Multiple PDZ domain crumbs cell polarity complex component

Overview
NameMultiple PDZ domain crumbs cell polarity complex component
Smed IDSMED30025821
Length (bp)6749
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Multiple PDZ domain crumbs cell polarity complex component (SMED30025821) t-SNE clustered cells

Violin plots show distribution of expression levels for Multiple PDZ domain crumbs cell polarity complex component (SMED30025821) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Multiple PDZ domain crumbs cell polarity complex component (SMED30025821) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Multiple PDZ domain crumbs cell polarity complex component (SMED30025821) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025821

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025821SMESG000053393.1 SmedASXL_017323SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30025821SMESG000053393.1 dd_Smed_v4_5376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025821SMESG000053393.1 dd_Smed_v4_5376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30025821SMESG000053393.1 dd_Smed_v4_5376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
anterior region of the whole animalSMED30025821SMESG000053393.1 dd_Smed_v4_5376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal cellSMED30025821SMESG000053393.1 dd_Smed_v4_5376_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025821SMESG000053393.1 dd_Smed_v6_5376_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
secretory systemSMED30025821SMESG000053393.1 dd_Smed_v6_5376_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30025821SMESG000053393.1 dd_Smed_v4_5376_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 351.673 bits (901), Expect = 1.864e-101
Identity = 250/738 (33.88%), Postives = 385/738 (52.17%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++                 S  ES E E   L S             +   +++++KI+Q+   E E  +                 + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct:   38 WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRAP------------SQSES-EPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGY---------------SWKNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPF 670          

HSP 2 Score: 75.485 bits (184), Expect = 1.188e-12
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct:  732 LGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 927          

HSP 3 Score: 56.9954 bits (136), Expect = 4.787e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AA+ DGRL  GD+I+AVNG+ L   TH++A+  L+     V L + 
Sbjct:  855 GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVL 928          

HSP 4 Score: 54.299 bits (129), Expect = 2.924e-6
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query: 1502 QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R   GP +
Sbjct:  593 KGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 671          

HSP 5 Score: 52.7582 bits (125), Expect = 9.795e-6
Identity = 87/422 (20.62%), Postives = 163/422 (38.63%), Query Frame = 2
Query: 4403 VTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPI---VFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDC--NANDEAGIYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            + ++++  + LG+SI+G +            DT    G+F++ I     A+  G+L  GD++L VNG D+   + +   + +K +   +   V  I++    S  + S ++++S   LS +        +  S     KK                                           SEI+ +R               +E+ K     +G+ + G        +  +I       VAA   +L +GD ++ I      GM+H+    ++K                    ++M  + A  + SV    + E A  +S     ++S++  Q   G      + LE+   G GF I+    + + +  IYVK V   G A+ +G L+ GD+I+ +N    E V +E+  ++LKR +G
Sbjct:  585 IELQKKPGKGLGLSIVGKR-----------NDT----GVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFHSERRPSQSSQVSEGSLSSFTFPLSGSSTSESLESSSKKNALA---------------------------------------SEIQGLRT--------------VEMKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNAS---------------GSIEMQVV-AGGDVSVVTGHQQEPA-SSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKG 921          

HSP 6 Score: 52.7582 bits (125), Expect = 9.962e-6
Identity = 26/97 (26.80%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSI 904
            +E+   R GLG S++G   T    ++I  ++    A ++G L  GD ++ ++ I++R  T ++   +LRQ+   +RL + R        E C +++I
Sbjct:  489 IEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTI 585          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 354.755 bits (909), Expect = 7.679e-98
Identity = 272/851 (31.96%), Postives = 422/851 (49.59%), Query Frame = 2
Query: 4046 GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            GD I  IN +    +       +L  +   G  IKI Y+ A+  E            EF + + Q+     S   M   I      R+        + +       ++ + N W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++                 S  ES E E   L S             +   +++++KI+Q+   E E  +S                + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1051 GDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLE------------EFKISLGQQ-----SGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSN-WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRAP------------SQSES-EPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSW---------------KNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPF 1778          

HSP 2 Score: 98.9821 bits (245), Expect = 1.039e-19
Identity = 47/113 (41.59%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSPEYCG-SMSIIPTDQIDQHLD 937
            W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR  I   ++P   G ++S  PT   +  +D
Sbjct:  252 WQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVD 364          

HSP 3 Score: 95.9005 bits (237), Expect = 9.337e-19
Identity = 58/161 (36.02%), Postives = 88/161 (54.66%), Query Frame = 2
Query: 2042 PLNQRLAKENTTKTDVLIA-----NILPNS--GFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            P+N  + KEN  K +  ++     NILP    G+ +    ++     +  E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  484 PVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRR 633          

HSP 4 Score: 92.4337 bits (228), Expect = 9.761e-18
Identity = 63/199 (31.66%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 6041 VIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL-------------------YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            V EL K    GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P     +                   +  ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  137 VFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAASTISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 335          

HSP 5 Score: 92.0485 bits (227), Expect = 1.299e-17
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 2
Query: 2846 PIKTLT-ANRSLQYLK-DVAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            P+  +T A +S + ++  +AMW   I  +EL K S+GLGFSI  YQD    AS+   VI+I SLVP G+A  DGR++PGDRL+F+N+V ++  SS +E +EAL+    G V +G+AKP+
Sbjct:  673 PVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPAST---VIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLEN-SSLEEAVEALKGAPSGTVRIGVAKPL 787          

HSP 6 Score: 84.7297 bits (208), Expect = 2.216e-15
Identity = 76/261 (29.12%), Postives = 118/261 (45.21%), Query Frame = 2
Query: 5885 RKRNSIQKVLNNQSITKKVSVNEQVIQEVP-PTKTLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYF----------KLKVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            + ++++Q V+   S+ + VS    ++   P    T++   +P   Q +   ET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     +L            +L+VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  211 KAKDTVQLVIARGSLPQLVS---PIVSRSPSAASTISAHSNPVHWQHM---ET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 7 Score: 75.8702 bits (185), Expect = 1.108e-12
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1840 LGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2035          

HSP 8 Score: 70.8626 bits (172), Expect = 3.949e-11
Identity = 110/447 (24.61%), Postives = 192/447 (42.95%), Query Frame = 2
Query: 4409 VEREQN-QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQN-ETDEKXXXXXXXXX---XXXXXTPDLS-EIEAIRNGHKSST---DESGKVMNI-------EIDKQGK-KGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIML------TIKRHPDNL----VKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQG-----YGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNA 5641
            VE  +N Q LGI+I G           +  D  L  SGIF+  I   S  E  G++ IGD++++V+G +L   +   A+  +++    ++ T   L+   M ++++                     L S+ D+ K    +P N+      + I +N E DE   S + ++    + E   P LS EIE I +  K       +  ++M I        + K  +  G+G+ L    + +  + +I            G+L  GDELL++N I +LG +H +V  I+K+  +E   +        T +   D+L    +++   P           ++E+ V   TD  Q  S   +Q         I H+ LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + 
Sbjct:  378 VELTKNVQGLGITIAG-----------YIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLT---LMRRGMKQEAE---------------------LMSREDVTKDADLSPVNA------SIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQ--STEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSG 777          

HSP 9 Score: 67.0106 bits (162), Expect = 5.088e-10
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  372 ESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 10 Score: 62.3882 bits (150), Expect = 1.420e-8
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R      + A     +  S +P    E  V+ ST + + S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++
Sbjct:  266 GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARGAIE-ERTAPTALGITLSSSPTSTPELRVDASTQKGEES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVD 432          

HSP 11 Score: 60.8474 bits (146), Expect = 4.455e-8
Identity = 35/101 (34.65%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  605 W-AELEIVELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            W A ++ +EL     GLGFS++  +      ST ++IRS+  G +AE++G L  GD LM+++D+N+   + E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  694 WEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKPLP--LSPE 792          

HSP 12 Score: 59.6918 bits (143), Expect = 8.655e-8
Identity = 59/230 (25.65%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKIN--SIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN  ++D   ++H     I++K +   + + L I R          +P  V+  V+   +S +A  T      IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  I +  A
Sbjct:  138 FELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQT-ITHQQAISILQKAK---DTVQLVIAR--------GSLPQLVSPIVS---RSPSAAST------ISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTA 343          

HSP 13 Score: 57.3806 bits (137), Expect = 4.534e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AA+ DGRL  GD+I+AVNG+ L   TH++A+  L+     V L + 
Sbjct: 1963 GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVL 2036          

HSP 14 Score: 54.299 bits (129), Expect = 3.770e-6
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query: 1502 QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R   GP +
Sbjct: 1701 KGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1779          

HSP 15 Score: 53.9138 bits (128), Expect = 5.550e-6
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     E +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   + L + R
Sbjct:  360 ELRVDASTQ--KGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 16 Score: 53.1434 bits (126), Expect = 8.520e-6
Identity = 26/97 (26.80%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSI 904
            +E+   R GLG S++G   T    ++I  ++    A ++G L  GD ++ ++ I++R  T ++   +LRQ+   +RL + R        E C +++I
Sbjct: 1597 IEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTI 1693          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 354.755 bits (909), Expect = 7.679e-98
Identity = 272/851 (31.96%), Postives = 422/851 (49.59%), Query Frame = 2
Query: 4046 GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            GD I  IN +    +       +L  +   G  IKI Y+ A+  E            EF + + Q+     S   M   I      R+        + +       ++ + N W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++                 S  ES E E   L S             +   +++++KI+Q+   E E  +S                + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1051 GDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLE------------EFKISLGQQ-----SGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSN-WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRAP------------SQSES-EPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSW---------------KNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPF 1778          

HSP 2 Score: 98.9821 bits (245), Expect = 1.039e-19
Identity = 47/113 (41.59%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSPEYCG-SMSIIPTDQIDQHLD 937
            W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR  I   ++P   G ++S  PT   +  +D
Sbjct:  252 WQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVD 364          

HSP 3 Score: 95.9005 bits (237), Expect = 9.337e-19
Identity = 58/161 (36.02%), Postives = 88/161 (54.66%), Query Frame = 2
Query: 2042 PLNQRLAKENTTKTDVLIA-----NILPNS--GFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            P+N  + KEN  K +  ++     NILP    G+ +    ++     +  E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  484 PVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRR 633          

HSP 4 Score: 92.4337 bits (228), Expect = 9.761e-18
Identity = 63/199 (31.66%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 6041 VIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL-------------------YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            V EL K    GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P     +                   +  ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  137 VFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAASTISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 335          

HSP 5 Score: 92.0485 bits (227), Expect = 1.299e-17
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 2
Query: 2846 PIKTLT-ANRSLQYLK-DVAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            P+  +T A +S + ++  +AMW   I  +EL K S+GLGFSI  YQD    AS+   VI+I SLVP G+A  DGR++PGDRL+F+N+V ++  SS +E +EAL+    G V +G+AKP+
Sbjct:  673 PVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPAST---VIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLEN-SSLEEAVEALKGAPSGTVRIGVAKPL 787          

HSP 6 Score: 84.7297 bits (208), Expect = 2.216e-15
Identity = 76/261 (29.12%), Postives = 118/261 (45.21%), Query Frame = 2
Query: 5885 RKRNSIQKVLNNQSITKKVSVNEQVIQEVP-PTKTLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYF----------KLKVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            + ++++Q V+   S+ + VS    ++   P    T++   +P   Q +   ET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     +L            +L+VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  211 KAKDTVQLVIARGSLPQLVS---PIVSRSPSAASTISAHSNPVHWQHM---ET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 7 Score: 75.8702 bits (185), Expect = 1.108e-12
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1840 LGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2035          

HSP 8 Score: 70.8626 bits (172), Expect = 3.949e-11
Identity = 110/447 (24.61%), Postives = 192/447 (42.95%), Query Frame = 2
Query: 4409 VEREQN-QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQN-ETDEKXXXXXXXXX---XXXXXTPDLS-EIEAIRNGHKSST---DESGKVMNI-------EIDKQGK-KGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIML------TIKRHPDNL----VKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQG-----YGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNA 5641
            VE  +N Q LGI+I G           +  D  L  SGIF+  I   S  E  G++ IGD++++V+G +L   +   A+  +++    ++ T   L+   M ++++                     L S+ D+ K    +P N+      + I +N E DE   S + ++    + E   P LS EIE I +  K       +  ++M I        + K  +  G+G+ L    + +  + +I            G+L  GDELL++N I +LG +H +V  I+K+  +E   +        T +   D+L    +++   P           ++E+ V   TD  Q  S   +Q         I H+ LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + 
Sbjct:  378 VELTKNVQGLGITIAG-----------YIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLT---LMRRGMKQEAE---------------------LMSREDVTKDADLSPVNA------SIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQ--STEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSG 777          

HSP 9 Score: 67.0106 bits (162), Expect = 5.088e-10
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  372 ESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 10 Score: 62.3882 bits (150), Expect = 1.420e-8
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R      + A     +  S +P    E  V+ ST + + S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++
Sbjct:  266 GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARGAIE-ERTAPTALGITLSSSPTSTPELRVDASTQKGEES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVD 432          

HSP 11 Score: 60.8474 bits (146), Expect = 4.455e-8
Identity = 35/101 (34.65%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  605 W-AELEIVELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            W A ++ +EL     GLGFS++  +      ST ++IRS+  G +AE++G L  GD LM+++D+N+   + E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  694 WEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKPLP--LSPE 792          

HSP 12 Score: 59.6918 bits (143), Expect = 8.655e-8
Identity = 59/230 (25.65%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKIN--SIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN  ++D   ++H     I++K +   + + L I R          +P  V+  V+   +S +A  T      IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  I +  A
Sbjct:  138 FELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQT-ITHQQAISILQKAK---DTVQLVIAR--------GSLPQLVSPIVS---RSPSAAST------ISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTA 343          

HSP 13 Score: 57.3806 bits (137), Expect = 4.534e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AA+ DGRL  GD+I+AVNG+ L   TH++A+  L+     V L + 
Sbjct: 1963 GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVL 2036          

HSP 14 Score: 54.299 bits (129), Expect = 3.770e-6
Identity = 30/85 (35.29%), Postives = 46/85 (54.12%), Query Frame = 2
Query: 1502 QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R   GP +
Sbjct: 1701 KGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1779          

HSP 15 Score: 53.9138 bits (128), Expect = 5.550e-6
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     E +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   + L + R
Sbjct:  360 ELRVDASTQ--KGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 16 Score: 53.1434 bits (126), Expect = 8.520e-6
Identity = 26/97 (26.80%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSI 904
            +E+   R GLG S++G   T    ++I  ++    A ++G L  GD ++ ++ I++R  T ++   +LRQ+   +RL + R        E C +++I
Sbjct: 1597 IEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTI 1693          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 353.214 bits (905), Expect = 2.657e-97
Identity = 253/748 (33.82%), Postives = 391/748 (52.27%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPL--SLNSKSDMLKKKLTTPPNSPDKA--------TSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++    + S    L +     Y      P   SL   +D   K  +   + P+KA          +   +  +D  ++S S  S   +         + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + II KC     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1160 WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIIN--RPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINAD---KAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSII-KCAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPF 1825          

HSP 2 Score: 98.9821 bits (245), Expect = 9.856e-20
Identity = 47/113 (41.59%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSPEYCG-SMSIIPTDQIDQHLD 937
            W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR  I   ++P   G ++S  PT   +  +D
Sbjct:  252 WQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVD 364          

HSP 3 Score: 95.9005 bits (237), Expect = 8.634e-19
Identity = 58/161 (36.02%), Postives = 88/161 (54.66%), Query Frame = 2
Query: 2042 PLNQRLAKENTTKTDVLIA-----NILPNS--GFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            P+N  + KEN  K +  ++     NILP    G+ +    ++     +  E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  484 PVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRR 633          

HSP 4 Score: 92.8189 bits (229), Expect = 7.887e-18
Identity = 63/199 (31.66%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 6041 VIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL-------------------YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            V EL K    GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P     +                   +  ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  137 VFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAASTISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 335          

HSP 5 Score: 92.0485 bits (227), Expect = 1.253e-17
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 2
Query: 2846 PIKTLT-ANRSLQYLK-DVAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            P+  +T A +S + ++  +AMW   I  +EL K S+GLGFSI  YQD    AS+   VI+I SLVP G+A  DGR++PGDRL+F+N+V ++  SS +E +EAL+    G V +G+AKP+
Sbjct:  673 PVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPAST---VIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLEN-SSLEEAVEALKGAPSGTVRIGVAKPL 787          

HSP 6 Score: 85.1149 bits (209), Expect = 1.820e-15
Identity = 76/261 (29.12%), Postives = 118/261 (45.21%), Query Frame = 2
Query: 5885 RKRNSIQKVLNNQSITKKVSVNEQVIQEVP-PTKTLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYF----------KLKVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            + ++++Q V+   S+ + VS    ++   P    T++   +P   Q +   ET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     +L            +L+VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  211 KAKDTVQLVIARGSLPQLVS---PIVSRSPSAASTISAHSNPVHWQHM---ET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 7 Score: 76.2554 bits (186), Expect = 9.018e-13
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1887 LGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2082          

HSP 8 Score: 71.2478 bits (173), Expect = 3.186e-11
Identity = 110/447 (24.61%), Postives = 192/447 (42.95%), Query Frame = 2
Query: 4409 VEREQN-QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQN-ETDEKXXXXXXXXX---XXXXXTPDLS-EIEAIRNGHKSST---DESGKVMNI-------EIDKQGK-KGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIML------TIKRHPDNL----VKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQG-----YGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNA 5641
            VE  +N Q LGI+I G           +  D  L  SGIF+  I   S  E  G++ IGD++++V+G +L   +   A+  +++    ++ T   L+   M ++++                     L S+ D+ K    +P N+      + I +N E DE   S + ++    + E   P LS EIE I +  K       +  ++M I        + K  +  G+G+ L    + +  + +I            G+L  GDELL++N I +LG +H +V  I+K+  +E   +        T +   D+L    +++   P           ++E+ V   TD  Q  S   +Q         I H+ LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + 
Sbjct:  378 VELTKNVQGLGITIAG-----------YIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLT---LMRRGMKQEAE---------------------LMSREDVTKDADLSPVNA------SIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQ--STEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSG 777          

HSP 9 Score: 67.0106 bits (162), Expect = 4.814e-10
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  372 ESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 10 Score: 62.3882 bits (150), Expect = 1.332e-8
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R      + A     +  S +P    E  V+ ST + + S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++
Sbjct:  266 GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARGAIE-ERTAPTALGITLSSSPTSTPELRVDASTQKGEES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVD 432          

HSP 11 Score: 60.8474 bits (146), Expect = 3.940e-8
Identity = 35/101 (34.65%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  605 W-AELEIVELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            W A ++ +EL     GLGFS++  +      ST ++IRS+  G +AE++G L  GD LM+++D+N+   + E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  694 WEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKPLP--LSPE 792          

HSP 12 Score: 60.077 bits (144), Expect = 7.216e-8
Identity = 59/230 (25.65%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKIN--SIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN  ++D   ++H     I++K +   + + L I R          +P  V+  V+   +S +A  T      IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  I +  A
Sbjct:  138 FELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQT-ITHQQAISILQKAK---DTVQLVIAR--------GSLPQLVSPIVS---RSPSAAST------ISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTA 343          

HSP 13 Score: 57.3806 bits (137), Expect = 3.941e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AA+ DGRL  GD+I+AVNG+ L   TH++A+  L+     V L + 
Sbjct: 2010 GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVL 2083          

