD  N +RWK MSEE +          +++ G G+            +  L A + D    SN LE ++R LV   R      ++ + WDD LCY+L  AL +YE+E+ TG+S  GN+EF+ +++R V DG TFK FP+H LH NAR    T L+SP  +EII CRG  V LA+RV VF Y E++   W++F C Y+
Sbjct:  104 QYLHLQVLGGKAFLEHLQEPQPL------------PGQVSSTFTLYLHFRDQRFGSKPVPCTCEPDMRENFLLELCRDNADGGKVMDAASMLSICDPIHFVLIKTD-ISGETTLVSSYFLDWRPVLSSTNSKTCFAVELMGVGSECKVPAGVLTVNLELYPP--PAVNLSADVISTQQSLER-TRTAEKDRLFLVYAKQWWREFLEIRASHQSKLVKIFAQDENGVNRPVCSYVRVLRAGRLLESSRHAARFVSLLAHERAPMLGGGTGKQEQWCTLMAFLCRGKGDCEDHATLLCSLLLGFGLDAYVCMGTKAKGV----PHTWVMTRGTD--GTITFWESLTAHRYLHRPVDPDAPPLSPQPKPSSPYRTVGCVFNHQTFMANCQPSDSVELCVFDFQNPSRWKAMSEEAL----------RSVCGPGSCTSL------PPLPPLCAPSLDPSAASNQLEMEMRYLVYEHRK---DLDLGTVWDDHLCYLLSSALSAYEMERCTGVS-CGNEEFQDAVRRAVPDGQTFKGFPIHFLHRNARRAFATCLRSPFCEEIICCRGDSVRLAVRVWVFIYPENACAVWLMFACKYR 654          
BLAST of CEP76 vs. Ensembl Medaka
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:NCBI gene;Acc:101169598])

HSP 1 Score: 68.1662 bits (165), Expect = 2.955e-11
Identity = 90/421 (21.38%), Postives = 175/421 (41.57%), Query Frame = 2
Query:  908 RMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGR-ILDS----PAQA----ARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFS-FRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSD---VIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCF 2131
            +++++ + S+++ + L  A+++  E K      +RP      D NG   FV  Y+ P+   +  LD+    P +A    ARFV+ I +       S     D+W +   F     G+ + H+VLLC+  L  G  A++ +G        + P ++V+T ++   ++ + W  S+G+ +  +  F        C ++   +GC+ +    + N  +  S     FD++    WK              +F  +    G +++            LV S +D     ++ + +E  L+  +  WR         ++W+      L Q  F  +LEQ  G  +V  +  +  +QR + + Y    FP+H+   + R +++    + +     N +GS+V  AL V V  Y  +    WV     
Sbjct: 1240 KIKDLKFDSQEQERLLQAAEKF--ERKAAERHPDRPCITTVIDLNGKTVFVTRYIRPLNPPQEFLDAFPNNPQEATTLVARFVSLIPSLPDQVSFSGVC--DLWTTCNQFFTLLAGDEEEHAVLLCNYFLSLGKKAWLVIGTA----IPEGPTAYVLTHEQ---SRYLIWNPSSGQFYGQYDTF--------CPLQ--AVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWK-------------PFFSGSFPHPGLSSV--------QPEELVYSHTDAAAAAELQDRIEKILKEKIMEWRPRH-----PTRWNRYCNTTLKQ--FLPKLEQSRG-QDVA-EGHRHELQRLLGE-YRISGFPLHMPFSDIRPLIEAVHSTGVH----NIQGSNVEFALAVYVHPYPNNVLSVWVYLASL 1604          
BLAST of CEP76 vs. Ensembl Medaka
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:NCBI gene;Acc:101169598])

HSP 1 Score: 67.781 bits (164), Expect = 3.346e-11
Identity = 90/421 (21.38%), Postives = 175/421 (41.57%), Query Frame = 2
Query:  908 RMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGR-ILDS----PAQA----ARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFS-FRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSD---VIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCF 2131