HSP 14 Score: 54.299 bits (129), Expect = 3.564e-6
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 2
Query: 1493 KGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            K  +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R   GP +
Sbjct: 1745 KPGKGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1826          

HSP 15 Score: 53.9138 bits (128), Expect = 4.510e-6
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     E +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   + L + R
Sbjct:  360 ELRVDASTQ--KGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 16 Score: 53.5286 bits (127), Expect = 7.282e-6
Identity = 26/97 (26.80%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSI 904
            +E+   R GLG S++G   T    ++I  ++    A ++G L  GD ++ ++ I++R  T ++   +LRQ+   +RL + R        E C +++I
Sbjct: 1644 IEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTI 1740          

HSP 17 Score: 53.1434 bits (126), Expect = 9.136e-6
Identity = 34/97 (35.05%), Postives = 59/97 (60.82%), Query Frame = 2
Query:  614 LEIVELLND-RCGLGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINV-RGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSP 880
            +E+ ELL     GLGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+   + + +T +Q  +IL+++ D ++L+IAR  +P   SP
Sbjct:  135 VEVFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSP 231          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:HGNC Symbol;Acc:HGNC:7208])

HSP 1 Score: 352.829 bits (904), Expect = 3.132e-97
Identity = 274/861 (31.82%), Postives = 427/861 (49.59%), Query Frame = 2
Query: 4046 GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPL--SLNSKSDMLKKKLTTPPNSPDKA--------TSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            GD I  IN +    +       +L  +   G  IKI Y+ A+  E            EF + + Q+     S   M   I      R+        + +       ++ + N W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+  ++  + S    L +     Y      P   SL   +D   K  +   + P+KA          +   +  +D  ++S S  S   +         + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1051 GDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLE------------EFKISLGQQ-----SGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSN-WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI--INRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINAD---KAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPF 1811          

HSP 2 Score: 98.9821 bits (245), Expect = 9.513e-20
Identity = 47/113 (41.59%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSPEYCG-SMSIIPTDQIDQHLD 937
            W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR  I   ++P   G ++S  PT   +  +D
Sbjct:  252 WQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVD 364          

HSP 3 Score: 95.9005 bits (237), Expect = 9.066e-19
Identity = 58/161 (36.02%), Postives = 88/161 (54.66%), Query Frame = 2
Query: 2042 PLNQRLAKENTTKTDVLIA-----NILPNS--GFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            P+N  + KEN  K +  ++     NILP    G+ +    ++     +  E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  484 PVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRR 633          

HSP 4 Score: 92.8189 bits (229), Expect = 7.941e-18
Identity = 63/199 (31.66%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 6041 VIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL-------------------YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            V EL K    GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P     +                   +  ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  137 VFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAASTISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 335          

HSP 5 Score: 92.0485 bits (227), Expect = 1.240e-17
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 2
Query: 2846 PIKTLT-ANRSLQYLK-DVAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            P+  +T A +S + ++  +AMW   I  +EL K S+GLGFSI  YQD    AS+   VI+I SLVP G+A  DGR++PGDRL+F+N+V ++  SS +E +EAL+    G V +G+AKP+
Sbjct:  673 PVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPAST---VIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLEN-SSLEEAVEALKGAPSGTVRIGVAKPL 787          

HSP 6 Score: 85.1149 bits (209), Expect = 1.817e-15
Identity = 76/261 (29.12%), Postives = 118/261 (45.21%), Query Frame = 2
Query: 5885 RKRNSIQKVLNNQSITKKVSVNEQVIQEVP-PTKTLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYF----------KLKVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            + ++++Q V+   S+ + VS    ++   P    T++   +P   Q +   ET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     +L            +L+VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  211 KAKDTVQLVIARGSLPQLVS---PIVSRSPSAASTISAHSNPVHWQHM---ET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 7 Score: 76.2554 bits (186), Expect = 9.237e-13
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1873 LGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          

HSP 8 Score: 71.2478 bits (173), Expect = 3.130e-11
Identity = 110/447 (24.61%), Postives = 192/447 (42.95%), Query Frame = 2
Query: 4409 VEREQN-QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQN-ETDEKXXXXXXXXX---XXXXXTPDLS-EIEAIRNGHKSST---DESGKVMNI-------EIDKQGK-KGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIML------TIKRHPDNL----VKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQG-----YGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNA 5641
            VE  +N Q LGI+I G           +  D  L  SGIF+  I   S  E  G++ IGD++++V+G +L   +   A+  +++    ++ T   L+   M ++++                     L S+ D+ K    +P N+      + I +N E DE   S + ++    + E   P LS EIE I +  K       +  ++M I        + K  +  G+G+ L    + +  + +I            G+L  GDELL++N I +LG +H +V  I+K+  +E   +        T +   D+L    +++   P           ++E+ V   TD  Q  S   +Q         I H+ LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + 
Sbjct:  378 VELTKNVQGLGITIAG-----------YIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLT---LMRRGMKQEAE---------------------LMSREDVTKDADLSPVNA------SIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQ--STEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSG 777          

HSP 9 Score: 67.0106 bits (162), Expect = 4.850e-10
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  372 ESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 10 Score: 62.3882 bits (150), Expect = 1.276e-8
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R      + A     +  S +P    E  V+ ST + + S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++
Sbjct:  266 GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARGAIE-ERTAPTALGITLSSSPTSTPELRVDASTQKGEES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVD 432          

HSP 11 Score: 60.8474 bits (146), Expect = 3.936e-8
Identity = 35/101 (34.65%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  605 W-AELEIVELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            W A ++ +EL     GLGFS++  +      ST ++IRS+  G +AE++G L  GD LM+++D+N+   + E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  694 WEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKPLP--LSPE 792          

HSP 12 Score: 60.077 bits (144), Expect = 7.456e-8
Identity = 59/230 (25.65%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKIN--SIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN  ++D   ++H     I++K +   + + L I R          +P  V+  V+   +S +A  T      IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  I +  A
Sbjct:  138 FELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQT-ITHQQAISILQKAK---DTVQLVIAR--------GSLPQLVSPIVS---RSPSAAST------ISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTA 343          

HSP 13 Score: 57.3806 bits (137), Expect = 4.039e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AA+ DGRL  GD+I+AVNG+ L   TH++A+  L+     V L + 
Sbjct: 1996 GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVL 2069          

HSP 14 Score: 54.299 bits (129), Expect = 3.562e-6
Identity = 31/88 (35.23%), Postives = 47/88 (53.41%), Query Frame = 2
Query: 1493 KGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            K  +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R   GP +
Sbjct: 1731 KPGKGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPFH 1812          

HSP 15 Score: 53.9138 bits (128), Expect = 4.700e-6
Identity = 32/104 (30.77%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     E +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   + L + R
Sbjct:  360 ELRVDASTQ--KGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 16 Score: 53.5286 bits (127), Expect = 7.276e-6
Identity = 26/97 (26.80%), Postives = 51/97 (52.58%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSI 904
            +E+   R GLG S++G   T    ++I  ++    A ++G L  GD ++ ++ I++R  T ++   +LRQ+   +RL + R        E C +++I
Sbjct: 1630 IEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTI 1726          

HSP 17 Score: 53.1434 bits (126), Expect = 9.284e-6
Identity = 34/97 (35.05%), Postives = 59/97 (60.82%), Query Frame = 2
Query:  614 LEIVELLND-RCGLGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINV-RGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSP 880
            +E+ ELL     GLGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+   + + +T +Q  +IL+++ D ++L+IAR  +P   SP
Sbjct:  135 VEVFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSP 231          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 173.711 bits (439), Expect = 8.577e-46
Identity = 94/187 (50.27%), Postives = 129/187 (68.98%), Query Frame = 2
Query: 6029 GVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----QPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            G ET+IE+ KD +GLGLSI+GG+DT+LGTV+IHEV+   AAA DGRL  GD++L VNG  LR  THDQ+I  LR    +V+L I+RD       L    +Y   ++DL+KK+ +GLGI+IV  K++ GV +S++VKG +AE DGRL  GD +LE+N  +VR   Q+ VA +LK  +G V L +GR +
Sbjct:   35 GRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 221          

HSP 2 Score: 56.225 bits (134), Expect = 2.206e-7
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+  D  GLG S++G   T    VVI  ++S   A  +G L+ GD ++ ++  ++RG+T +Q  A LR++   +RL+I R
Sbjct:   39 MIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 120          

HSP 3 Score: 52.373 bits (124), Expect = 3.432e-6
Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G K+  GV +  I  G +AE +G L  GD ++ ++  +VRG   E VAA+L+  +  + L + R
Sbjct:  149 GLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR 219          

HSP 4 Score: 51.2174 bits (121), Expect = 8.462e-6
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 2
Query: 2216 YDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            Y+I  I  + KT  GLGIS         + G +++P  Y+  I   G    DG   +GD++LE NGK + G   ++V   LK++  +V +   R K
Sbjct:  135 YNIFEIDLVKKTGRGLGIS---------IVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 221          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 176.792 bits (447), Expect = 3.043e-44
Identity = 94/187 (50.27%), Postives = 129/187 (68.98%), Query Frame = 2
Query: 6029 GVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----QPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            G ET+IE+ KD +GLGLSI+GG+DT+LGTV+IHEV+   AAA DGRL  GD++L VNG  LR  THDQ+I  LR    +V+L I+RD       L    +Y   ++DL+KK+ +GLGI+IV  K++ GV +S++VKG +AE DGRL  GD +LE+N  +VR   Q+ VA +LK  +G V L +GR +
Sbjct:  545 GRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 731          

HSP 2 Score: 101.293 bits (251), Expect = 5.881e-21
Identity = 48/102 (47.06%), Postives = 70/102 (68.63%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W   R VT+ RE N+S GISI+GG+V  V +K       N V GIFI  + P+SPA + GQ+N+GDR++SVN +DL   +++ A++ IKNA++P+ F +QSL
Sbjct:   29 WGEARTVTLVREPNKSFGISIVGGRV-EVSQKGGLPGTGNTVCGIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRFVLQSL 129          

HSP 3 Score: 70.8626 bits (172), Expect = 1.091e-11
Identity = 66/233 (28.33%), Postives = 106/233 (45.49%), Query Frame = 2
Query: 4988 ESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELV---VNEDYDSVLKRLRGCKNALEMVVGRITISQ 5677
            E+G+   IEIDK GK G+GL +VG  D       I     +  AA DG+L  GD++L++N   + G++H      +++      K+ L I R              VN                    Q+S  +  Q Y +IF + L K   G G  I      +E G+YV ++   G+A ++G L  GD+IL +N + V   + ED  ++LK + G    + + +GR  I++
Sbjct:  543 ENGRETMIEIDKDGK-GLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRT---PPKVRLLIYR-------------DVNL-------------------QLSLLDPTQIY-NIFEIDLVKKT-GRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITG---KVHLKLGRWKITE 734          

HSP 4 Score: 56.6102 bits (135), Expect = 2.577e-7
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+  D  GLG S++G   T    VVI  ++S   A  +G L+ GD ++ ++  ++RG+T +Q  A LR++   +RL+I R
Sbjct:  549 MIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 630          

HSP 5 Score: 55.0694 bits (131), Expect = 7.412e-7
Identity = 51/238 (21.43%), Postives = 100/238 (42.02%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASV------------NTSVAPCEKSENAVETSTD----ENQISSNNNLQGY-------------GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            G+G+ L GNKD    N ++   + +   A+      GDELL+IN   +  +SH   + ++++C  + + I + ++R    L + A    ++             +++AP E    A +  T     EN   +   L                G    + ++K  +G G  I+         + + +V  DG AA++G L+ GD++L +N   +    +D  +  LR     + +++ R
Sbjct:  397 GLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAVRSDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 630          

HSP 6 Score: 52.7582 bits (125), Expect = 3.786e-6
Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G K+  GV +  I  G +AE +G L  GD ++ ++  +VRG   E VAA+L+  +  + L + R
Sbjct:  659 GLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR 729          

HSP 7 Score: 51.6026 bits (122), Expect = 8.591e-6
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 2
Query: 2216 YDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            Y+I  I  + KT  GLGIS         + G +++P  Y+  I   G    DG   +GD++LE NGK + G   ++V   LK++  +V +   R K
Sbjct:  645 YNIFEIDLVKKTGRGLGIS---------IVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 731          

HSP 8 Score: 51.2174 bits (121), Expect = 9.918e-6
Identity = 28/84 (33.33%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 1487 LTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY 1738
            + K  +GLG++I G        N  G++V  I K  +A+ +G+++  DQI+E+N + V G     V  +LK  +G V LK  R+
Sbjct:  653 VKKTGRGLGISIVGR------KNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 730          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 176.407 bits (446), Expect = 7.856e-44
Identity = 94/187 (50.27%), Postives = 129/187 (68.98%), Query Frame = 2
Query: 6029 GVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----QPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            G ET+IE+ KD +GLGLSI+GG+DT+LGTV+IHEV+   AAA DGRL  GD++L VNG  LR  THDQ+I  LR    +V+L I+RD       L    +Y   ++DL+KK+ +GLGI+IV  K++ GV +S++VKG +AE DGRL  GD +LE+N  +VR   Q+ VA +LK  +G V L +GR +
Sbjct:  974 GRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 1160          

HSP 2 Score: 100.908 bits (250), Expect = 8.944e-21
Identity = 48/102 (47.06%), Postives = 70/102 (68.63%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W   R VT+ RE N+S GISI+GG+V  V +K       N V GIFI  + P+SPA + GQ+N+GDR++SVN +DL   +++ A++ IKNA++P+ F +QSL
Sbjct:  458 WGEARTVTLVREPNKSFGISIVGGRV-EVSQKGGLPGTGNTVCGIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRFVLQSL 558          

HSP 3 Score: 70.8626 bits (172), Expect = 1.194e-11
Identity = 69/248 (27.82%), Postives = 112/248 (45.16%), Query Frame = 2
Query: 4988 ESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELV---VNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISK 5722
            E+G+   IEIDK GK G+GL +VG  D       I     +  AA DG+L  GD++L++N   + G++H      +++      K+ L I R              VN                    Q+S  +  Q Y +IF + L K   G G  I      +E G+YV ++   G+A ++G L  GD+IL +N + V   + ED  ++LK + G    + + +GR  I++  A  +    Q ++K
Sbjct:  972 ENGRETMIEIDKDGK-GLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRT---PPKVRLLIYR-------------DVNL-------------------QLSLLDPTQIY-NIFEIDLVKKT-GRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITG---KVHLKLGRWKITET-ANRVHAATQALAK 1177          

HSP 4 Score: 56.9954 bits (136), Expect = 2.186e-7
Identity = 28/84 (33.33%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI 862
            ++E+  D  GLG S++G   T    VVI  ++S   A  +G L+ GD ++ ++  ++RG+T +Q  A LR++   +RL+I R +
Sbjct:  978 MIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYRDV 1061          

HSP 5 Score: 55.0694 bits (131), Expect = 7.732e-7
Identity = 51/238 (21.43%), Postives = 100/238 (42.02%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASV------------NTSVAPCEKSENAVETSTD----ENQISSNNNLQGY-------------GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            G+G+ L GNKD    N ++   + +   A+      GDELL+IN   +  +SH   + ++++C  + + I + ++R    L + A    ++             +++AP E    A +  T     EN   +   L                G    + ++K  +G G  I+         + + +V  DG AA++G L+ GD++L +N   +    +D  +  LR     + +++ R
Sbjct:  826 GLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAVRSDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 1059          

HSP 6 Score: 52.7582 bits (125), Expect = 3.551e-6
Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G K+  GV +  I  G +AE +G L  GD ++ ++  +VRG   E VAA+L+  +  + L + R
Sbjct: 1088 GLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR 1158          

HSP 7 Score: 51.9878 bits (123), Expect = 6.678e-6
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 2
Query: 2216 YDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            Y+I  I  + KT  GLGIS         + G +++P  Y+  I   G    DG   +GD++LE NGK + G   ++V   LK++  +V +   R K
Sbjct: 1074 YNIFEIDLVKKTGRGLGIS---------IVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 1160          

HSP 8 Score: 51.9878 bits (123), Expect = 7.705e-6
Identity = 28/84 (33.33%), Postives = 46/84 (54.76%), Query Frame = 2
Query: 1487 LTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY 1738
            + K  +GLG++I G        N  G++V  I K  +A+ +G+++  DQI+E+N + V G     V  +LK  +G V LK  R+
Sbjct: 1082 VKKTGRGLGISIVGR------KNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRW 1159          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 177.178 bits (448), Expect = 8.187e-44
Identity = 94/187 (50.27%), Postives = 129/187 (68.98%), Query Frame = 2
Query: 6029 GVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----QPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            G ET+IE+ KD +GLGLSI+GG+DT+LGTV+IHEV+   AAA DGRL  GD++L VNG  LR  THDQ+I  LR    +V+L I+RD       L    +Y   ++DL+KK+ +GLGI+IV  K++ GV +S++VKG +AE DGRL  GD +LE+N  +VR   Q+ VA +LK  +G V L +GR +
Sbjct: 1767 GRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 1953          

HSP 2 Score: 101.293 bits (251), Expect = 8.375e-21
Identity = 48/102 (47.06%), Postives = 70/102 (68.63%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W   R VT+ RE N+S GISI+GG+V  V +K       N V GIFI  + P+SPA + GQ+N+GDR++SVN +DL   +++ A++ IKNA++P+ F +QSL
Sbjct: 1251 WGEARTVTLVREPNKSFGISIVGGRV-EVSQKGGLPGTGNTVCGIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRFVLQSL 1351          

HSP 3 Score: 92.0485 bits (227), Expect = 5.572e-18
Identity = 54/145 (37.24%), Postives = 87/145 (60.00%), Query Frame = 2
Query: 2789 KAKSDNSIFVKSNSFSEMLP-IKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDAS-SNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYS 3214
            KAKSD  +       + +L  +     ++SL+    +A+W+  P+++ L K+S+GLGFSI  Y+D +  +  VIV+ SLVP GVA  DGR++PGDRL+F+N  ++   SS +  +  L++   G V LG+AKP+      + S+S
Sbjct:  580 KAKSDIDLTSTRAETTHLLQRVSRRLRSKSLENFHGLAVWNCVPLVIHLCKDSRGLGFSIVDYKDPTHRDESVIVVQSLVPGGVAQADGRVVPGDRLLFVNNHDLSN-SSLERAVAVLKAARMGPVRLGLAKPIPVDQSQFTSHS 723          

HSP 4 Score: 77.0258 bits (188), Expect = 1.941e-13
Identity = 40/96 (41.67%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  593 LNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSP 880
            L+ +W ++E++ L  +  GLGF ++G  STGVV+++I  GS A+++G L+ GDH++ I +IN  GM+S+QVA ILR     + +I+ RPI     P
Sbjct:   21 LSGDWTQVEVIHLNTETGGLGFGIVGGTSTGVVVKTILPGSPADKDGRLQPGDHILQIGNINSHGMSSQQVATILRHQHPTVDMIVGRPIAYADKP 116          

HSP 5 Score: 72.7886 bits (177), Expect = 3.968e-12
Identity = 52/173 (30.06%), Postives = 84/173 (48.55%), Query Frame = 2
Query: 2006 SEDEAEISILDFPLNQRLAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINKTNE----GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHG---VPYQEVLTSLKSLPNRVQIVAARRKE 2503
            S D+ ++ ++ FPL+   A+            +L       Q +++K ++ D   E      W   IG + +I+ + +    +    GLGISLEGTVDV  + G +  PHHYI +I  DGP+      ++GDELL+ N   L+G   V  ++ LT        V ++ ARR +
Sbjct:  395 SGDQVKLKLVRFPLSSPQAQ---------CLKMLQQQETETQVIDVKLSNPDLVKE------WKSRIGDDIEIIAAVVKPDRQSVDGGLGISLEGTVDV--LNGAQLCPHHYIESIRQDGPVAKTKVLQAGDELLQVNHSPLYGESHVTVRQALTRAVHSGAPVTLIVARRSQ 550          

HSP 6 Score: 72.0182 bits (175), Expect = 6.853e-12
Identity = 69/248 (27.82%), Postives = 112/248 (45.16%), Query Frame = 2
Query: 4988 ESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELV---VNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISK 5722
            E+G+   IEIDK GK G+GL +VG  D       I     +  AA DG+L  GD++L++N   + G++H      +++      K+ L I R              VN                    Q+S  +  Q Y +IF + L K   G G  I      +E G+YV ++   G+A ++G L  GD+IL +N + V   + ED  ++LK + G    + + +GR  I++  A  +    Q ++K
Sbjct: 1765 ENGRETMIEIDKDGK-GLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRT---PPKVRLLIYR-------------DVNL-------------------QLSLLDPTQIY-NIFEIDLVKKT-GRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITG---KVHLKLGRWKITET-ANRVHAATQALAK 1970          

HSP 7 Score: 56.9954 bits (136), Expect = 2.261e-7
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+  D  GLG S++G   T    VVI  ++S   A  +G L+ GD ++ ++  ++RG+T +Q  A LR++   +RL+I R
Sbjct: 1771 MIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 1852          

HSP 8 Score: 55.4546 bits (132), Expect = 6.198e-7
Identity = 51/238 (21.43%), Postives = 100/238 (42.02%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASV------------NTSVAPCEKSENAVETSTD----ENQISSNNNLQGY-------------GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            G+G+ L GNKD    N ++   + +   A+      GDELL+IN   +  +SH   + ++++C  + + I + ++R    L + A    ++             +++AP E    A +  T     EN   +   L                G    + ++K  +G G  I+         + + +V  DG AA++G L+ GD++L +N   +    +D  +  LR     + +++ R
Sbjct: 1619 GLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAVRSDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 1852          

HSP 9 Score: 52.373 bits (124), Expect = 5.991e-6
Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G K+  GV +  I  G +AE +G L  GD ++ ++  +VRG   E VAA+L+  +  + L + R
Sbjct: 1881 GLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR 1951          

HSP 10 Score: 51.9878 bits (123), Expect = 8.245e-6
Identity = 30/78 (38.46%), Postives = 46/78 (58.97%), Query Frame = 2
Query: 1505 GLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY 1738
            GLG+T+AGY+  + E  I GIFVKS+   S A  +G I ++D I+E+N  ++  + +   V  L  +   VKLK  R+
Sbjct:  331 GLGITVAGYVHKKEE--IGGIFVKSLVPRSAASSSGVIKVHDLILEVNGTTLEHMSHADSVRTLVKSGDQVKLKLVRF 406          

HSP 11 Score: 51.6026 bits (122), Expect = 9.919e-6
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 2
Query: 2216 YDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            Y+I  I  + KT  GLGIS         + G +++P  Y+  I   G    DG   +GD++LE NGK + G   ++V   LK++  +V +   R K
Sbjct: 1867 YNIFEIDLVKKTGRGLGIS---------IVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 1953          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Match: mpz-1 (Multiple PDZ domain protein [Source:UniProtKB/TrEMBL;Acc:G1K0W2])

HSP 1 Score: 177.178 bits (448), Expect = 8.385e-44
Identity = 94/187 (50.27%), Postives = 129/187 (68.98%), Query Frame = 2
Query: 6029 GVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----QPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            G ET+IE+ KD +GLGLSI+GG+DT+LGTV+IHEV+   AAA DGRL  GD++L VNG  LR  THDQ+I  LR    +V+L I+RD       L    +Y   ++DL+KK+ +GLGI+IV  K++ GV +S++VKG +AE DGRL  GD +LE+N  +VR   Q+ VA +LK  +G V L +GR +
Sbjct: 1936 GRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYRDVNLQLSLLDPTQIYNIFEIDLVKKTGRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 2122          

HSP 2 Score: 101.293 bits (251), Expect = 8.313e-21
Identity = 48/102 (47.06%), Postives = 70/102 (68.63%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W   R VT+ RE N+S GISI+GG+V  V +K       N V GIFI  + P+SPA + GQ+N+GDR++SVN +DL   +++ A++ IKNA++P+ F +QSL
Sbjct: 1420 WGEARTVTLVREPNKSFGISIVGGRV-EVSQKGGLPGTGNTVCGIFIKSVLPNSPAGRSGQMNMGDRVISVNDVDLRDATHEQAVNAIKNASNPVRFVLQSL 1520          

HSP 3 Score: 92.0485 bits (227), Expect = 5.248e-18
Identity = 54/145 (37.24%), Postives = 87/145 (60.00%), Query Frame = 2
Query: 2789 KAKSDNSIFVKSNSFSEMLP-IKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDAS-SNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYS 3214
            KAKSD  +       + +L  +     ++SL+    +A+W+  P+++ L K+S+GLGFSI  Y+D +  +  VIV+ SLVP GVA  DGR++PGDRL+F+N  ++   SS +  +  L++   G V LG+AKP+      + S+S
Sbjct:  749 KAKSDIDLTSTRAETTHLLQRVSRRLRSKSLENFHGLAVWNCVPLVIHLCKDSRGLGFSIVDYKDPTHRDESVIVVQSLVPGGVAQADGRVVPGDRLLFVNNHDLSN-SSLERAVAVLKAARMGPVRLGLAKPIPVDQSQFTSHS 892          

HSP 4 Score: 77.411 bits (189), Expect = 1.489e-13
Identity = 40/97 (41.24%), Postives = 65/97 (67.01%), Query Frame = 2
Query:  590 MLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSP 880
            +L+ +W ++E++ L  +  GLGF ++G  STGVV+++I  GS A+++G L+ GDH++ I +IN  GM+S+QVA ILR     + +I+ RPI     P
Sbjct:  211 VLSGDWTQVEVIHLNTETGGLGFGIVGGTSTGVVVKTILPGSPADKDGRLQPGDHILQIGNINSHGMSSQQVATILRHQHPTVDMIVGRPIAYADKP 307          

HSP 5 Score: 72.7886 bits (177), Expect = 3.336e-12
Identity = 52/173 (30.06%), Postives = 84/173 (48.55%), Query Frame = 2
Query: 2006 SEDEAEISILDFPLNQRLAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINKTNE----GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHG---VPYQEVLTSLKSLPNRVQIVAARRKE 2503
            S D+ ++ ++ FPL+   A+            +L       Q +++K ++ D   E      W   IG + +I+ + +    +    GLGISLEGTVDV  + G +  PHHYI +I  DGP+      ++GDELL+ N   L+G   V  ++ LT        V ++ ARR +
Sbjct:  564 SGDQVKLKLVRFPLSSPQAQ---------CLKMLQQQETETQVIDVKLSNPDLVKE------WKSRIGDDIEIIAAVVKPDRQSVDGGLGISLEGTVDV--LNGAQLCPHHYIESIRQDGPVAKTKVLQAGDELLQVNHSPLYGESHVTVRQALTRAVHSGAPVTLIVARRSQ 719          

HSP 6 Score: 71.633 bits (174), Expect = 7.289e-12
Identity = 69/248 (27.82%), Postives = 112/248 (45.16%), Query Frame = 2
Query: 4988 ESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELV---VNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISK 5722
            E+G+   IEIDK GK G+GL +VG  D       I     +  AA DG+L  GD++L++N   + G++H      +++      K+ L I R              VN                    Q+S  +  Q Y +IF + L K   G G  I      +E G+YV ++   G+A ++G L  GD+IL +N + V   + ED  ++LK + G    + + +GR  I++  A  +    Q ++K
Sbjct: 1934 ENGRETMIEIDKDGK-GLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRT---PPKVRLLIYR-------------DVNL-------------------QLSLLDPTQIY-NIFEIDLVKKT-GRGLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITG---KVHLKLGRWKITET-ANRVHAATQALAK 2139          

HSP 7 Score: 56.9954 bits (136), Expect = 2.338e-7
Identity = 28/82 (34.15%), Postives = 49/82 (59.76%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+  D  GLG S++G   T    VVI  ++S   A  +G L+ GD ++ ++  ++RG+T +Q  A LR++   +RL+I R
Sbjct: 1940 MIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 2021          

HSP 8 Score: 55.4546 bits (132), Expect = 6.092e-7
Identity = 51/238 (21.43%), Postives = 100/238 (42.02%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASV------------NTSVAPCEKSENAVETSTD----ENQISSNNNLQGY-------------GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            G+G+ L GNKD    N ++   + +   A+      GDELL+IN   +  +SH   + ++++C  + + I + ++R    L + A    ++             +++AP E    A +  T     EN   +   L                G    + ++K  +G G  I+         + + +V  DG AA++G L+ GD++L +N   +    +D  +  LR     + +++ R
Sbjct: 1788 GLGISLAGNKDRDKQNVFVVNVRPSCPLAI----RPGDELLEINGRLLNKISHVAASAVVRECCDQHQNIEIVLRRRNGALNECAVRSDTITSSQSLPSPPTSPSTLAPSESKSTAPQMPTTTEGIENAAPNQEELSRKKSFSQERTQAIENGRETMIEIDKDGKGLGLSIVGGADTVLGTVVIHEVYSDGAAAHDGRLKPGDQVLEVNGTSLRGVTHDQSIAYLRRTPPKVRLLIYR 2021          

HSP 9 Score: 52.373 bits (124), Expect = 6.086e-6
Identity = 26/71 (36.62%), Postives = 42/71 (59.15%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G K+  GV +  I  G +AE +G L  GD ++ ++  +VRG   E VAA+L+  +  + L + R
Sbjct: 2050 GLGISIVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGR 2120          

HSP 10 Score: 51.9878 bits (123), Expect = 7.830e-6
Identity = 30/78 (38.46%), Postives = 46/78 (58.97%), Query Frame = 2
Query: 1505 GLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY 1738
            GLG+T+AGY+  + E  I GIFVKS+   S A  +G I ++D I+E+N  ++  + +   V  L  +   VKLK  R+
Sbjct:  500 GLGITVAGYVHKKEE--IGGIFVKSLVPRSAASSSGVIKVHDLILEVNGTTLEHMSHADSVRTLVKSGDQVKLKLVRF 575          

HSP 11 Score: 51.6026 bits (122), Expect = 9.420e-6
Identity = 31/96 (32.29%), Postives = 48/96 (50.00%), Query Frame = 2
Query: 2216 YDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            Y+I  I  + KT  GLGIS         + G +++P  Y+  I   G    DG   +GD++LE NGK + G   ++V   LK++  +V +   R K
Sbjct: 2036 YNIFEIDLVKKTGRGLGIS---------IVGRKNEPGVYVSEIVKGGLAESDGRLMTGDQILEVNGKDVRGCMQEDVAAMLKTITGKVHLKLGRWK 2122          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: Patj (gene:FBgn0067864 transcript:FBtr0072781)

HSP 1 Score: 172.94 bits (437), Expect = 3.279e-43
Identity = 120/360 (33.33%), Postives = 181/360 (50.28%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVP-PSAQLANSSSEDEAEISILD-FPLNQRLAKENTT---KTDVLIANILP--------NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK-TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            E  +    L K   GLG+TIAGY+ C  E  + GIFVKS+S  S ADL+G+I +ND+IIE++ QS+ G  N   VE+LK +  +V L+  RY +GP +E L Q                       +N  + +S   T     +   + T  S   +P  +    ++   +P P A +    S      + L  F   ++L     +    T ++   ++P        NSG   +        +    E  I   W KI+G + +++++ I K    GLGISLEGTVDV+   G E +PHHYIR+I  DGP+G++G  +SGDELLE NG++L G+ + EV+  LK LP  V++V  R +
Sbjct:  313 ETEKLQVELKKDANGLGITIAGYV-CEKE-ELSGIFVKSVSPGSAADLSGRIRVNDRIIEVDGQSLQGYSNHQAVELLKKSGQVVNLRLERYLRGPKFEQLQQA--------------------IAANDKLPSSAPGTPSRAPMPTPVATTSSATTTPSRSITRELEEEALPAPEAFMTTPPSVTTMTTTTLSSFGAGKQLVAVRDSLDGSTKIIPTEVVPLADKTEAKNSGVITRHKYYTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDVE--GGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGRNR 648          

HSP 2 Score: 117.857 bits (294), Expect = 5.305e-26
Identity = 48/113 (42.48%), Postives = 84/113 (74.34%), Query Frame = 2
Query:  584 TDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIP-NCSSPEYC--GSMSIIPT 913
             D+  T++A+++ +EL+ND  GLGF ++G++++GV++++I  G VA+++G LR GDH++ I D+N+  M SEQVAA+LRQS  H+RL++ARP+  +  +P+Y      +++PT
Sbjct:  137 ADLYATDYAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVARPVEQSVPTPQYALEPGTAVVPT 249          

HSP 3 Score: 107.071 bits (266), Expect = 9.450e-23
Identity = 66/147 (44.90%), Postives = 89/147 (60.54%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSN------------SFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            + KAKSD S+    +            SFS++        +RSL+ L  +AMWS  P ++EL K  +GLGFSI  YQD    N  +IVI SLVP GVA LDGR+IPGDRL+F+N + ++  S  Q V +AL+  SKG V +G+AKP+
Sbjct:  677 LVKAKSDGSLATAGSVADGDSVAAAAASFSKL-------KSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAV-QALKGASKGVVRIGVAKPL 815          

HSP 4 Score: 59.6918 bits (143), Expect = 3.174e-8
Identity = 28/84 (33.33%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 6314 YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            Y +++   L     GLG  I+   + GV +  ++ G +A++DGRL+ GD +L+I D N+     +QVA +L++   +V L+V R
Sbjct:  144 YAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVAR 227          

HSP 5 Score: 56.9954 bits (136), Expect = 2.400e-7
Identity = 31/95 (32.63%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  605 WA-ELEIVELLNDRCGLGFSLMGSKS------TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDH-IRLIIARPIP 865
            W+ + +I+EL+    GLGFS++  +       T +VIRS+  G VA+ +G L  GD L++++ IN+   + +Q    L+ +S   +R+ +A+P+P
Sbjct:  722 WSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLP 816          

HSP 6 Score: 54.6842 bits (130), Expect = 1.240e-6
Identity = 37/95 (38.95%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 6041 VIELTK-DRGLGLSIIGGSDTILGT---VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL 6313
            +IEL K DRGLG SI+   D +      ++I  +     A LDGRL  GDR+L VN  +L NA+ DQA+Q L+     V         P+ ++SL
Sbjct:  728 IIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSL 822          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: Patj (gene:FBgn0067864 transcript:FBtr0301625)

HSP 1 Score: 172.94 bits (437), Expect = 3.279e-43
Identity = 120/360 (33.33%), Postives = 181/360 (50.28%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVP-PSAQLANSSSEDEAEISILD-FPLNQRLAKENTT---KTDVLIANILP--------NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK-TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            E  +    L K   GLG+TIAGY+ C  E  + GIFVKS+S  S ADL+G+I +ND+IIE++ QS+ G  N   VE+LK +  +V L+  RY +GP +E L Q                       +N  + +S   T     +   + T  S   +P  +    ++   +P P A +    S      + L  F   ++L     +    T ++   ++P        NSG   +        +    E  I   W KI+G + +++++ I K    GLGISLEGTVDV+   G E +PHHYIR+I  DGP+G++G  +SGDELLE NG++L G+ + EV+  LK LP  V++V  R +
Sbjct:  313 ETEKLQVELKKDANGLGITIAGYV-CEKE-ELSGIFVKSVSPGSAADLSGRIRVNDRIIEVDGQSLQGYSNHQAVELLKKSGQVVNLRLERYLRGPKFEQLQQA--------------------IAANDKLPSSAPGTPSRAPMPTPVATTSSATTTPSRSITRELEEEALPAPEAFMTTPPSVTTMTTTTLSSFGAGKQLVAVRDSLDGSTKIIPTEVVPLADKTEAKNSGVITRHKYYTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDVE--GGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGRNR 648          

HSP 2 Score: 117.857 bits (294), Expect = 5.305e-26
Identity = 48/113 (42.48%), Postives = 84/113 (74.34%), Query Frame = 2
Query:  584 TDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIP-NCSSPEYC--GSMSIIPT 913
             D+  T++A+++ +EL+ND  GLGF ++G++++GV++++I  G VA+++G LR GDH++ I D+N+  M SEQVAA+LRQS  H+RL++ARP+  +  +P+Y      +++PT
Sbjct:  137 ADLYATDYAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVARPVEQSVPTPQYALEPGTAVVPT 249          

HSP 3 Score: 107.071 bits (266), Expect = 9.450e-23
Identity = 66/147 (44.90%), Postives = 89/147 (60.54%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSN------------SFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            + KAKSD S+    +            SFS++        +RSL+ L  +AMWS  P ++EL K  +GLGFSI  YQD    N  +IVI SLVP GVA LDGR+IPGDRL+F+N + ++  S  Q V +AL+  SKG V +G+AKP+
Sbjct:  677 LVKAKSDGSLATAGSVADGDSVAAAAASFSKL-------KSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAV-QALKGASKGVVRIGVAKPL 815          

HSP 4 Score: 59.6918 bits (143), Expect = 3.174e-8
Identity = 28/84 (33.33%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 6314 YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            Y +++   L     GLG  I+   + GV +  ++ G +A++DGRL+ GD +L+I D N+     +QVA +L++   +V L+V R
Sbjct:  144 YAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVAR 227          

HSP 5 Score: 56.9954 bits (136), Expect = 2.400e-7
Identity = 31/95 (32.63%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  605 WA-ELEIVELLNDRCGLGFSLMGSKS------TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDH-IRLIIARPIP 865
            W+ + +I+EL+    GLGFS++  +       T +VIRS+  G VA+ +G L  GD L++++ IN+   + +Q    L+ +S   +R+ +A+P+P
Sbjct:  722 WSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLP 816          

HSP 6 Score: 54.6842 bits (130), Expect = 1.240e-6
Identity = 37/95 (38.95%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 6041 VIELTK-DRGLGLSIIGGSDTILGT---VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL 6313
            +IEL K DRGLG SI+   D +      ++I  +     A LDGRL  GDR+L VN  +L NA+ DQA+Q L+     V         P+ ++SL
Sbjct:  728 IIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSL 822          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: Patj (gene:FBgn0067864 transcript:FBtr0072779)