            +++++ + S+++ + L  A+++  E K      +RP      D NG   FV  Y+ P+   +  LD+    P +A    ARFV+ I +       S     D+W +   F     G+ + H+VLLC+  L  G  A++ +G        + P ++V+T ++   ++ + W  S+G+ +  +  F        C ++   +GC+ +    + N  +  S     FD++    WK              +F  +    G +++            LV S +D     ++ + +E  L+  +  WR         ++W+      L Q  F  +LEQ  G  +V  +  +  +QR + + Y    FP+H+   + R +++    + +     N +GS+V  AL V V  Y  +    WV     
Sbjct: 1281 KIKDLKFDSQEQERLLQAAEKF--ERKAAERHPDRPCITTVIDLNGKTVFVTRYIRPLNPPQEFLDAFPNNPQEATTLVARFVSLIPSLPDQVSFSGVC--DLWTTCNQFFTLLAGDEEEHAVLLCNYFLSLGKKAWLVIGTA----IPEGPTAYVLTHEQ---SRYLIWNPSSGQFYGQYDTF--------CPLQ--AVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWK-------------PFFSGSFPHPGLSSV--------QPEELVYSHTDAAAAAELQDRIEKILKEKIMEWRPRH-----PTRWNRYCNTTLKQ--FLPKLEQSRG-QDVA-EGHRHELQRLLGE-YRISGFPLHMPFSDIRPLIEAVHSTGVH----NIQGSNVEFALAVYVHPYPNNVLSVWVYLASL 1645          
BLAST of CEP76 vs. Ensembl Medaka
Match: cc2d2a (coiled-coil and C2 domain containing 2A [Source:NCBI gene;Acc:101169598])

HSP 1 Score: 65.4698 bits (158), Expect = 1.623e-10
Identity = 90/415 (21.69%), Postives = 170/415 (40.96%), Query Frame = 2
Query:  926 YGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGR-ILDS----PAQA----ARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFS-FRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSD---VIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCF 2131
            + S+++ + L  A+++  E K      +RP      D NG   FV  Y+ P+   +  LD+    P +A    ARFV+ I +       S     D+W +   F     G+ + H+VLLC+  L  G  A++ +G        + P ++V+T ++   ++ + W  S+G+ +  +  F        C ++   +GC+ +    + N  +  S     FD++    WK              +F  +    G +++            LV S +D     ++ + +E  L+  +  WR         ++W+      L Q  F  +LEQ  G  +V  +  +  +QR + + Y    FP+H+   + R +++    + +     N +GS+V  AL V V  Y  +    WV     
Sbjct: 1241 FDSQEQERLLQAAEKF--ERKAAERHPDRPCITTVIDLNGKTVFVTRYIRPLNPPQEFLDAFPNNPQEATTLVARFVSLIPSLPDQVSFSGVC--DLWTTCNQFFTLLAGDEEEHAVLLCNYFLSLGKKAWLVIGTA----IPEGPTAYVLTHEQ---SRYLIWNPSSGQFYGQYDTF--------CPLQ--AVGCLVDADNVWFNIQEYASPMRMSFDVSKRKLWK-------------PFFSGSFPHPGLSSV--------QPEELVYSHTDAAAAAELQDRIEKILKEKIMEWRPRH-----PTRWNRYCNTTLKQ--FLPKLEQSRG-QDVA-EGHRHELQRLLGE-YRISGFPLHMPFSDIRPLIEAVHSTGVH----NIQGSNVEFALAVYVHPYPNNVLSVWVYLASL 1599          
BLAST of CEP76 vs. Planmine SMEST
Match: SMESG000002127.1 (SMESG000002127.1)

HSP 1 Score: 1327 bits (3433), Expect = 0.000e+0
Identity = 687/688 (99.85%), Postives = 687/688 (99.85%), Query Frame = 2
Query:   83 MTTNGFISCEYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVAXXXXXXXXXXXXNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ 2146
            MTTNGFISCEYENVINSEITNNNNIKDKINSIIGKSSLSKNKSLNKEIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVASISTQLSSSIGSNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIE CIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ
Sbjct:    1 MTTNGFISCEYENVINSEITNNNNIKDKINSIIGKSSLSKNKSLNKEIVLDSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPGQFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQKQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSVSTLLGLREPLHLVLIKHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSIEVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQEFKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVASISTQLSSSIGSNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGMNAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFPHYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIEMCIFDLNNANRWKRMSEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMSNDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGLSNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEIINCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ 688          
The following BLAST results are available for this feature:
BLAST of CEP76 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CEP762.108e-13138.07centrosomal protein 76 [Source:HGNC Symbol;Acc:HGN... [more]
CEP762.661e-12541.68centrosomal protein 76 [Source:HGNC Symbol;Acc:HGN... [more]
CEP764.575e-3240.85centrosomal protein 76 [Source:HGNC Symbol;Acc:HGN... [more]
CEP761.091e-3040.43centrosomal protein 76 [Source:HGNC Symbol;Acc:HGN... [more]
CEP765.732e-1645.00centrosomal protein 76 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of CEP76 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP76 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP76 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep761.876e-12139.36centrosomal protein 76 [Source:NCBI gene;Acc:56492... [more]
cc2d2a2.816e-1322.30coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cc2d2a2.953e-1322.30coiled-coil and C2 domain containing 2A [Source:ZF... [more]
back to top
BLAST of CEP76 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep761.189e-12737.35centrosomal protein 76kDa [Source:NCBI gene;Acc:54... [more]
cep762.238e-12737.37centrosomal protein 76kDa [Source:NCBI gene;Acc:54... [more]
cep767.968e-11036.84centrosomal protein 76kDa [Source:NCBI gene;Acc:54... [more]
dhcr79.603e-1421.927-dehydrocholesterol reductase [Source:Xenbase;Acc... [more]
dhcr72.963e-1221.627-dehydrocholesterol reductase [Source:Xenbase;Acc... [more]
back to top
BLAST of CEP76 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cep762.173e-13137.83centrosomal protein 76 [Source:MGI Symbol;Acc:MGI:... [more]
Cc2d2a2.108e-719.78coiled-coil and C2 domain containing 2A [Source:MG... [more]
Cc2d2b3.709e-619.75coiled-coil and C2 domain containing 2B [Source:MG... [more]
back to top
BLAST of CEP76 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCP7|CEP76_PONAB9.321e-13138.07Centrosomal protein of 76 kDa OS=Pongo abelii OX=9... [more]
sp|Q8TAP6|CEP76_HUMAN1.012e-13038.07Centrosomal protein of 76 kDa OS=Homo sapiens OX=9... [more]
sp|Q0VEJ0|CEP76_MOUSE1.520e-13037.83Centrosomal protein of 76 kDa OS=Mus musculus OX=1... [more]
sp|Q28DH9|CEP76_XENTR1.186e-12637.37Centrosomal protein of 76 kDa OS=Xenopus tropicali... [more]
sp|A7E2V1|CEP76_DANRE1.121e-12039.36Centrosomal protein of 76 kDa OS=Danio rerio OX=79... [more]