HSP 1 Score: 172.94 bits (437), Expect = 3.279e-43
Identity = 120/360 (33.33%), Postives = 181/360 (50.28%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVP-PSAQLANSSSEDEAEISILD-FPLNQRLAKENTT---KTDVLIANILP--------NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK-TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            E  +    L K   GLG+TIAGY+ C  E  + GIFVKS+S  S ADL+G+I +ND+IIE++ QS+ G  N   VE+LK +  +V L+  RY +GP +E L Q                       +N  + +S   T     +   + T  S   +P  +    ++   +P P A +    S      + L  F   ++L     +    T ++   ++P        NSG   +        +    E  I   W KI+G + +++++ I K    GLGISLEGTVDV+   G E +PHHYIR+I  DGP+G++G  +SGDELLE NG++L G+ + EV+  LK LP  V++V  R +
Sbjct:  313 ETEKLQVELKKDANGLGITIAGYV-CEKE-ELSGIFVKSVSPGSAADLSGRIRVNDRIIEVDGQSLQGYSNHQAVELLKKSGQVVNLRLERYLRGPKFEQLQQA--------------------IAANDKLPSSAPGTPSRAPMPTPVATTSSATTTPSRSITRELEEEALPAPEAFMTTPPSVTTMTTTTLSSFGAGKQLVAVRDSLDGSTKIIPTEVVPLADKTEAKNSGVITRHKYYTDPELSDDAETEIIRKWQKIVGSDVEVIVAQIKKFAVGGLGISLEGTVDVE--GGREVRPHHYIRSILPDGPVGVNGVLRSGDELLEVNGERLLGMNHLEVVAILKELPLDVRMVCGRNR 648          

HSP 2 Score: 117.857 bits (294), Expect = 5.305e-26
Identity = 48/113 (42.48%), Postives = 84/113 (74.34%), Query Frame = 2
Query:  584 TDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIP-NCSSPEYC--GSMSIIPT 913
             D+  T++A+++ +EL+ND  GLGF ++G++++GV++++I  G VA+++G LR GDH++ I D+N+  M SEQVAA+LRQS  H+RL++ARP+  +  +P+Y      +++PT
Sbjct:  137 ADLYATDYAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVARPVEQSVPTPQYALEPGTAVVPT 249          

HSP 3 Score: 107.071 bits (266), Expect = 9.450e-23
Identity = 66/147 (44.90%), Postives = 89/147 (60.54%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSN------------SFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            + KAKSD S+    +            SFS++        +RSL+ L  +AMWS  P ++EL K  +GLGFSI  YQD    N  +IVI SLVP GVA LDGR+IPGDRL+F+N + ++  S  Q V +AL+  SKG V +G+AKP+
Sbjct:  677 LVKAKSDGSLATAGSVADGDSVAAAAASFSKL-------KSRSLEPLTGLAMWSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAV-QALKGASKGVVRIGVAKPL 815          

HSP 4 Score: 59.6918 bits (143), Expect = 3.174e-8
Identity = 28/84 (33.33%), Postives = 49/84 (58.33%), Query Frame = 2
Query: 6314 YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            Y +++   L     GLG  I+   + GV +  ++ G +A++DGRL+ GD +L+I D N+     +QVA +L++   +V L+V R
Sbjct:  144 YAQIQAIELVNDGTGLGFGIIGARNSGVIVKTILPGGVADKDGRLRSGDHILQIGDVNLHEMVSEQVAAVLRQSGTHVRLVVAR 227          

HSP 5 Score: 56.9954 bits (136), Expect = 2.400e-7
Identity = 31/95 (32.63%), Postives = 57/95 (60.00%), Query Frame = 2
Query:  605 WA-ELEIVELLNDRCGLGFSLMGSKS------TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDH-IRLIIARPIP 865
            W+ + +I+EL+    GLGFS++  +       T +VIRS+  G VA+ +G L  GD L++++ IN+   + +Q    L+ +S   +R+ +A+P+P
Sbjct:  722 WSSQPQIIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLP 816          

HSP 6 Score: 54.6842 bits (130), Expect = 1.240e-6
Identity = 37/95 (38.95%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 6041 VIELTK-DRGLGLSIIGGSDTILGT---VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL 6313
            +IEL K DRGLG SI+   D +      ++I  +     A LDGRL  GDR+L VN  +L NA+ DQA+Q L+     V         P+ ++SL
Sbjct:  728 IIELVKGDRGLGFSILDYQDPLDPNDTLIVIRSLVPGGVAQLDGRLIPGDRLLFVNSINLENASLDQAVQALKGASKGVVRIGVAKPLPMTDNSL 822          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: CG15803 (gene:FBgn0038606 transcript:FBtr0302308)

HSP 1 Score: 120.939 bits (302), Expect = 5.969e-27
Identity = 49/91 (53.85%), Postives = 76/91 (83.52%), Query Frame = 2
Query:  590 MLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI 862
            +L+TEW+++E+++L+ND  GLGF L+G +STGVVI+++  G VAER+G L++GDHL+ I ++N+RG +SEQVA +LRQ+   +RLI+ARP+
Sbjct:    2 VLSTEWSQVEVIDLINDGNGLGFILVGGRSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQTGAQVRLIVARPV 92          

HSP 2 Score: 91.6633 bits (226), Expect = 5.214e-18
Identity = 45/81 (55.56%), Postives = 57/81 (70.37%), Query Frame = 2
Query: 2264 ISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEV 2506
            ISLEGTVDV+   G+E +PHHYIR+I ADGP+G  G  + GDELL+ N  KL G+ + EV+  LK LP RV++V AR   V
Sbjct:  607 ISLEGTVDVE--CGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHV 685          

HSP 3 Score: 77.0258 bits (188), Expect = 1.627e-13
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEIL 1765
            E   Y   L K   GLG+T+AGY+ C  E ++ GIFVKSI + S A+ +GQI IND+I+ ++ +S+ G+ N   VE+L+ T  +V L   R+ +G  YE L
Sbjct:  305 ETETYVVELHKNVYGLGITVAGYV-CEEE-DLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHL 403          

HSP 4 Score: 67.3958 bits (163), Expect = 1.409e-10
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 2
Query: 6329 VDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +DL+     GLG  +V     GV I  L  G +AE+DGRL+ GD LL+I + N+R F+ +QVAT+L++    V L+V R
Sbjct:   13 IDLINDG-NGLGFILVGGRSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQTGAQVRLIVAR 90          

HSP 5 Score: 63.5438 bits (153), Expect = 2.211e-9
Identity = 44/145 (30.34%), Postives = 72/145 (49.66%), Query Frame = 2
Query: 2780 IMSKAKSDNSIFVKSNS---------FSEMLPIKTLTANRSLQYLKDVAMWSGPI-LVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            ++SKA+S++S++  S +                     ++SL+ +  +A+WS  +  V++ K  QG GFSI  YQD   S   VIVI  L+  G A     I PGDRL+ + +  +  L    E +  L+++  G   LGI +P+
Sbjct:  714 LLSKAQSESSLYTSSTATLTDAGAAAGGSGGTAGGGARSKSLENVSGLALWSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGL-ELDEAVSILKAMPPGLTRLGICRPL 857          

HSP 6 Score: 54.299 bits (129), Expect = 1.497e-6
Identity = 33/104 (31.73%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 2903 WSGPILVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYS 3214
            WS   +++L  +  GLGF +   +        +VI +L P GVA  DGR+  GD L+ I EV +   SS+Q  +  +   +  QV L +A+P+ P++  Y++ +
Sbjct:    7 WSQVEVIDLINDGNGLGFILVGGRSTG-----VVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQ--VATVLRQTGAQVRLIVARPVEPTAIDYQTLA 103          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Match: CG15803 (gene:FBgn0038606 transcript:FBtr0345256)

HSP 1 Score: 120.939 bits (302), Expect = 6.306e-27
Identity = 49/91 (53.85%), Postives = 76/91 (83.52%), Query Frame = 2
Query:  590 MLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI 862
            +L+TEW+++E+++L+ND  GLGF L+G +STGVVI+++  G VAER+G L++GDHL+ I ++N+RG +SEQVA +LRQ+   +RLI+ARP+
Sbjct:    2 VLSTEWSQVEVIDLINDGNGLGFILVGGRSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQTGAQVRLIVARPV 92          

HSP 2 Score: 95.9005 bits (237), Expect = 3.107e-19
Identity = 47/83 (56.63%), Postives = 59/83 (71.08%), Query Frame = 2
Query: 2258 LGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEV 2506
            LGISLEGTVDV+   G+E +PHHYIR+I ADGP+G  G  + GDELL+ N  KL G+ + EV+  LK LP RV++V AR   V
Sbjct:  607 LGISLEGTVDVE--CGIEKRPHHYIRSILADGPVGRQGILRPGDELLQVNEHKLQGLRHIEVVKILKELPARVKLVCARGTHV 687          

HSP 3 Score: 77.0258 bits (188), Expect = 1.714e-13
Identity = 43/101 (42.57%), Postives = 63/101 (62.38%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEIL 1765
            E   Y   L K   GLG+T+AGY+ C  E ++ GIFVKSI + S A+ +GQI IND+I+ ++ +S+ G+ N   VE+L+ T  +V L   R+ +G  YE L
Sbjct:  305 ETETYVVELHKNVYGLGITVAGYV-CEEE-DLSGIFVKSIIEGSAAETSGQIQINDRIVAVDGRSLSGVTNHQAVELLRNTDIVVHLTLERFLRGRKYEHL 403          

HSP 4 Score: 67.3958 bits (163), Expect = 1.399e-10
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 2
Query: 6329 VDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +DL+     GLG  +V     GV I  L  G +AE+DGRL+ GD LL+I + N+R F+ +QVAT+L++    V L+V R
Sbjct:   13 IDLINDG-NGLGFILVGGRSTGVVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQVATVLRQTGAQVRLIVAR 90          

HSP 5 Score: 63.5438 bits (153), Expect = 2.429e-9
Identity = 44/145 (30.34%), Postives = 72/145 (49.66%), Query Frame = 2
Query: 2780 IMSKAKSDNSIFVKSNS---------FSEMLPIKTLTANRSLQYLKDVAMWSGPI-LVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            ++SKA+S++S++  S +                     ++SL+ +  +A+WS  +  V++ K  QG GFSI  YQD   S   VIVI  L+  G A     I PGDRL+ + +  +  L    E +  L+++  G   LGI +P+
Sbjct:  716 LLSKAQSESSLYTSSTATLTDAGAAAGGSGGTAGGGARSKSLENVSGLALWSCEVTAVDIEKTEQGFGFSILDYQDPLDSEGSVIVIRGLIRGGAAEATNEIYPGDRLMSVGDRLLQGL-ELDEAVSILKAMPPGLTRLGICRPL 859          

HSP 6 Score: 54.299 bits (129), Expect = 1.577e-6
Identity = 33/104 (31.73%), Postives = 56/104 (53.85%), Query Frame = 2
Query: 2903 WSGPILVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYS 3214
            WS   +++L  +  GLGF +   +        +VI +L P GVA  DGR+  GD L+ I EV +   SS+Q  +  +   +  QV L +A+P+ P++  Y++ +
Sbjct:    7 WSQVEVIDLINDGNGLGFILVGGRSTG-----VVIKALTPGGVAERDGRLQLGDHLLQIGEVNLRGFSSEQ--VATVLRQTGAQVRLIVARPVEPTAIDYQTLA 103          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 196.438 bits (498), Expect = 1.643e-49
Identity = 139/441 (31.52%), Postives = 218/441 (49.43%), Query Frame = 2
Query: 5405 GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPP---------PLQMPTVISP------------------------IINDERKMSAVRPS-------ISHDKEPIYSSIP--PDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEH----PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            G++  V LEK   G G  +          I+V  +T  G A+ +G ++ GD +L IN +++    + +    ++   + +++V+ R   ++D    +   P P       S E H   +PP         P  +P   SP                        + + E  +  ++P+            +P    IP  P  +R+S +    +  +T   S        VP + T    E+    P    I+PG ETVIE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR+  H+ AI  LR    +V+L + RD+    ++       V+L KK+ +GLG++IV K +  GV ISD+VKG  A+ DGRL +GD +L ++  ++R  +Q+ VA +LK   G V L +GRL++  +
Sbjct: 1221 GELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVR---NEDAINQMAVTPFPSQPALFSSSETH--ENPPAVPAEKPQLPESLPLSRSPPENTLNKDQACVTATASSDPTHKSLTDGESAVKKLKPAEKLLESPSEQSAKPQVEQIPSLPKLQRSSTKPSAGSLEVTSSAS-------SVPVSGTSPDFEYCSKDPATCPIVPGQETVIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLRDEAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKCARGKVLLELGRLKAASW 1649          

HSP 2 Score: 99.7525 bits (247), Expect = 4.158e-20
Identity = 40/92 (43.48%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  581 STDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            S  +   +W  +E +EL+ND  GLGF ++G K+TG+V+R++  GSVA+++G LR GDH++ I D   RG+ S+QV  +L+    H+R++IAR
Sbjct:  227 SAPITTDQWGHVEEIELVNDGSGLGFGIVGGKTTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR 318          

HSP 3 Score: 90.5077 bits (223), Expect = 2.534e-17
Identity = 61/179 (34.08%), Postives = 93/179 (51.96%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G     +G   V + +V     A  DGRL   D+ILA+NG  L ++ T  QAI  L+   +RV+L + RD           P+  D      +++L+     GLG  IV     G+ +  +V GS+A++DGRL+ GD +L I DT  R    DQV  +L+ C  +V +++ R
Sbjct:  141 GLGFSVVGLRPEGVGGHGVFVRQVQPGSVADRDGRLLENDQILAINGIPLDQSVTQQQAIALLQQQKDRVELVVARDTALKPRLSASAPITTDQWGHVEEIELVNDG-SGLGFGIVGGKTTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR 318          

HSP 4 Score: 88.9669 bits (219), Expect = 7.013e-17
Identity = 46/104 (44.23%), Postives = 63/104 (60.58%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGK--VANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W  PR V V  E  +SLGISI+GG+  +  +K  EE         GIFI  +  DSPA + G L  GD++L V+G+DL   S+++A+  IK A SP+VF +QSL
Sbjct: 1050 WGPPRRVEVWAEPEESLGISIVGGRTVIKRLKNGEEL-------KGIFIKQVLADSPAGRTGALKTGDKILQVSGVDLQNASHEEAVQTIKAAPSPVVFIVQSL 1146          

HSP 5 Score: 85.1149 bits (209), Expect = 1.018e-15
Identity = 109/476 (22.90%), Postives = 187/476 (39.29%), Query Frame = 2
Query: 4400 VVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDM---LKKKLTTPPNSPDK--------ATSNKINQNETDE-------KXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDES------------------------------------GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRI 5665
            +V +E+++N  LG+S+ G +            D + +S IF+  I    PA + G++ +GD LL +N   L   S+ +A + IK+A S +   +    D                 S  E+HE  P     K  +   L    + P N+ +K        A+S+  +++ TD        K     + S S +S  P + +I ++    +SST  S                                    G+   IEI K G+ G+GL +VG KD       I    +   AA DG+L  GD++L++N +D+  ++H +    I   +    K+ LT+ R                                 DE Q     NL    D+F V L+K   G G  +      +  G+++  V   G A  +G L +GD+IL ++ E +     ++V   L+  +  + + +GR+
Sbjct: 1225 IVELEKDRN-GLGLSLAGNR------------DRSCMS-IFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVRNEDAINQMAVTPFPSQPALFSSSETHENPPAVPAEKPQLPESLPLSRSPPENTLNKDQACVTATASSDPTHKSLTDGESAVKKLKPAEKLLESPSEQSAKPQVEQIPSLPKLQRSSTKPSAGSLEVTSSASSVPVSGTSPDFEYCSKDPATCPIVPGQETVIEISK-GRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDA---IAALRQTPPKVRLTVLR---------------------------------DEAQYRDEENL----DVFPVELQKKT-GRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKCARGKVLLELGRL 1644          

HSP 6 Score: 80.1073 bits (196), Expect = 3.457e-14
Identity = 57/141 (40.43%), Postives = 79/141 (56.03%), Query Frame = 2
Query: 2894 VAMWSGPILV-ELTKESQGLGFSIEYYQDASSNV-PVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFP---SSYMYRSYSKETVEELSTS-QSLEYEPFTLAEDAAIGS 3298
            +A+WS  + V EL K  +GLGFSI  YQD       VIVI SLVP GVA   G I PGD+L+F+N+  ++  S  Q  +E L+S   G+V LGI KP+      S     +  E+V+E  T+ Q++ +    + ED   GS
Sbjct:  724 LALWSPNVQVLELEKAERGLGFSILDYQDPMDVARSVIVIRSLVPGGVADNHGGIFPGDQLVFVNDTHLETCSLAQ-AVEVLKSAPPGKVYLGIRKPLAAEDRGSGQQSLWPVESVDEQPTAKQAVSHTLPPMPEDFVNGS 863          

HSP 7 Score: 71.633 bits (174), Expect = 1.500e-11
Identity = 62/210 (29.52%), Postives = 93/210 (44.29%), Query Frame = 2
Query: 6026 PGVETVIELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-----------------------PLCEDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            PGV TV E+T+     LG+SI GG  + LG   + I  +     AA   RL  GDRI+++N + L   TH   +  L++    + L++  D                          L E     K K   L+K  +GLG +IV        D+ + +  +     A  DGRLK+GD LL +N  ++   T +Q   +LK+  G+V L V
Sbjct: 1705 PGVRTV-EITRGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVVADTNISAIASQVESLSSSSAPSTNPEVRLVEPETP-KPKSITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1912          

HSP 8 Score: 70.4774 bits (171), Expect = 2.772e-11
Identity = 60/215 (27.91%), Postives = 97/215 (45.12%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIGGSDT--ILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLY--------------------------------FKLKVDLLKKSRKGLGITIV------SKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            IEL  D  GLG  I+GG  T  ++ TV+   V +K     DGRL  GD IL +     R    DQ +Q L++ G  V++ I R  +PL                                      F++    LKK  + LGI+I+      S+  VGV + +++ GSIAEQ G+++  D ++ ++  N++ +   +V  ++K+    V L + R
Sbjct:  241 IELVNDGSGLGFGIVGGKTTGMVVRTVVPGSVADK-----DGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR--EPLGAKQPAPPPAPAMGPVSSLPPPPPVPARRASRTPNLEGFEIHEVALKKEGQSLGISIIGHNALTSEDAVGVYVKNVIPGSIAEQTGKIQIHDRIISLDGVNLQGYNNQEVLEVMKQSGDVVHLTLVR 448          

HSP 9 Score: 62.7734 bits (151), Expect = 6.288e-9
Identity = 60/235 (25.53%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 4979 STDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNA---NDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
            +TD+ G V  IE+   G  G+G  +VG K   +    +      SVA  DG+L  GD +L+I      G++   V  +++ C      + + I R P     +     +   + A    S           + S   NL+G+ +I  V L+K  Q  G  I+  NA    D  G+YVK V    IA   G ++  DRI+ ++   +   +   VL+ ++   + + + + R  IS
Sbjct:  231 TTDQWGHVEEIELVNDGS-GLGFGIVGGK---TTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQAC---GAHVRMLIAREP-----LGAKQPAPPPAPAMGPVSSLPPPPPVPARRASRTPNLEGF-EIHEVALKKEGQSLGISIIGHNALTSEDAVGVYVKNVIPGSIAEQTGKIQIHDRIISLDGVNLQGYNNQEVLEVMKQSGDVVHLTLVRKIIS 452          

HSP 10 Score: 61.6178 bits (148), Expect = 1.559e-8
Identity = 62/231 (26.84%), Postives = 106/231 (45.89%), Query Frame = 2
Query: 4973 KSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDC--SSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENA----VETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMD--CNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRGC 5632
            KS+  E G V  +EI +     +G+ + G K      +  +I   + N VAA   +L +GD ++ INS  + G++H++V  ++K        I+L +         ++ I + V +  +    S N     VE  T + +               + LEK  +G GF I+    + + +  IYVK V   G AA +G L+ GD++L +N E    V +E   ++LK+ RG 
Sbjct: 1699 KSTVTEPG-VRTVEITRGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYG---AIILQVVAD----TNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPK--------------SITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGS 1907          

HSP 11 Score: 60.8474 bits (146), Expect = 2.739e-8
Identity = 35/120 (29.17%), Postives = 62/120 (51.67%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYIN----------KTNEGLGI-SLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            E  +++ W + +G +YD++I  ++          K ++ L I ++   V++D   G     HHYI T+  +GP+   G  +  DELLE NG +L+G   +E +  L+ +P    +V  RR
Sbjct:  517 EMELRAKWEQALGPHYDVMIVQLDPVIEDDIELQKYSKLLPIHTMRLGVELDSFDG-----HHYISTVAPEGPVAKHGLLRPEDELLEVNGVQLYGKSRRESVAFLREVPTPFTLVCCRR 631          

HSP 12 Score: 59.3066 bits (142), Expect = 8.036e-8
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA+DGRL  GD++L+VNG+ L   TH+QA+  L+     V L + 
Sbjct: 1840 GLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSVL 1913          

HSP 13 Score: 58.5362 bits (140), Expect = 1.234e-7
Identity = 26/82 (31.71%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R +  E   A LRQ+   +RL + R
Sbjct: 1467 VIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLR 1548          

HSP 14 Score: 56.9954 bits (136), Expect = 3.272e-7
Identity = 28/86 (32.56%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  608 AELEIVELLNDRCGLGFSLMGSKS---TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
             EL IVEL  DR GLG SL G++      + +  I +G  A R+G +++GD L+ I+   + G + +  +AI++ ++  ++L++ R
Sbjct: 1221 GELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVR 1306          

HSP 15 Score: 54.6842 bits (130), Expect = 1.744e-6
Identity = 30/90 (33.33%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 6023 IPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK 6289
            +PG   ++EL KDR GLGLS+ G  D    ++ +  +     A+ DGR+  GD +L +N + L   +H  A   ++S  ++VKL + R++
Sbjct: 1219 LPGELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVRNE 1308          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 183.726 bits (465), Expect = 1.022e-45
Identity = 133/423 (31.44%), Postives = 208/423 (49.17%), Query Frame = 2
Query: 5405 GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPP---------PLQMPTVISP------------------------IINDERKMSAVRPS-------ISHDKEPIYSSIP--PDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEH----PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLK 6529
            G++  V LEK   G G  +          I+V  +T  G A+ +G ++ GD +L IN +++    + +    ++   + +++V+ R   ++D    +   P P       S E H   +PP         P  +P   SP                        + + E  +  ++P+            +P    IP  P  +R+S +    +  +T   S        VP + T    E+    P    I+PG ETVIE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR+  H+ AI  LR    +V+L + RD+    ++       V+L KK+ +GLG++IV K +  GV ISD+VKG  A+ DGRL +GD +L ++  ++R  +Q+ VA +LK
Sbjct: 1221 GELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVR---NEDAINQMAVTPFPSQPALFSSSETH--ENPPAVPAEKPQLPESLPLSRSPPENTLNKDQACVTATASSDPTHKSLTDGESAVKKLKPAEKLLESPSEQSAKPQVEQIPSLPKLQRSSTKPSAGSLEVTSSAS-------SVPVSGTSPDFEYCSKDPATCPIVPGQETVIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLRDEAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILK 1631          

HSP 2 Score: 99.7525 bits (247), Expect = 4.102e-20
Identity = 40/92 (43.48%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  581 STDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            S  +   +W  +E +EL+ND  GLGF ++G K+TG+V+R++  GSVA+++G LR GDH++ I D   RG+ S+QV  +L+    H+R++IAR
Sbjct:  227 SAPITTDQWGHVEEIELVNDGSGLGFGIVGGKTTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR 318          

HSP 3 Score: 90.5077 bits (223), Expect = 2.612e-17
Identity = 61/179 (34.08%), Postives = 93/179 (51.96%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G     +G   V + +V     A  DGRL   D+ILA+NG  L ++ T  QAI  L+   +RV+L + RD           P+  D      +++L+     GLG  IV     G+ +  +V GS+A++DGRL+ GD +L I DT  R    DQV  +L+ C  +V +++ R
Sbjct:  141 GLGFSVVGLRPEGVGGHGVFVRQVQPGSVADRDGRLLENDQILAINGIPLDQSVTQQQAIALLQQQKDRVELVVARDTALKPRLSASAPITTDQWGHVEEIELVNDG-SGLGFGIVGGKTTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR 318          

HSP 4 Score: 88.9669 bits (219), Expect = 7.231e-17
Identity = 46/104 (44.23%), Postives = 63/104 (60.58%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGK--VANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W  PR V V  E  +SLGISI+GG+  +  +K  EE         GIFI  +  DSPA + G L  GD++L V+G+DL   S+++A+  IK A SP+VF +QSL
Sbjct: 1050 WGPPRRVEVWAEPEESLGISIVGGRTVIKRLKNGEEL-------KGIFIKQVLADSPAGRTGALKTGDKILQVSGVDLQNASHEEAVQTIKAAPSPVVFIVQSL 1146          

HSP 5 Score: 85.8853 bits (211), Expect = 6.394e-16
Identity = 110/469 (23.45%), Postives = 184/469 (39.23%), Query Frame = 2
Query: 4400 VVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDM---LKKKLTTPPNSPDK--------ATSNKINQNETDE-------KXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDES------------------------------------GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNAL 5644
            +V +E+++N  LG+S+ G +            D + +S IF+  I    PA + G++ +GD LL +N   L   S+ +A + IK+A S +   +    D                 S  E+HE  P     K  +   L    + P N+ +K        A+S+  +++ TD        K     + S S +S  P + +I ++    +SST  S                                    G+   IEI K G+ G+GL +VG KD       I    +   AA DG+L  GD++L++N +D+  ++H +    I   +    K+ LT+ R                                 DE Q     NL    D+F V L+K   G G  +      +  G+++  V   G A  +G L +GD+IL ++ E +     ++V   L+G  +AL
Sbjct: 1225 IVELEKDRN-GLGLSLAGNR------------DRSCMS-IFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVRNEDAINQMAVTPFPSQPALFSSSETHENPPAVPAEKPQLPESLPLSRSPPENTLNKDQACVTATASSDPTHKSLTDGESAVKKLKPAEKLLESPSEQSAKPQVEQIPSLPKLQRSSTKPSAGSLEVTSSASSVPVSGTSPDFEYCSKDPATCPIVPGQETVIEISK-GRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDA---IAALRQTPPKVRLTVLR---------------------------------DEAQYRDEENL----DVFPVELQKKT-GRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKGPTDAL 1637          

HSP 6 Score: 80.1073 bits (196), Expect = 3.631e-14
Identity = 56/141 (39.72%), Postives = 80/141 (56.74%), Query Frame = 2
Query: 2894 VAMWSGPI-LVELTKESQGLGFSIEYYQDASSNV-PVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFP---SSYMYRSYSKETVEELSTS-QSLEYEPFTLAEDAAIGS 3298
            +A+WS  + ++EL K  +GLGFSI  YQD       VIVI SLVP GVA   G I PGD+L+F+N+  ++  S  Q  +E L+S   G+V LGI KP+      S     +  E+V+E  T+ Q++ +    + ED   GS
Sbjct:  724 LALWSPNVQVLELEKAERGLGFSILDYQDPMDVARSVIVIRSLVPGGVADNHGGIFPGDQLVFVNDTHLETCSLAQ-AVEVLKSAPPGKVYLGIRKPLAAEDRGSGQQSLWPVESVDEQPTAKQAVSHTLPPMPEDFVNGS 863          

HSP 7 Score: 70.8626 bits (172), Expect = 2.506e-11
Identity = 99/412 (24.03%), Postives = 173/412 (41.99%), Query Frame = 2
Query: 4433 LGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDM-LKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDC--SSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENA----VETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMD--CNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRGC 5632
            LG+SI+GGK            DT L   I I  +  +  A + G+L  GD++L VNG+DL   +++DAI+ ++  T P        V +++++D         Q  D E+ +  P+ L  K+   L   +    N      S+ +     D                   L + + I +       ++ +     I K     +G+ + G K      +  +I   + N VAA   +L +GD ++ INS  + G++H++V  ++K        I+L +         ++ I + V +  +    S N     VE  T + +               + LEK  +G GF I+    + + +  IYVK V   G AA +G L+ GD++L +N E    V +E   ++LK+ RG 
Sbjct: 1477 LGLSIVGGK------------DTQL-DAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQ-TPP-------KVRLTVLRD-------EAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGR---------------LMQGDQILSVDGEDMRQASQETVAAILKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYG---AIILQVVAD----TNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPK--------------SITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGS 1824          

HSP 8 Score: 70.4774 bits (171), Expect = 2.772e-11
Identity = 60/215 (27.91%), Postives = 97/215 (45.12%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIGGSDT--ILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLY--------------------------------FKLKVDLLKKSRKGLGITIV------SKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            IEL  D  GLG  I+GG  T  ++ TV+   V +K     DGRL  GD IL +     R    DQ +Q L++ G  V++ I R  +PL                                      F++    LKK  + LGI+I+      S+  VGV + +++ GSIAEQ G+++  D ++ ++  N++ +   +V  ++K+    V L + R
Sbjct:  241 IELVNDGSGLGFGIVGGKTTGMVVRTVVPGSVADK-----DGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR--EPLGAKQPAPPPAPAMGPVSSLPPPPPVPARRASRTPNLEGFEIHEVALKKEGQSLGISIIGHNALTSEDAVGVYVKNVIPGSIAEQTGKIQIHDRIISLDGVNLQGYNNQEVLEVMKQSGDVVHLTLVR 448          

HSP 9 Score: 67.0106 bits (162), Expect = 3.762e-10
Identity = 59/207 (28.50%), Postives = 89/207 (43.00%), Query Frame = 2
Query: 6035 ETVIELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-----------------------PLCEDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            ETV  + K     LG+SI GG  + LG   + I  +     AA   RL  GDRI+++N + L   TH   +  L++    + L++  D                          L E     K K   L+K  +GLG +IV        D+ + +  +     A  DGRLK+GD LL +N  ++   T +Q   +LK+  G+V L V
Sbjct: 1624 ETVAAILKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVVADTNISAIASQVESLSSSSAPSTNPEVRLVEPETP-KPKSITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          

HSP 10 Score: 62.7734 bits (151), Expect = 7.204e-9
Identity = 60/235 (25.53%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 4979 STDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNA---NDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
            +TD+ G V  IE+   G  G+G  +VG K   +    +      SVA  DG+L  GD +L+I      G++   V  +++ C      + + I R P     +     +   + A    S           + S   NL+G+ +I  V L+K  Q  G  I+  NA    D  G+YVK V    IA   G ++  DRI+ ++   +   +   VL+ ++   + + + + R  IS
Sbjct:  231 TTDQWGHVEEIELVNDGS-GLGFGIVGGK---TTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQAC---GAHVRMLIAREP-----LGAKQPAPPPAPAMGPVSSLPPPPPVPARRASRTPNLEGF-EIHEVALKKEGQSLGISIIGHNALTSEDAVGVYVKNVIPGSIAEQTGKIQIHDRIISLDGVNLQGYNNQEVLEVMKQSGDVVHLTLVRKIIS 452          

HSP 11 Score: 60.8474 bits (146), Expect = 2.653e-8
Identity = 35/120 (29.17%), Postives = 62/120 (51.67%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYIN----------KTNEGLGI-SLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            E  +++ W + +G +YD++I  ++          K ++ L I ++   V++D   G     HHYI T+  +GP+   G  +  DELLE NG +L+G   +E +  L+ +P    +V  RR
Sbjct:  517 EMELRAKWEQALGPHYDVMIVQLDPVIEDDIELQKYSKLLPIHTMRLGVELDSFDG-----HHYISTVAPEGPVAKHGLLRPEDELLEVNGVQLYGKSRRESVAFLREVPTPFTLVCCRR 631          

HSP 12 Score: 59.3066 bits (142), Expect = 7.984e-8
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA+DGRL  GD++L+VNG+ L   TH+QA+  L+     V L + 
Sbjct: 1757 GLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSVL 1830          

HSP 13 Score: 58.5362 bits (140), Expect = 1.195e-7
Identity = 26/82 (31.71%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R +  E   A LRQ+   +RL + R
Sbjct: 1467 VIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLR 1548          

HSP 14 Score: 57.3806 bits (137), Expect = 3.198e-7
Identity = 28/86 (32.56%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  608 AELEIVELLNDRCGLGFSLMGSKS---TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
             EL IVEL  DR GLG SL G++      + +  I +G  A R+G +++GD L+ I+   + G + +  +AI++ ++  ++L++ R
Sbjct: 1221 GELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVR 1306          

HSP 15 Score: 54.6842 bits (130), Expect = 1.719e-6
Identity = 30/90 (33.33%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 6023 IPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK 6289
            +PG   ++EL KDR GLGLS+ G  D    ++ +  +     A+ DGR+  GD +L +N + L   +H  A   ++S  ++VKL + R++
Sbjct: 1219 LPGELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVRNE 1308          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 183.726 bits (465), Expect = 1.022e-45
Identity = 133/423 (31.44%), Postives = 208/423 (49.17%), Query Frame = 2
Query: 5405 GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPP---------PLQMPTVISP------------------------IINDERKMSAVRPS-------ISHDKEPIYSSIP--PDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEH----PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLK 6529
            G++  V LEK   G G  +          I+V  +T  G A+ +G ++ GD +L IN +++    + +    ++   + +++V+ R   ++D    +   P P       S E H   +PP         P  +P   SP                        + + E  +  ++P+            +P    IP  P  +R+S +    +  +T   S        VP + T    E+    P    I+PG ETVIE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR+  H+ AI  LR    +V+L + RD+    ++       V+L KK+ +GLG++IV K +  GV ISD+VKG  A+ DGRL +GD +L ++  ++R  +Q+ VA +LK
Sbjct: 1221 GELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVR---NEDAINQMAVTPFPSQPALFSSSETH--ENPPAVPAEKPQLPESLPLSRSPPENTLNKDQACVTATASSDPTHKSLTDGESAVKKLKPAEKLLESPSEQSAKPQVEQIPSLPKLQRSSTKPSAGSLEVTSSAS-------SVPVSGTSPDFEYCSKDPATCPIVPGQETVIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLRDEAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILK 1631          

HSP 2 Score: 99.7525 bits (247), Expect = 4.102e-20
Identity = 40/92 (43.48%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  581 STDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            S  +   +W  +E +EL+ND  GLGF ++G K+TG+V+R++  GSVA+++G LR GDH++ I D   RG+ S+QV  +L+    H+R++IAR
Sbjct:  227 SAPITTDQWGHVEEIELVNDGSGLGFGIVGGKTTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR 318          

HSP 3 Score: 90.5077 bits (223), Expect = 2.612e-17
Identity = 61/179 (34.08%), Postives = 93/179 (51.96%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G     +G   V + +V     A  DGRL   D+ILA+NG  L ++ T  QAI  L+   +RV+L + RD           P+  D      +++L+     GLG  IV     G+ +  +V GS+A++DGRL+ GD +L I DT  R    DQV  +L+ C  +V +++ R
Sbjct:  141 GLGFSVVGLRPEGVGGHGVFVRQVQPGSVADRDGRLLENDQILAINGIPLDQSVTQQQAIALLQQQKDRVELVVARDTALKPRLSASAPITTDQWGHVEEIELVNDG-SGLGFGIVGGKTTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR 318          

HSP 4 Score: 88.9669 bits (219), Expect = 7.231e-17
Identity = 46/104 (44.23%), Postives = 63/104 (60.58%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGK--VANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            W  PR V V  E  +SLGISI+GG+  +  +K  EE         GIFI  +  DSPA + G L  GD++L V+G+DL   S+++A+  IK A SP+VF +QSL
Sbjct: 1050 WGPPRRVEVWAEPEESLGISIVGGRTVIKRLKNGEEL-------KGIFIKQVLADSPAGRTGALKTGDKILQVSGVDLQNASHEEAVQTIKAAPSPVVFIVQSL 1146          

HSP 5 Score: 85.8853 bits (211), Expect = 6.394e-16
Identity = 110/469 (23.45%), Postives = 184/469 (39.23%), Query Frame = 2
Query: 4400 VVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDM---LKKKLTTPPNSPDK--------ATSNKINQNETDE-------KXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDES------------------------------------GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNAL 5644
            +V +E+++N  LG+S+ G +            D + +S IF+  I    PA + G++ +GD LL +N   L   S+ +A + IK+A S +   +    D                 S  E+HE  P     K  +   L    + P N+ +K        A+S+  +++ TD        K     + S S +S  P + +I ++    +SST  S                                    G+   IEI K G+ G+GL +VG KD       I    +   AA DG+L  GD++L++N +D+  ++H +    I   +    K+ LT+ R                                 DE Q     NL    D+F V L+K   G G  +      +  G+++  V   G A  +G L +GD+IL ++ E +     ++V   L+G  +AL
Sbjct: 1225 IVELEKDRN-GLGLSLAGNR------------DRSCMS-IFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVRNEDAINQMAVTPFPSQPALFSSSETHENPPAVPAEKPQLPESLPLSRSPPENTLNKDQACVTATASSDPTHKSLTDGESAVKKLKPAEKLLESPSEQSAKPQVEQIPSLPKLQRSSTKPSAGSLEVTSSASSVPVSGTSPDFEYCSKDPATCPIVPGQETVIEISK-GRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDA---IAALRQTPPKVRLTVLR---------------------------------DEAQYRDEENL----DVFPVELQKKT-GRGLGLSIVGKRNGKGVFISDVVKGGAADLDGRLMQGDQILSVDGEDMRQASQETVAAILKGPTDAL 1637          

HSP 6 Score: 80.1073 bits (196), Expect = 3.631e-14
Identity = 56/141 (39.72%), Postives = 80/141 (56.74%), Query Frame = 2
Query: 2894 VAMWSGPI-LVELTKESQGLGFSIEYYQDASSNV-PVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFP---SSYMYRSYSKETVEELSTS-QSLEYEPFTLAEDAAIGS 3298
            +A+WS  + ++EL K  +GLGFSI  YQD       VIVI SLVP GVA   G I PGD+L+F+N+  ++  S  Q  +E L+S   G+V LGI KP+      S     +  E+V+E  T+ Q++ +    + ED   GS
Sbjct:  724 LALWSPNVQVLELEKAERGLGFSILDYQDPMDVARSVIVIRSLVPGGVADNHGGIFPGDQLVFVNDTHLETCSLAQ-AVEVLKSAPPGKVYLGIRKPLAAEDRGSGQQSLWPVESVDEQPTAKQAVSHTLPPMPEDFVNGS 863          

HSP 7 Score: 70.8626 bits (172), Expect = 2.506e-11
Identity = 99/412 (24.03%), Postives = 173/412 (41.99%), Query Frame = 2
Query: 4433 LGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDM-LKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDC--SSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENA----VETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMD--CNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRGC 5632
            LG+SI+GGK            DT L   I I  +  +  A + G+L  GD++L VNG+DL   +++DAI+ ++  T P        V +++++D         Q  D E+ +  P+ L  K+   L   +    N      S+ +     D                   L + + I +       ++ +     I K     +G+ + G K      +  +I   + N VAA   +L +GD ++ INS  + G++H++V  ++K        I+L +         ++ I + V +  +    S N     VE  T + +               + LEK  +G GF I+    + + +  IYVK V   G AA +G L+ GD++L +N E    V +E   ++LK+ RG 
Sbjct: 1477 LGLSIVGGK------------DTQL-DAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQ-TPP-------KVRLTVLRD-------EAQYRDEENLDVFPVELQKKTGRGLGLSIVGKRNGKGVFISDVVKGGAADLDGR---------------LMQGDQILSVDGEDMRQASQETVAAILKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYG---AIILQVVAD----TNISAIASQVESLSSSSAPSTNPEVRLVEPETPKPK--------------SITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGS 1824          