back to top
BLAST of CEP76 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H6WA340.000e+0100.00CEP76 (Fragment) OS=Schmidtea mediterranea OX=7932... [more]
A0A091EGX75.374e-13037.60Centrosomal protein of 76 kDa OS=Corvus brachyrhyn... [more]
A0A3L8T3C31.032e-12937.44CEP76-C2 domain-containing protein OS=Chloebia gou... [more]
A0A1S3G1P51.633e-12938.13centrosomal protein of 76 kDa isoform X1 OS=Dipodo... [more]
A0A091WGB82.718e-12937.25Centrosomal protein of 76 kDa (Fragment) OS=Opisth... [more]
back to top
BLAST of CEP76 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cep766.453e-12334.35centrosomal protein 76 [Source:NCBI gene;Acc:10304... [more]
cep761.100e-12236.20centrosomal protein 76 [Source:NCBI gene;Acc:10304... [more]
cep761.206e-12234.35centrosomal protein 76 [Source:NCBI gene;Acc:10304... [more]
cc2d2a2.678e-920.89coiled-coil and C2 domain containing 2A [Source:ZF... [more]
back to top
BLAST of CEP76 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cep761.423e-12536.49centrosomal protein 76 [Source:NCBI gene;Acc:56492... [more]
cc2d2a4.908e-1321.14coiled-coil and C2 domain containing 2A [Source:ZF... [more]
cc2d2a6.490e-1220.75coiled-coil and C2 domain containing 2A [Source:ZF... [more]
back to top
BLAST of CEP76 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CEP76 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO309222.295e-11934.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CEP76 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cep766.006e-12635.89centrosomal protein 76 [Source:NCBI gene;Acc:10116... [more]
cep762.886e-12537.77centrosomal protein 76 [Source:NCBI gene;Acc:10116... [more]
cc2d2a2.955e-1121.38coiled-coil and C2 domain containing 2A [Source:NC... [more]
cc2d2a3.346e-1121.38coiled-coil and C2 domain containing 2A [Source:NC... [more]
cc2d2a1.623e-1021.69coiled-coil and C2 domain containing 2A [Source:NC... [more]
back to top
BLAST of CEP76 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000002127.10.000e+099.85SMESG000002127.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025823
GenBankAFB74716.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025823 ID=SMED30025823|Name=CEP76|organism=Schmidtea mediterranea sexual|type=transcript|length=2168bp
TGCGTGAATATACTTTTTATATCATCATTTATTTGTGAACTGAAATCTAT
TTATTCGATTTTCTGTATTTTAGGATTGCGAAATGACAACTAATGGTTTT
ATAAGCTGTGAGTATGAGAATGTGATTAATTCAGAAATTACAAATAATAA
CAATATCAAAGATAAAATTAATTCGATCATTGGAAAAAGTTCATTATCAA
AAAATAAATCTTTAAATAAAGAAATCGTTCTCGATTCATTACGCAATGAA
GGAGTTGTTGACTTCATATTGTCGAATCTGCTGTCGAGAACTAAAATTCA
AAACCAAAGTAGTCAGCATGTGATAAATGATCGAGCGTTATTGAATTTCA
CCCATGAGCAACTAGCACCTCCAGGTCCAGGTCAGTTTATTGGCATCAAT
GTGATGAGAGGCGCCAATTTTGCCGATCACCTTTTAGTCGACCACAATAC
AAATGTCAACGACAAATTCGAGTTTGGTCTCCATCAACCGAATGAAATGC
AGAAAGGCTTTCAGTTTTTTCTCTCCTACCAAAAGCAGCGGATCTGCAGT
AAAATGATTCCTTGTGTCCGAGATCCTCTCATCAATCAGCAGTTCTTTAT
CAAGCTCACTGACGGTGAGCCTGACAATACGAGTGTTTCAACATTGCTTG
GACTTAGAGAACCTCTTCATTTGGTGCTCATTAAACACGATTTCATGACT
CATGAGCGATGGTTAGTCAGCTCGCAAGTAATAGAGTGGCGAATGGTATT
ATGTAGTGAATCCTGGTCAACGAGGATCAATATGGACCTTCAAGGAGTCT
TTGATGAAAGCAAGGTGAACGTCGGGAGCATTGAGGTTGTCCTTCAGTTA
GTCCCAACTTGTCATCGGCAATTGCCGATCGCGCAAGACGTTTTCAATGC
TCAATTGAGAATGGAAAATGTCACCTACGGCTCAGAAAAGGAGCGGAAGT
TTCTAGTTTATGCCAAGCAGTGGTGGCAGGAATTTAAAACGGAACATGAA
GAAGACGAGAGACCGGTAAAGATTTTCGCTCAAGATGAAAACGGTTTGAA
CAGATTTGTGTGCGACTATGTTTCTCCAGTAAGAGCAGGACGGATTCTGG
ATTCTCCTGCCCAAGCCGCAAGGTTTGTCGCATCTATCTCAACTCAACTC
AGCTCCTCAATCGGATCAAATACTGCTGCACATGATATTTGGAAATCCGG
ACTCGCTTTCCTGGTGGAAAATCGGGGTAATGTCGATAACCATTCAGTGC
TTTTGTGCTCTTTGCTCTTGGGGTTCGGGATGAACGCCTATGTCGCGGTT
GGGGTTGTCAAGGATGACTTTAGTGGTCAGCGGCCCCACTCGTGGGTTGT
TACGTTTCAGGAAGAGCAGCCAAACAAAGCAATATTTTGGGAAGCATCCA
CCGGTAAGAAGTTCTCATTTCGTGCATTTCCCCATTATAGCCCGCCGAGC
AATTGCAAGGTGGAATATGTGACTATCGGTTGCATTTTCAATCATTATCA
ATTTTTCGCCAACAATTACAAGACGAAATCGATCGAAACGTGCATATTTG
ACCTGAATAATGCAAACAGATGGAAGCGAATGTCGGAAGAGATCATTGCG
ATTGTTGTCGACAATAAATACTTTGAGAAAGCAATCAGTGGCGACGGGAA
CAACAATATCTCATGGAACAATCGGATCCCGCTGTCCGTTTCCCGGCTGG
TAGCGAGCACAAGTGACGTGATCAAGATGAGCAATGACCTTGAGAACCAG
TTGCGGACGCTGGTCAGCAGGTGGCGGTCAGCGCGCCTCGGCACCAATGT
CACATCGAAATGGGACGATCAATTGTGCTACATGCTAGGGCAGGCGCTGT
TCTCATATGAATTGGAGCAGCTGACCGGTCTGTCCAATGTCGGCAATGAC
GAGTTCAAGAGTTCCATTCAGAGGCACGTCAAGGACGGGTACACATTCAA
GGCGTTCCCTGTTCATGTCCTACACATCAATGCTAGATTAATTCTTGACA
CTGCCCTAAAATCTCCGATATTTCAGGAGATTATCAATTGTCGAGGATCA
GATGTCAATTTAGCGCTCCGAGTGAAAGTGTTTTCTTATGCCGAGCATTC
AACTCCTACATGGGTGATTTTCGGTTGTTTCTATCAATTTAGTCAGTAAT
ACAACTGGACCGATTGCA
back to top

protein sequence of SMED30025823-orf-1

>SMED30025823-orf-1 ID=SMED30025823-orf-1|Name=SMED30025823-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=689bp
MTTNGFISCEYENVINSEITNNNNIKDKINSIIGKSSLSKNKSLNKEIVL
DSLRNEGVVDFILSNLLSRTKIQNQSSQHVINDRALLNFTHEQLAPPGPG
QFIGINVMRGANFADHLLVDHNTNVNDKFEFGLHQPNEMQKGFQFFLSYQ
KQRICSKMIPCVRDPLINQQFFIKLTDGEPDNTSVSTLLGLREPLHLVLI
KHDFMTHERWLVSSQVIEWRMVLCSESWSTRINMDLQGVFDESKVNVGSI
EVVLQLVPTCHRQLPIAQDVFNAQLRMENVTYGSEKERKFLVYAKQWWQE
FKTEHEEDERPVKIFAQDENGLNRFVCDYVSPVRAGRILDSPAQAARFVA
SISTQLSSSIGSNTAAHDIWKSGLAFLVENRGNVDNHSVLLCSLLLGFGM
NAYVAVGVVKDDFSGQRPHSWVVTFQEEQPNKAIFWEASTGKKFSFRAFP
HYSPPSNCKVEYVTIGCIFNHYQFFANNYKTKSIETCIFDLNNANRWKRM
SEEIIAIVVDNKYFEKAISGDGNNNISWNNRIPLSVSRLVASTSDVIKMS
NDLENQLRTLVSRWRSARLGTNVTSKWDDQLCYMLGQALFSYELEQLTGL
SNVGNDEFKSSIQRHVKDGYTFKAFPVHVLHINARLILDTALKSPIFQEI
INCRGSDVNLALRVKVFSYAEHSTPTWVIFGCFYQFSQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR028926CEP76-C2
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005814centriole
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0046599regulation of centriole replication
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR028926CEP76, C2 domainPFAMPF15627CEP76-C2coord: 101..259
e-value: 1.6E-30
score: 105.8
NoneNo IPR availablePANTHERPTHR46436FAMILY NOT NAMEDcoord: 15..685