HSP 8 Score: 70.4774 bits (171), Expect = 2.772e-11
Identity = 60/215 (27.91%), Postives = 97/215 (45.12%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIGGSDT--ILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLY--------------------------------FKLKVDLLKKSRKGLGITIV------SKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            IEL  D  GLG  I+GG  T  ++ TV+   V +K     DGRL  GD IL +     R    DQ +Q L++ G  V++ I R  +PL                                      F++    LKK  + LGI+I+      S+  VGV + +++ GSIAEQ G+++  D ++ ++  N++ +   +V  ++K+    V L + R
Sbjct:  241 IELVNDGSGLGFGIVGGKTTGMVVRTVVPGSVADK-----DGRLRTGDHILRIGDTMTRGLASDQVVQVLQACGAHVRMLIAR--EPLGAKQPAPPPAPAMGPVSSLPPPPPVPARRASRTPNLEGFEIHEVALKKEGQSLGISIIGHNALTSEDAVGVYVKNVIPGSIAEQTGKIQIHDRIISLDGVNLQGYNNQEVLEVMKQSGDVVHLTLVR 448          

HSP 9 Score: 67.0106 bits (162), Expect = 3.762e-10
Identity = 59/207 (28.50%), Postives = 89/207 (43.00%), Query Frame = 2
Query: 6035 ETVIELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-----------------------PLCEDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            ETV  + K     LG+SI GG  + LG   + I  +     AA   RL  GDRI+++N + L   TH   +  L++    + L++  D                          L E     K K   L+K  +GLG +IV        D+ + +  +     A  DGRLK+GD LL +N  ++   T +Q   +LK+  G+V L V
Sbjct: 1624 ETVAAILKGPTDALGISIAGGKGSPLGDIPIFIAMIQANGVAAKTHRLKVGDRIVSINSQSLDGLTHADVVNMLKNAYGAIILQVVADTNISAIASQVESLSSSSAPSTNPEVRLVEPETP-KPKSITLEKGSEGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSV 1829          

HSP 10 Score: 62.7734 bits (151), Expect = 7.204e-9
Identity = 60/235 (25.53%), Postives = 101/235 (42.98%), Query Frame = 2
Query: 4979 STDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNA---NDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
            +TD+ G V  IE+   G  G+G  +VG K   +    +      SVA  DG+L  GD +L+I      G++   V  +++ C      + + I R P     +     +   + A    S           + S   NL+G+ +I  V L+K  Q  G  I+  NA    D  G+YVK V    IA   G ++  DRI+ ++   +   +   VL+ ++   + + + + R  IS
Sbjct:  231 TTDQWGHVEEIELVNDGS-GLGFGIVGGK---TTGMVVRTVVPGSVADKDGRLRTGDHILRIGDTMTRGLASDQVVQVLQAC---GAHVRMLIAREP-----LGAKQPAPPPAPAMGPVSSLPPPPPVPARRASRTPNLEGF-EIHEVALKKEGQSLGISIIGHNALTSEDAVGVYVKNVIPGSIAEQTGKIQIHDRIISLDGVNLQGYNNQEVLEVMKQSGDVVHLTLVRKIIS 452          

HSP 11 Score: 60.8474 bits (146), Expect = 2.653e-8
Identity = 35/120 (29.17%), Postives = 62/120 (51.67%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYIN----------KTNEGLGI-SLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            E  +++ W + +G +YD++I  ++          K ++ L I ++   V++D   G     HHYI T+  +GP+   G  +  DELLE NG +L+G   +E +  L+ +P    +V  RR
Sbjct:  517 EMELRAKWEQALGPHYDVMIVQLDPVIEDDIELQKYSKLLPIHTMRLGVELDSFDG-----HHYISTVAPEGPVAKHGLLRPEDELLEVNGVQLYGKSRRESVAFLREVPTPFTLVCCRR 631          

HSP 12 Score: 59.3066 bits (142), Expect = 7.984e-8
Identity = 32/74 (43.24%), Postives = 45/74 (60.81%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA+DGRL  GD++L+VNG+ L   TH+QA+  L+     V L + 
Sbjct: 1757 GLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAVDGRLKRGDQLLSVNGESLEGVTHEQAVAILKKQRGSVTLSVL 1830          

HSP 13 Score: 58.5362 bits (140), Expect = 1.195e-7
Identity = 26/82 (31.71%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R +  E   A LRQ+   +RL + R
Sbjct: 1467 VIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPPKVRLTVLR 1548          

HSP 14 Score: 57.3806 bits (137), Expect = 3.198e-7
Identity = 28/86 (32.56%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  608 AELEIVELLNDRCGLGFSLMGSKS---TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
             EL IVEL  DR GLG SL G++      + +  I +G  A R+G +++GD L+ I+   + G + +  +AI++ ++  ++L++ R
Sbjct: 1221 GELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVR 1306          

HSP 15 Score: 54.6842 bits (130), Expect = 1.719e-6
Identity = 30/90 (33.33%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 6023 IPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK 6289
            +PG   ++EL KDR GLGLS+ G  D    ++ +  +     A+ DGR+  GD +L +N + L   +H  A   ++S  ++VKL + R++
Sbjct: 1219 LPGELLIVELEKDRNGLGLSLAGNRDRSCMSIFVVGITTGGPASRDGRIKVGDELLEINSQVLYGRSHQNASAIIKSAASKVKLVLVRNE 1308          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 167.548 bits (423), Expect = 8.971e-41
Identity = 87/205 (42.44%), Postives = 129/205 (62.93%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----------QPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG    +++ K   GLGLSI+GG +T+LG ++IHEV++  AA  DGRLWAGD IL VNG DLR ATH++A+  LR    RV+L I+RD           Q    + ++    V+L  + R+GLG+ IV K +D G+ +S++ +G  A+ DGRL  GD +L +N  ++R+ +QD  + LL+RCSG+V L V R +++ +
Sbjct: 1415 PLTCPIIPGCINTVDICKGTTGLGLSIVGGCNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLRLSPQRVRLSIYRDHVTEKHSKHTSQKHTPEDMWDLFNVELNLQPRQGLGLCIVGKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKASSH 1619          

HSP 2 Score: 87.0409 bits (214), Expect = 2.460e-16
Identity = 60/182 (32.97%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 6038 TVIELTKDRG---LGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNA-THDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            TV+    ++G   LG+SI+  +    G   + I E+     A  DGRL  GD+ILAVN K   ++ THDQA+Q L+   + V L I R+  P        ++    L+    GLG  I+     G  +  ++   +A +DGRL+ GDLLL I D +V     ++VA  L+    +V L++ R
Sbjct:  131 TVLSFDLEKGESALGVSIVNLAIESTGGHGIFIKEIQTDSVAYSDGRLHEGDQILAVNDKVFDSSVTHDQAVQILQEAASVVTLTIAREPTPSFSTPKPRQIYHVELENDGSGLGFGIIGGRSTGTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAR 312          

HSP 3 Score: 83.5741 bits (205), Expect = 3.312e-15
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 2816 VKSNSFSEMLPIKTLTANRSLQYLKDVAMWSGPILV-ELTKESQGLGFSIEYYQD-ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
             + N F  +  ++          L   AMW   I V EL K   GLGFSI  YQD  +    VIVI SLVP G+A  DGR++PGDRL+F+N+ ++   S  Q  +  L+S + G V +G+ KP+
Sbjct:  609 AEQNIFGSVFALREEDLKSEAPVLSHQAMWENEIEVYELQKGDSGLGFSILDYQDPVNPGRTVIVIRSLVPGGLADRDGRLLPGDRLMFVNQTDLSHASLAQ-AVHVLKSTALGTVRIGVTKPL 731          

HSP 4 Score: 81.6481 bits (200), Expect = 1.170e-14
Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI 862
            VEL ND  GLGF ++G +STG ++++I    VA ++G LR GD L+ I D++V  M SE+VA  LR +  H+RLIIAR I
Sbjct:  235 VELENDGSGLGFGIIGGRSTGTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAREI 314          

HSP 5 Score: 79.337 bits (194), Expect = 5.787e-14
Identity = 83/318 (26.10%), Postives = 136/318 (42.77%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQS--LVDVSMMKDSDATKLSNCQLSDYESHEQ-------------EPLSLNSKSDMLKKKLTTPPNS----------PDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEID-KQGKKGMGLLLVGNKDCS--SMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLT 5254
            WS PR V + R     LG S+ GG+    +       +  +  GIFI HI  DSPA     L  GDR+L V GID+   ++++A+  I+ A   +   +QS    +     + D    +N Q     +H++              P+      D    KL  PP+S          PD+  ++ + +          +    S +  T   S ++  R G        G+++  ++D      G+GL L GN+D +   M+ ++     +  AA DG++ +GDELL+IN   + G SH N   II     +  +I+LT
Sbjct:  990 WSQPRRVKLSRAGGTCLGFSVFGGRGMGSR-----LSNGEMRRGIFIKHIAEDSPAAHNSTLKEGDRILQVQGIDVSDFTHEEAVEAIRRAGDRVELLVQSPQFSEPDNYLEDDRISKTNSQ-----NHQESEIPNNLSPTFPFSPIPFKRTEDW---KLGKPPHSAPSLLKLPCRPDETQTDGVQRLPERPPLPEETSHDHSGQEQTSYWSRMQQ-RYG-----SLPGELLMFDLDCSSHGSGLGLCLSGNRDGARGRMSVFVSEITADGAAAADGRVRVGDELLEINGQVLYGRSHQNATAIINNAPAKV-RILLT 1287          

HSP 6 Score: 74.7146 bits (182), Expect = 1.647e-12
Identity = 41/110 (37.27%), Postives = 61/110 (55.45%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 2494
            E ++K  W   +G  Y++L++ + K  E  GLG+SLE             + HHYI +I  +GP+G  G    GDEL+E NG  L G  ++EV++ LK LP  V +V +R
Sbjct:  482 EKSLKEKWQSKLGPQYEVLVTQVEKFIESSGLGVSLEAK-----------EGHHYICSILPEGPLGQTGIIHPGDELIEVNGFSLIGETHKEVVSLLKELPMNVCVVCSR 580          

HSP 7 Score: 63.1586 bits (152), Expect = 5.335e-9
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 2
Query: 6017 QIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLC 6301
            Q  P  +T+       GLG SI+GG  +  G + I+   +  K AA  DGRL  GD++L VNG+ L   TH +A++ LR     V L++   + P C
Sbjct: 1764 QSSPQYQTITLERGSAGLGFSIVGGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVILQVLSKRPPSC 1860          

HSP 8 Score: 59.3066 bits (142), Expect = 7.419e-8
Identity = 58/234 (24.79%), Postives = 108/234 (46.15%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDN--SVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLE-KSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
            G +  ++I K G  G+GL +VG   C+++   I   + N    A  DG+L  GD +L++N ID+   +H     +++   +  +++ L+I R  D++ +               + S++  +  T E+            D+F+V L  +  QG G  I+     ++ GI+V ++T  G A  +G L  GD+IL +N E +     D     L+ C  ++ + V R   S  ++
Sbjct: 1423 GCINTVDICK-GTTGLGLSIVGG--CNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLR---LSPQRVRLSIYR--DHVTE---------------KHSKHTSQKHTPEDMW----------DLFNVELNLQPRQGLGLCIV--GKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKASSHYS 1621          

HSP 9 Score: 58.9214 bits (141), Expect = 9.468e-8
Identity = 93/420 (22.14%), Postives = 173/420 (41.19%), Query Frame = 2
Query: 5108 NSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---------GYGDIFHVHLEKSVQGFGFFIMDCNA-NDEAGIYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEY-HMINSP-PPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSI-----QKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKI 6277
              +A  DG+L+ GD L+ +N  D+   S +    ++K   + + +I +T K  P+N ++      + N     C    N   ++   N  S  + ++         GY     V     V+G     M  +A  D +GI ++ V   G  + +G L  GD I+ +N E    + N    ++L+R       L ++         H  +     + +      ++++ H  N P  PL+  +    +++   K    +     + E I    P  ++ NS      QKV N +   +  + +EQ   E    +   +KE   +          ++L++  G  LG S+ GG        +  +   + I  + E   AA +  L  GDRIL V G D+ + TH++A++ +R  G+RV+L +
Sbjct:  680 GGLADRDGRLLPGDRLMFVNQTDLSHASLAQAVHVLKSTALGTVRIGVT-KPLPENDIQDTGAEITGN-----CHSEHNHQHSTFQTNSHSQKSKMEAEPVSIPSSGYERTITV-----VRGNSSLGMTVSALRDGSGIIIRSVVHGGSISKDGRLAVGDGIVALNGESTTNLTNAQARAMLRRHSLIGPDLSVMYVPAAFLDLHRASYSKSKEEMEIHTPAAVQHRHSQNLPFKPLECISEQQSVVDG--KGVNGKTQAEEENERIDEHSPIKQRENSKRLDRDQKVKNEKPALQSENRHEQ---EREKDRQRDEKETHGRDHTSWSQPRRVKLSRAGGTCLGFSVFGGRGMGSRLSNGEMRRGIFIKHIAEDSPAAHNSTLKEGDRILQVQGIDVSDFTHEEAVEAIRRAGDRVELLV 1083          

HSP 10 Score: 57.3806 bits (137), Expect = 3.047e-7
Identity = 44/213 (20.66%), Postives = 100/213 (46.95%), Query Frame = 2
Query: 4940 LSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKR-HPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            ++E  +     K + ++   + N+E++ Q ++G+GL +VG  + + +  ++        A +DG+L++GD++L +N  D+   S  + + ++++C   S  ++L + R    +          V+  +  C  + ++V+ + D   ++              H   SV+     + D   +  AG+Y+ K+    +AA  G L+ G R++ IN
Sbjct: 1511 VTEKHSKHTSQKHTPEDMWDLFNVELNLQPRQGLGLCIVGKMNDTGI--FVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRC---SGSVLLEVARFKASSHYSYGDQVGEVDVPLFSCLNTHDSVDGNVDIRTVTVQK-----------HECDSVE---LRVRDTLGH--AGMYISKLDASTLAARSGLLQLGSRVISIN 1702          

HSP 11 Score: 54.6842 bits (130), Expect = 1.723e-6
Identity = 29/95 (30.53%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  605 WA-ELEIVELLNDRCGLGFSLMGSKS------TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSS-DHIRLIIARPIP 865
            W  E+E+ EL     GLGFS++  +       T +VIRS+  G +A+R+G L  GD LM+++  ++   +  Q   +L+ ++   +R+ + +P+P
Sbjct:  638 WENEIEVYELQKGDSGLGFSILDYQDPVNPGRTVIVIRSLVPGGLADRDGRLLPGDRLMFVNQTDLSHASLAQAVHVLKSTALGTVRIGVTKPLP 732          

HSP 12 Score: 53.5286 bits (127), Expect = 4.381e-6
Identity = 46/138 (33.33%), Postives = 65/138 (47.10%), Query Frame = 2
Query: 5918 NQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETV--IELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---DKQPLCEDSL 6313
            + S+T   +V  Q++QE     TLT    PT +   P    +  +EL  D  GLG  IIGG  T  GT M+  +     A  DGRL +GD +L++   D+     ++    LR  G  V+L I R   D  PL   +L
Sbjct:  193 DSSVTHDQAV--QILQEAASVVTLTIAREPTPSFSTPKPRQIYHVELENDGSGLGFGIIGGRST--GT-MVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAREITDSDPLPASAL 325          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Match: si:dkey-92j12.5 (si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-354])

HSP 1 Score: 167.548 bits (423), Expect = 9.734e-41
Identity = 87/205 (42.44%), Postives = 129/205 (62.93%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK----------QPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG    +++ K   GLGLSI+GG +T+LG ++IHEV++  AA  DGRLWAGD IL VNG DLR ATH++A+  LR    RV+L I+RD           Q    + ++    V+L  + R+GLG+ IV K +D G+ +S++ +G  A+ DGRL  GD +L +N  ++R+ +QD  + LL+RCSG+V L V R +++ +
Sbjct: 1449 PLTCPIIPGCINTVDICKGTTGLGLSIVGGCNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLRLSPQRVRLSIYRDHVTEKHSKHTSQKHTPEDMWDLFNVELNLQPRQGLGLCIVGKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKASSH 1653          

HSP 2 Score: 87.0409 bits (214), Expect = 2.544e-16
Identity = 60/182 (32.97%), Postives = 92/182 (50.55%), Query Frame = 2
Query: 6038 TVIELTKDRG---LGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNA-THDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            TV+    ++G   LG+SI+  +    G   + I E+     A  DGRL  GD+ILAVN K   ++ THDQA+Q L+   + V L I R+  P        ++    L+    GLG  I+     G  +  ++   +A +DGRL+ GDLLL I D +V     ++VA  L+    +V L++ R
Sbjct:  165 TVLSFDLEKGESALGVSIVNLAIESTGGHGIFIKEIQTDSVAYSDGRLHEGDQILAVNDKVFDSSVTHDQAVQILQEAASVVTLTIAREPTPSFSTPKPRQIYHVELENDGSGLGFGIIGGRSTGTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAR 346          

HSP 3 Score: 83.5741 bits (205), Expect = 3.147e-15
Identity = 49/124 (39.52%), Postives = 68/124 (54.84%), Query Frame = 2
Query: 2816 VKSNSFSEMLPIKTLTANRSLQYLKDVAMWSGPILV-ELTKESQGLGFSIEYYQD-ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
             + N F  +  ++          L   AMW   I V EL K   GLGFSI  YQD  +    VIVI SLVP G+A  DGR++PGDRL+F+N+ ++   S  Q  +  L+S + G V +G+ KP+
Sbjct:  643 AEQNIFGSVFALREEDLKSEAPVLSHQAMWENEIEVYELQKGDSGLGFSILDYQDPVNPGRTVIVIRSLVPGGLADRDGRLLPGDRLMFVNQTDLSHASLAQ-AVHVLKSTALGTVRIGVTKPL 765          

HSP 4 Score: 81.6481 bits (200), Expect = 1.282e-14
Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI 862
            VEL ND  GLGF ++G +STG ++++I    VA ++G LR GD L+ I D++V  M SE+VA  LR +  H+RLIIAR I
Sbjct:  269 VELENDGSGLGFGIIGGRSTGTMVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAREI 348          

HSP 5 Score: 79.337 bits (194), Expect = 6.029e-14
Identity = 83/318 (26.10%), Postives = 136/318 (42.77%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQS--LVDVSMMKDSDATKLSNCQLSDYESHEQ-------------EPLSLNSKSDMLKKKLTTPPNS----------PDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEID-KQGKKGMGLLLVGNKDCS--SMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLT 5254
            WS PR V + R     LG S+ GG+    +       +  +  GIFI HI  DSPA     L  GDR+L V GID+   ++++A+  I+ A   +   +QS    +     + D    +N Q     +H++              P+      D    KL  PP+S          PD+  ++ + +          +    S +  T   S ++  R G        G+++  ++D      G+GL L GN+D +   M+ ++     +  AA DG++ +GDELL+IN   + G SH N   II     +  +I+LT
Sbjct: 1024 WSQPRRVKLSRAGGTCLGFSVFGGRGMGSR-----LSNGEMRRGIFIKHIAEDSPAAHNSTLKEGDRILQVQGIDVSDFTHEEAVEAIRRAGDRVELLVQSPQFSEPDNYLEDDRISKTNSQ-----NHQESEIPNNLSPTFPFSPIPFKRTEDW---KLGKPPHSAPSLLKLPCRPDETQTDGVQRLPERPPLPEETSHDHSGQEQTSYWSRMQQ-RYG-----SLPGELLMFDLDCSSHGSGLGLCLSGNRDGARGRMSVFVSEITADGAAAADGRVRVGDELLEINGQVLYGRSHQNATAIINNAPAKV-RILLT 1321          

HSP 6 Score: 74.7146 bits (182), Expect = 1.449e-12
Identity = 41/110 (37.27%), Postives = 61/110 (55.45%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 2494
            E ++K  W   +G  Y++L++ + K  E  GLG+SLE             + HHYI +I  +GP+G  G    GDEL+E NG  L G  ++EV++ LK LP  V +V +R
Sbjct:  516 EKSLKEKWQSKLGPQYEVLVTQVEKFIESSGLGVSLEAK-----------EGHHYICSILPEGPLGQTGIIHPGDELIEVNGFSLIGETHKEVVSLLKELPMNVCVVCSR 614          

HSP 7 Score: 63.1586 bits (152), Expect = 5.364e-9
Identity = 35/97 (36.08%), Postives = 51/97 (52.58%), Query Frame = 2
Query: 6017 QIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLC 6301
            Q  P  +T+       GLG SI+GG  +  G + I+   +  K AA  DGRL  GD++L VNG+ L   TH +A++ LR     V L++   + P C
Sbjct: 1827 QSSPQYQTITLERGSAGLGFSIVGGFGSSHGDLPIYVKNIFPKGAAVEDGRLRRGDQLLTVNGQSLEGVTHSEAVEILRQTSGTVILQVLSKRPPSC 1923          

HSP 8 Score: 59.3066 bits (142), Expect = 7.974e-8
Identity = 58/234 (24.79%), Postives = 108/234 (46.15%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDN--SVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLE-KSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
            G +  ++I K G  G+GL +VG   C+++   I   + N    A  DG+L  GD +L++N ID+   +H     +++   +  +++ L+I R  D++ +               + S++  +  T E+            D+F+V L  +  QG G  I+     ++ GI+V ++T  G A  +G L  GD+IL +N E +     D     L+ C  ++ + V R   S  ++
Sbjct: 1457 GCINTVDICK-GTTGLGLSIVGG--CNTLLGVIVIHEVNKDGAAHRDGRLWAGDHILEVNGIDLRMATHEEALSVLR---LSPQRVRLSIYR--DHVTE---------------KHSKHTSQKHTPEDMW----------DLFNVELNLQPRQGLGLCIV--GKMNDTGIFVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRCSGSVLLEVARFKASSHYS 1655          

HSP 9 Score: 58.9214 bits (141), Expect = 9.355e-8
Identity = 93/418 (22.25%), Postives = 173/418 (41.39%), Query Frame = 2
Query: 5114 VAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---------GYGDIFHVHLEKSVQGFGFFIMDCNA-NDEAGIYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEY-HMINSP-PPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSI-----QKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKI 6277
            +A  DG+L+ GD L+ +N  D+   S +    ++K   + + +I +T K  P+N ++      + N     C    N   ++   N  S  + ++         GY     V     V+G     M  +A  D +GI ++ V   G  + +G L  GD I+ +N E    + N    ++L+R       L ++         H  +     + +      ++++ H  N P  PL+  +    +++   K    +     + E I    P  ++ NS      QKV N +   +  + +EQ   E    +   +KE   +          ++L++  G  LG S+ GG        +  +   + I  + E   AA +  L  GDRIL V G D+ + TH++A++ +R  G+RV+L +
Sbjct:  716 LADRDGRLLPGDRLMFVNQTDLSHASLAQAVHVLKSTALGTVRIGVT-KPLPENDIQDTGAEITGN-----CHSEHNHQHSTFQTNSHSQKSKMEAEPVSIPSSGYERTITV-----VRGNSSLGMTVSALRDGSGIIIRSVVHGGSISKDGRLAVGDGIVALNGESTTNLTNAQARAMLRRHSLIGPDLSVMYVPAAFLDLHRASYSKSKEEMEIHTPAAVQHRHSQNLPFKPLECISEQQSVVDG--KGVNGKTQAEEENERIDEHSPIKQRENSKRLDRDQKVKNEKPALQSENRHEQ---EREKDRQRDEKETHGRDHTSWSQPRRVKLSRAGGTCLGFSVFGGRGMGSRLSNGEMRRGIFIKHIAEDSPAAHNSTLKEGDRILQVQGIDVSDFTHEEAVEAIRRAGDRVELLV 1117          

HSP 10 Score: 57.3806 bits (137), Expect = 3.193e-7
Identity = 44/213 (20.66%), Postives = 100/213 (46.95%), Query Frame = 2
Query: 4940 LSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKR-HPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            ++E  +     K + ++   + N+E++ Q ++G+GL +VG  + + +  ++        A +DG+L++GD++L +N  D+   S  + + ++++C   S  ++L + R    +          V+  +  C  + ++V+ + D   ++              H   SV+     + D   +  AG+Y+ K+    +AA  G L+ G R++ IN
Sbjct: 1545 VTEKHSKHTSQKHTPEDMWDLFNVELNLQPRQGLGLCIVGKMNDTGI--FVSEITRGGAADVDGRLLLGDQILSVNGEDIRAASQDHASALLQRC---SGSVLLEVARFKASSHYSYGDQVGEVDVPLFSCLNTHDSVDGNVDIRTVTVQK-----------HECDSVE---LRVRDTLGH--AGMYISKLDASTLAARSGLLQLGSRVISIN 1736          

HSP 11 Score: 54.6842 bits (130), Expect = 1.760e-6
Identity = 29/95 (30.53%), Postives = 54/95 (56.84%), Query Frame = 2
Query:  605 WA-ELEIVELLNDRCGLGFSLMGSKS------TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSS-DHIRLIIARPIP 865
            W  E+E+ EL     GLGFS++  +       T +VIRS+  G +A+R+G L  GD LM+++  ++   +  Q   +L+ ++   +R+ + +P+P
Sbjct:  672 WENEIEVYELQKGDSGLGFSILDYQDPVNPGRTVIVIRSLVPGGLADRDGRLLPGDRLMFVNQTDLSHASLAQAVHVLKSTALGTVRIGVTKPLP 766          

HSP 12 Score: 53.5286 bits (127), Expect = 4.627e-6
Identity = 46/138 (33.33%), Postives = 65/138 (47.10%), Query Frame = 2
Query: 5918 NQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETV--IELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---DKQPLCEDSL 6313
            + S+T   +V  Q++QE     TLT    PT +   P    +  +EL  D  GLG  IIGG  T  GT M+  +     A  DGRL +GD +L++   D+     ++    LR  G  V+L I R   D  PL   +L
Sbjct:  227 DSSVTHDQAV--QILQEAASVVTLTIAREPTPSFSTPKPRQIYHVELENDGSGLGFGIIGGRST--GT-MVKTIIPDGVAGKDGRLRSGDLLLSIGDVDVSEMGSEEVAHELRVAGTHVRLIIAREITDSDPLPASAL 359          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 211.846 bits (538), Expect = 4.961e-54
Identity = 228/843 (27.05%), Postives = 376/843 (44.60%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVD------VSMMKDSDATK-LSNCQLSDYESHEQEPLSLNSKS-DMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDES--------------------GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR---------------ITISQDHAKNIE--------TEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSI-----------PPDRKRNSIQKVLNNQSITKKVSVNEQ---VIQEVPPTKTLT--QKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGG-SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-------------------------------PLCEDSLYFK---------LKVDLLKKSRKGLGITIVSK-----SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            W++PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA K G L  GDR++ V+G DL   S++ A+  I+ A +P+VF +QS+++      + +++ +  TK L  C  + ++S +   L++N  + + ++      P +P   T  K + +   E E + S + L+  S    LS + + +    SSTD                      G++  IE++K GK G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + II KC     KI+    R+ D + +MA  P        P   + + +E   +E  + S     N+  + ++ HV L K   G G  I + +  +  G+ +K +T  G AA +G ++ GD IL ++DE VV +  + V+  L+  K  +++ +                 +T S    KN +        +EP+P+    R S      + P    +       I+  +  + +  SI    + +  +I             D +  +  ++L    I  + + +++   V+++ P    LT  + E   K + +  V   +EL K   +GLGLSI+G  +DT    V + ++ +   A +DGRL  GD++L VNG+D+RNAT +     L+     VKL++ R K                                P   DS   K           V++ K     LGI+I         DV + I+ +    +A Q  +L+ GD ++ I        T  Q  TLLK  SG + L V
Sbjct: 1192 WNNPRRVELWREPGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRKPALPLLQSTFGTKPLFRCT-NPFDSSQ---LNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPST---LSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEK-GKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSII-KCAPSKVKIIFI--RNKDAVNQMAVCPVKATEPSFPNSSAFSNLE--VEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDT---GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2010          

HSP 2 Score: 209.92 bits (533), Expect = 1.931e-53
Identity = 106/195 (54.36%), Postives = 142/195 (72.82%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET I+++K R GLGLSI+GG+DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLRNATHD+AI  LR    +V+L ++RD+    E+ +Y  L ++L KK  KGLG++IV K +D GV +SD+VKG IAE DGRL +GD LL +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1685 PATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPF 1879          

HSP 3 Score: 103.99 bits (258), Expect = 2.931e-21
Identity = 46/92 (50.00%), Postives = 67/92 (72.83%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSS 877
            W  +E VEL+ND  GLGF ++G KSTGV++++I  G VA++NG L  GDH++ I D ++ GM+SEQVA +LRQ    ++L+IAR P+ N S+
Sbjct:  256 WQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSST 347          

HSP 4 Score: 90.8929 bits (224), Expect = 2.497e-17
Identity = 67/213 (31.46%), Postives = 96/213 (45.07%), Query Frame = 2
Query: 6032 VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD-----------------------KQPLCE------DSLYFKLKVDLLKKSRKGLGITIVS------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VETV  +    GLG  I+GG  T    V++  +     A  +GRL +GD IL +   DL   + +Q  Q LR  G RVKL I R                        +  +CE      D   F +K   L K+ +GLGITI            G+ +  + KGS  EQDGR++ GD ++ ++ TN+R FT  Q   +L+    +V L + R
Sbjct:  259 VETVELVNDGSGLGFGIVGGKST---GVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQVCEGEIKDADGDAFDVK---LTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 5 Score: 89.7373 bits (221), Expect = 6.296e-17
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 6032 VETVIELTKDRG-LGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP-------------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +ET+  L    G LG S++G      G   + + E+ E   A  DGRL   D+IL++NG+ L +  TH QAI  L+    +V+L I R   P                   L     +  ++   L     GLG  IV     GV +  ++ G +A+Q+GRL  GD +L+I DT++   + +QVA +L++C   V L++ R
Sbjct:  139 IETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAKEQVQLVIARGPLPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          

HSP 6 Score: 86.6557 bits (213), Expect = 5.330e-16
Identity = 62/164 (37.80%), Postives = 94/164 (57.32%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSS-------------YMYRSYSKETVE-------ELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            +AMW   I  + L K S GLGFSI  YQD    AS+   VIVI SLVP GVA  DGR++PGDRL+F+NE+ ++  +S +E ++AL+    G V +G+AKP+  S              Y  +SY++E +        EL+  ++LE +   L  ++A+ S +++
Sbjct:  719 LAMWETDIQDILLEKGSLGLGFSILDYQDPIDPAST---VIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEH-ASLEEAVQALKGAPTGNVSIGVAKPLPLSPEEGSVSAKEDTLFYTAQSYAEEGLSDAPLFHAELALVETLEVD---LTSESALESRFSA 875          

HSP 7 Score: 85.1149 bits (209), Expect = 1.631e-15
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 2
Query: 2165 TIEDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            T E+ IKS W +I+G  Y+I+++ +NK +E  GLGISLE +             HH++R+I  +GP+G  G+  SGDELLE NG  L G  + +V+  LK LP  V +V  R+
Sbjct:  532 TDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEAS-----------GGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQ 633          

HSP 8 Score: 73.9442 bits (180), Expect = 3.922e-12
Identity = 97/431 (22.51%), Postives = 175/431 (40.60%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC---NANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQ--------MPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP 6295
            G+G  +VG K   S    +       VA  +G+L  GD +LKI   D+ GMS   VA ++++C    +++ L I R P   V+ +    S    + P   S   +ET   E +I   +     GD F V L K+ QG G  I        ++ +GI+VK +T       +G ++ GD+I++++   +        ++ LR    ++ + + R  + Q+       EP       R+  E     S  PLQ        +P + +   +D +  S             +SS+  +++               +V  +E+ I      K+  Q+      +I+  V  V + ++  GLG+S+    +   G   +  +  +      G L++GD +L VNG  L    H   +  L+ +   V +   R  +P
Sbjct:  270 GLGFGIVGGK---STGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GKRVKLVIARGP---VENSSTGVSTGVQITPALPS--LLETQVCEGEIKDAD-----GDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEP-------RKPTE-----SGQPLQNADSSEACVPIIPTSFSSDAQSQSPAN----------WSSLQAEKE--------------TQVDTDEEDI------KSKWQRIMGVGYEIV--VAKVNKFSESSGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKP 636          

HSP 9 Score: 72.7886 bits (177), Expect = 9.641e-12
Identity = 56/212 (26.42%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 6023 IPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---------DKQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            I G+ TV I+      LG+SI GG  + LG V   I  +H    AA   +L  GDRI+++ G+     TH QA+  L++    ++L++            +Q     ++ F                + K  +L++   GLG +IV        D+ + +  +     A +DGRL +GD ++ +N  ++   T ++  ++LKR  G V L V
Sbjct: 1923 IQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2134          

HSP 10 Score: 63.929 bits (154), Expect = 3.929e-9
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +   LTK  QGLG+TIAGY+  +      GIFVKSI+K S  + +G+I + DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  380 FDVKLTKNAQGLGITIAGYVGDKGS-EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 11 Score: 63.929 bits (154), Expect = 4.383e-9
Identity = 102/421 (24.23%), Postives = 168/421 (39.90%), Query Frame = 2
Query: 4409 VEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDAT-KLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTT---PPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            ++++  + LG+SI+G +            DT    G+F++ I     AE  G+L  GD+LL VNG D            ++NAT   V         +++K S  T KL   ++     H +   S +S+       LT+   P   P  A S                           D SEI+ +R               +EI K     +G+ + G        +  +I     N VAA   +L +GD ++ I      GM+HS    ++K     S  I L +              A  + SV   ++ E+ + ++   + ++S++ LQ   G      + LE+   G GF I+  + +      IYVK V   G A+ +G L  GD+I+ +N    E V +E+  S+LKR +G
Sbjct: 1796 LQKKPGKGLGLSIVGKR-----------NDT----GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGED------------VRNATQEAV--------AALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKS----------------------DTSEIQGLRT--------------VEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNA---SGTIELQVV-------------AGGDVSVVTGQQQEH-LGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKG 2128          

HSP 12 Score: 62.003 bits (149), Expect = 1.829e-8
Identity = 40/146 (27.40%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  590 MLNTEWAELEI---------VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-----------------------PIPNCSSPEYCGSMSIIPT 913
            +L T+  E EI         V+L  +  GLG ++ G      S+ +G+ ++SI  GS  E++G +++GD ++ +D  N+RG T++Q   +LR +   + L + R                       P+ N  S E C  + IIPT
Sbjct:  362 LLETQVCEGEIKDADGDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTESGQPLQNADSSEAC--VPIIPT 505          

HSP 13 Score: 58.9214 bits (141), Expect = 1.398e-7
Identity = 82/333 (24.62%), Postives = 138/333 (41.44%), Query Frame = 2
Query: 1556 IHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSG----IVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVPPSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLIANILPN--SGFNVQKMNLKYASIDKTIEDTIKSTWNKIIG--GNY--DILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            + GIF+K I ++S A  NG +   D+I+E++   +    +   VE ++        +V+   NR  K P   +L  T                    TK      N   ++   +    M    ++   SP N            P+   A+SSS+ E E                T+ ++ L     P+  S  N +K+ +  +S D   ED    +W KI    GN   ++ +  + K   GLG+SL G  D   ++        +I  I  +G  G DG  +  DELLE NG+ L+G  +Q   + +K  P++V+I+  R K+  V+Q++
Sbjct: 1228 MRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRK-PALPLLQST------------------FGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNP---------FAPTPFKASSSSDSETE---------------KTSSSNYLTG---PSTLSSVNSEKLQMT-SSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMS-------VFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDA-VNQMA 1505          

HSP 14 Score: 55.4546 bits (132), Expect = 1.560e-6
Identity = 38/108 (35.19%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  605 WAELEIVELLNDR--CGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPEYCGSMS 901
            W E +I ++L ++   GLGFS++  +      ST +VIRS+  G VAE++G L  GD LM++++IN+   + E+    L+ + + ++ + +A+P+P   SPE  GS+S
Sbjct:  722 W-ETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKPLP--LSPEE-GSVS 825          

HSP 15 Score: 55.0694 bits (131), Expect = 2.258e-6
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 2
Query: 1493 KGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            K  +GLGL+I G      + N  G+FV  I K  +A+++G+++  DQ++ +N + V      AV  +LK + G VKL+  R   GP +
Sbjct: 1799 KPGKGLGLSIVG------KRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1880          

HSP 16 Score: 54.6842 bits (130), Expect = 2.881e-6
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G ++ TGV +  I  G +AE +G L  GD L+ ++  +VR  T E VAA+L+ S   ++L + R
Sbjct: 1803 GLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGR 1873          

HSP 17 Score: 53.5286 bits (127), Expect = 5.595e-6
Identity = 33/94 (35.11%), Postives = 53/94 (56.38%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIG-----GSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLC 6301
            ++LTK+ +GLG++I G     GS+     + +  + +  A   DGR+  GD+I+ V+G +LR  T+ QA++ LR  G  V L + R   KQ  C
Sbjct:  382 VKLTKNAQGLGITIAGYVGDKGSEP--SGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEAC 473          

HSP 18 Score: 53.5286 bits (127), Expect = 6.034e-6
Identity = 49/223 (21.97%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            + M++   + G  G  ++ + +++   +  ++   +++SVA  DG+L   D++L IN   +   ++H     I++K +   E++ L I R P                  P   S +   + ++ + +S+ ++   +  +  V L     G GF I+        G+ VK +   G+A   G L  GD IL I D  +     + V + LR C   +++V+ R
Sbjct:  140 ETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAK---EQVQLVIARGP-----------------LPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIV---GGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 211.46 bits (537), Expect = 6.256e-54
Identity = 218/815 (26.75%), Postives = 356/815 (43.68%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR---------------ITISQDHAKNIE--------TEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSI-----------PPDRKRNSIQKVLNNQSITKKVSVNEQ---VIQEVPPTKTLT--QKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGG-SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-------------------------------PLCEDSLYFK---------LKVDLLKKSRKGLGITIVSK-----SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            W++PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA K G L  GDR++ V+G DL   S++ A+  I+ A +P+VF +QS+++      +       C  S        P   +S SD   +K ++       +T + +N  +     ++              +S+    R G+       G++  IE++K GK G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + II KC     KI+    R+ D + +MA  P        P   + + +E   +E  + S     N+  + ++ HV L K   G G  I + +  +  G+ +K +T  G AA +G ++ GD IL ++DE VV +  + V+  L+  K  +++ +                 +T S    KN +        +EP+P+    R S      + P    +       I+  +  + +  SI    + +  +I             D +  +  ++L    I  + + +++   V+++ P    LT  + E   K + +  V   +EL K   +GLGLSI+G  +DT    V + ++ +   A +DGRL  GD++L VNG+D+RNAT +     L+     VKL++ R K                                P   DS   K           V++ K     LGI+I         DV + I+ +    +A Q  +L+ GD ++ I        T  Q  TLLK  SG + L V
Sbjct: 1192 WNNPRRVELWREPGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRGTMNPVRIAFRC--SPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLSSVNSEKLQMTSSTDPEKEDEFGYSWKKISQ----RYGNLP-----GELHMIELEK-GKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSII-KCAPSKVKIIFI--RNKDAVNQMAVCPVKATEPSFPNSSAFSNLE--VEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDT---GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 1978          

HSP 2 Score: 209.92 bits (533), Expect = 2.092e-53
Identity = 106/195 (54.36%), Postives = 142/195 (72.82%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET I+++K R GLGLSI+GG+DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLRNATHD+AI  LR    +V+L ++RD+    E+ +Y  L ++L KK  KGLG++IV K +D GV +SD+VKG IAE DGRL +GD LL +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1653 PATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPF 1847          

HSP 3 Score: 103.99 bits (258), Expect = 3.149e-21
Identity = 46/92 (50.00%), Postives = 67/92 (72.83%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSS 877
            W  +E VEL+ND  GLGF ++G KSTGV++++I  G VA++NG L  GDH++ I D ++ GM+SEQVA +LRQ    ++L+IAR P+ N S+
Sbjct:  256 WQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSST 347          

HSP 4 Score: 90.8929 bits (224), Expect = 2.509e-17
Identity = 67/213 (31.46%), Postives = 96/213 (45.07%), Query Frame = 2
Query: 6032 VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD-----------------------KQPLCE------DSLYFKLKVDLLKKSRKGLGITIVS------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VETV  +    GLG  I+GG  T    V++  +     A  +GRL +GD IL +   DL   + +Q  Q LR  G RVKL I R                        +  +CE      D   F +K   L K+ +GLGITI            G+ +  + KGS  EQDGR++ GD ++ ++ TN+R FT  Q   +L+    +V L + R
Sbjct:  259 VETVELVNDGSGLGFGIVGGKST---GVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQVCEGEIKDADGDAFDVK---LTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 5 Score: 89.3521 bits (220), Expect = 7.679e-17
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 6032 VETVIELTKDRG-LGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP-------------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +ET+  L    G LG S++G      G   + + E+ E   A  DGRL   D+IL++NG+ L +  TH QAI  L+    +V+L I R   P                   L     +  ++   L     GLG  IV     GV +  ++ G +A+Q+GRL  GD +L+I DT++   + +QVA +L++C   V L++ R
Sbjct:  139 IETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAKEQVQLVIARGPLPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          

HSP 6 Score: 86.6557 bits (213), Expect = 6.077e-16
Identity = 62/164 (37.80%), Postives = 94/164 (57.32%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSS-------------YMYRSYSKETVE-------ELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            +AMW   I  + L K S GLGFSI  YQD    AS+   VIVI SLVP GVA  DGR++PGDRL+F+NE+ ++  +S +E ++AL+    G V +G+AKP+  S              Y  +SY++E +        EL+  ++LE +   L  ++A+ S +++
Sbjct:  719 LAMWETDIQDILLEKGSLGLGFSILDYQDPIDPAST---VIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEH-ASLEEAVQALKGAPTGNVSIGVAKPLPLSPEEGSVSAKEDTLFYTAQSYAEEGLSDAPLFHAELALVETLEVD---LTSESALESRFSA 875          

HSP 7 Score: 85.1149 bits (209), Expect = 1.653e-15
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 2
Query: 2165 TIEDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            T E+ IKS W +I+G  Y+I+++ +NK +E  GLGISLE +             HH++R+I  +GP+G  G+  SGDELLE NG  L G  + +V+  LK LP  V +V  R+
Sbjct:  532 TDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEAS-----------GGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQ 633          

HSP 8 Score: 73.9442 bits (180), Expect = 4.012e-12
Identity = 97/431 (22.51%), Postives = 175/431 (40.60%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC---NANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQ--------MPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP 6295
            G+G  +VG K   S    +       VA  +G+L  GD +LKI   D+ GMS   VA ++++C    +++ L I R P   V+ +    S    + P   S   +ET   E +I   +     GD F V L K+ QG G  I        ++ +GI+VK +T       +G ++ GD+I++++   +        ++ LR    ++ + + R  + Q+       EP       R+  E     S  PLQ        +P + +   +D +  S             +SS+  +++               +V  +E+ I      K+  Q+      +I+  V  V + ++  GLG+S+    +   G   +  +  +      G L++GD +L VNG  L    H   +  L+ +   V +   R  +P
Sbjct:  270 GLGFGIVGGK---STGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GKRVKLVIARGP---VENSSTGVSTGVQITPALPS--LLETQVCEGEIKDAD-----GDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEP-------RKPTE-----SGQPLQNADSSEACVPIIPTSFSSDAQSQSPAN----------WSSLQAEKE--------------TQVDTDEEDI------KSKWQRIMGVGYEIV--VAKVNKFSESSGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKP 636          

HSP 9 Score: 72.4034 bits (176), Expect = 1.020e-11
Identity = 56/212 (26.42%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 6023 IPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---------DKQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            I G+ TV I+      LG+SI GG  + LG V   I  +H    AA   +L  GDRI+++ G+     TH QA+  L++    ++L++            +Q     ++ F                + K  +L++   GLG +IV        D+ + +  +     A +DGRL +GD ++ +N  ++   T ++  ++LKR  G V L V
Sbjct: 1891 IQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2102          

HSP 10 Score: 63.929 bits (154), Expect = 3.855e-9
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +   LTK  QGLG+TIAGY+  +      GIFVKSI+K S  + +G+I + DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  380 FDVKLTKNAQGLGITIAGYVGDKGS-EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 11 Score: 63.929 bits (154), Expect = 4.373e-9
Identity = 102/421 (24.23%), Postives = 168/421 (39.90%), Query Frame = 2
Query: 4409 VEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDAT-KLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTT---PPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            ++++  + LG+SI+G +            DT    G+F++ I     AE  G+L  GD+LL VNG D            ++NAT   V         +++K S  T KL   ++     H +   S +S+       LT+   P   P  A S                           D SEI+ +R               +EI K     +G+ + G        +  +I     N VAA   +L +GD ++ I      GM+HS    ++K     S  I L +              A  + SV   ++ E+ + ++   + ++S++ LQ   G      + LE+   G GF I+  + +      IYVK V   G A+ +G L  GD+I+ +N    E V +E+  S+LKR +G
Sbjct: 1764 LQKKPGKGLGLSIVGKR-----------NDT----GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGED------------VRNATQEAV--------AALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKS----------------------DTSEIQGLRT--------------VEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNA---SGTIELQVV-------------AGGDVSVVTGQQQEH-LGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKG 2096          

HSP 12 Score: 61.6178 bits (148), Expect = 1.936e-8
Identity = 40/146 (27.40%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  590 MLNTEWAELEI---------VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-----------------------PIPNCSSPEYCGSMSIIPT 913
            +L T+  E EI         V+L  +  GLG ++ G      S+ +G+ ++SI  GS  E++G +++GD ++ +D  N+RG T++Q   +LR +   + L + R                       P+ N  S E C  + IIPT
Sbjct:  362 LLETQVCEGEIKDADGDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTESGQPLQNADSSEAC--VPIIPT 505          

HSP 13 Score: 55.4546 bits (132), Expect = 1.384e-6
Identity = 44/141 (31.21%), Postives = 71/141 (50.35%), Query Frame = 2
Query: 2114 SGFNVQKMNLKYASIDKTIEDTIKSTWNKIIG--GNY--DILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            S  N +K+ +  +S D   ED    +W KI    GN   ++ +  + K   GLG+SL G  D         +   +I  I  +G  G DG  +  DELLE NG+ L+G  +Q   + +K  P++V+I+  R K+  V+Q++
Sbjct: 1342 SSVNSEKLQMT-SSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKD-------RSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDA-VNQMA 1473          

HSP 14 Score: 55.4546 bits (132), Expect = 1.781e-6
Identity = 38/108 (35.19%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  605 WAELEIVELLNDR--CGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPEYCGSMS 901
            W E +I ++L ++   GLGFS++  +      ST +VIRS+  G VAE++G L  GD LM++++IN+   + E+    L+ + + ++ + +A+P+P   SPE  GS+S
Sbjct:  722 W-ETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKPLP--LSPEE-GSVS 825          

HSP 15 Score: 55.0694 bits (131), Expect = 2.292e-6
Identity = 29/85 (34.12%), Postives = 48/85 (56.47%), Query Frame = 2
Query: 1502 QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +GLGL+I G      + N  G+FV  I K  +A+++G+++  DQ++ +N + V      AV  +LK + G VKL+  R   GP +
Sbjct: 1770 KGLGLSIVG------KRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1848          

HSP 16 Score: 54.299 bits (129), Expect = 3.235e-6
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G ++ TGV +  I  G +AE +G L  GD L+ ++  +VR  T E VAA+L+ S   ++L + R
Sbjct: 1771 GLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGR 1841          

HSP 17 Score: 53.5286 bits (127), Expect = 5.874e-6
Identity = 33/94 (35.11%), Postives = 53/94 (56.38%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIG-----GSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLC 6301
            ++LTK+ +GLG++I G     GS+     + +  + +  A   DGR+  GD+I+ V+G +LR  T+ QA++ LR  G  V L + R   KQ  C
Sbjct:  382 VKLTKNAQGLGITIAGYVGDKGSEP--SGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEAC 473          

HSP 18 Score: 53.5286 bits (127), Expect = 6.126e-6
Identity = 49/223 (21.97%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            + M++   + G  G  ++ + +++   +  ++   +++SVA  DG+L   D++L IN   +   ++H     I++K +   E++ L I R P                  P   S +   + ++ + +S+ ++   +  +  V L     G GF I+        G+ VK +   G+A   G L  GD IL I D  +     + V + LR C   +++V+ R
Sbjct:  140 ETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAK---EQVQLVIARGP-----------------LPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIV---GGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 209.92 bits (533), Expect = 1.764e-53
Identity = 106/195 (54.36%), Postives = 142/195 (72.82%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET I+++K R GLGLSI+GG+DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLRNATHD+AI  LR    +V+L ++RD+    E+ +Y  L ++L KK  KGLG++IV K +D GV +SD+VKG IAE DGRL +GD LL +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1713 PATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPF 1907          

HSP 2 Score: 150.984 bits (380), Expect = 1.766e-35
Identity = 163/612 (26.63%), Postives = 264/612 (43.14%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR---------------ITISQDHAKNIE--------TEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSI-----------PPDRKRNSIQKVLNNQSITKKVSVNEQ---VIQEVPPTKTLT--QKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGG-SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-------------------------------PLCEDSLYFK---------LKVDLLKKSRKGLGITIVSK-----SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            G++  IE++K GK G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + II KC     KI+    R+ D + +MA  P        P   + + +E   +E  + S     N+  + ++ HV L K   G G  I + +  +  G+ +K +T  G AA +G ++ GD IL ++DE VV +  + V+  L+  K  +++ +                 +T S    KN +        +EP+P+    R S      + P    +       I+  +  + +  SI    + +  +I             D +  +  ++L    I  + + +++   V+++ P    LT  + E   K + +  V   +EL K   +GLGLSI+G  +DT    V + ++ +   A +DGRL  GD++L VNG+D+RNAT +     L+     VKL++ R K                                P   DS   K           V++ K     LGI+I         DV + I+ +    +A Q  +L+ GD ++ I        T  Q  TLLK  SG + L V
Sbjct: 1439 GELHMIELEK-GKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSII-KCAPSKVKIIFI--RNKDAVNQMAVCPVKATEPSFPNSSAFSNLE--VEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDV-LDLELQKKPGKGLGLSIVGKRNDT---GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2038          

HSP 3 Score: 103.99 bits (258), Expect = 2.942e-21
Identity = 46/92 (50.00%), Postives = 67/92 (72.83%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSS 877
            W  +E VEL+ND  GLGF ++G KSTGV++++I  G VA++NG L  GDH++ I D ++ GM+SEQVA +LRQ    ++L+IAR P+ N S+
Sbjct:  256 WQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSST 347          

HSP 4 Score: 91.2781 bits (225), Expect = 2.264e-17
Identity = 67/213 (31.46%), Postives = 96/213 (45.07%), Query Frame = 2
Query: 6032 VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD-----------------------KQPLCE------DSLYFKLKVDLLKKSRKGLGITIVS------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VETV  +    GLG  I+GG  T    V++  +     A  +GRL +GD IL +   DL   + +Q  Q LR  G RVKL I R                        +  +CE      D   F +K   L K+ +GLGITI            G+ +  + KGS  EQDGR++ GD ++ ++ TN+R FT  Q   +L+    +V L + R
Sbjct:  259 VETVELVNDGSGLGFGIVGGKST---GVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQVCEGEIKDADGDAFDVK---LTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 5 Score: 90.1225 bits (222), Expect = 5.382e-17
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 6032 VETVIELTKDRG-LGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP-------------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +ET+  L    G LG S++G      G   + + E+ E   A  DGRL   D+IL++NG+ L +  TH QAI  L+    +V+L I R   P                   L     +  ++   L     GLG  IV     GV +  ++ G +A+Q+GRL  GD +L+I DT++   + +QVA +L++C   V L++ R
Sbjct:  139 IETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAKEQVQLVIARGPLPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          

HSP 6 Score: 87.0409 bits (214), Expect = 3.754e-16
Identity = 43/104 (41.35%), Postives = 66/104 (63.46%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVD 4696
            W++PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA K G L  GDR++ V+G DL   S++ A+  I+ A +P+VF +QS+++
Sbjct: 1192 WNNPRRVELWREPGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIIN 1290          

HSP 7 Score: 86.6557 bits (213), Expect = 5.435e-16
Identity = 62/164 (37.80%), Postives = 94/164 (57.32%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSS-------------YMYRSYSKETVE-------ELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            +AMW   I  + L K S GLGFSI  YQD    AS+   VIVI SLVP GVA  DGR++PGDRL+F+NE+ ++  +S +E ++AL+    G V +G+AKP+  S              Y  +SY++E +        EL+  ++LE +   L  ++A+ S +++
Sbjct:  719 LAMWETDIQDILLEKGSLGLGFSILDYQDPIDPAST---VIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEH-ASLEEAVQALKGAPTGNVSIGVAKPLPLSPEEGSVSAKEDTLFYTAQSYAEEGLSDAPLFHAELALVETLEVD---LTSESALESRFSA 875          

HSP 8 Score: 85.1149 bits (209), Expect = 1.555e-15
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 2
Query: 2165 TIEDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            T E+ IKS W +I+G  Y+I+++ +NK +E  GLGISLE +             HH++R+I  +GP+G  G+  SGDELLE NG  L G  + +V+  LK LP  V +V  R+
Sbjct:  532 TDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGG-----------HHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQ 633          

HSP 9 Score: 80.8777 bits (198), Expect = 2.803e-14
Identity = 111/448 (24.78%), Postives = 174/448 (38.84%), Query Frame = 2
Query: 5438 VQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPP-------LQMPTVISPIIN------------DERKMSAVR------PSISHDKEPIYSSIPPDRK--RNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQII-------PGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ--------------------------------------PLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDV-GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            V G G      N     GI++K +  D  A   GTL+ GDRI+ ++   + +  ++  ++ +R   N +  +V  I I++   +++   P   S   R+    +  + P P       LQ      P+              ++  M+ VR      P+      P  +S   D +  + S    L   S     SVN + +Q    T    + E     + I       PG   +IEL K + GLGLS+ G  D    +V I  +    AA  DGRL   D +L +NG+ L   +H  A   ++   ++VK+   R+K                                       PL   S    L V+ L K + GLGI I  +  V GV I  L     A +DGR+K GD +L ++D  V     ++V  LLK+    V L +
Sbjct: 1213 VGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSI-INRPRPESVYCSPS--SSALRQHPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLS--SVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVE-LPKDQGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI 1654          

HSP 10 Score: 73.9442 bits (180), Expect = 3.675e-12
Identity = 97/431 (22.51%), Postives = 175/431 (40.60%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC---NANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQ--------MPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP 6295
            G+G  +VG K   S    +       VA  +G+L  GD +LKI   D+ GMS   VA ++++C    +++ L I R P   V+ +    S    + P   S   +ET   E +I   +     GD F V L K+ QG G  I        ++ +GI+VK +T       +G ++ GD+I++++   +        ++ LR    ++ + + R  + Q+       EP       R+  E     S  PLQ        +P + +   +D +  S             +SS+  +++               +V  +E+ I      K+  Q+      +I+  V  V + ++  GLG+S+    +   G   +  +  +      G L++GD +L VNG  L    H   +  L+ +   V +   R  +P
Sbjct:  270 GLGFGIVGGK---STGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GKRVKLVIARGP---VENSSTGVSTGVQITPALPS--LLETQVCEGEIKDAD-----GDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEP-------RKPTE-----SGQPLQNADSSEACVPIIPTSFSSDAQSQSPAN----------WSSLQAEKE--------------TQVDTDEEDI------KSKWQRIMGVGYEIV--VAKVNKFSESSGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKP 636          

HSP 11 Score: 72.7886 bits (177), Expect = 7.700e-12
Identity = 56/212 (26.42%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 6023 IPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---------DKQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            I G+ TV I+      LG+SI GG  + LG V   I  +H    AA   +L  GDRI+++ G+     TH QA+  L++    ++L++            +Q     ++ F                + K  +L++   GLG +IV        D+ + +  +     A +DGRL +GD ++ +N  ++   T ++  ++LKR  G V L V
Sbjct: 1951 IQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2162          

HSP 12 Score: 63.929 bits (154), Expect = 3.806e-9
Identity = 102/421 (24.23%), Postives = 168/421 (39.90%), Query Frame = 2
Query: 4409 VEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDAT-KLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTT---PPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            ++++  + LG+SI+G +            DT    G+F++ I     AE  G+L  GD+LL VNG D            ++NAT   V         +++K S  T KL   ++     H +   S +S+       LT+   P   P  A S                           D SEI+ +R               +EI K     +G+ + G        +  +I     N VAA   +L +GD ++ I      GM+HS    ++K     S  I L +              A  + SV   ++ E+ + ++   + ++S++ LQ   G      + LE+   G GF I+  + +      IYVK V   G A+ +G L  GD+I+ +N    E V +E+  S+LKR +G
Sbjct: 1824 LQKKPGKGLGLSIVGKR-----------NDT----GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGED------------VRNATQEAV--------AALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKS----------------------DTSEIQGLRT--------------VEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNA---SGTIELQVV-------------AGGDVSVVTGQQQEH-LGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKG 2156          

HSP 13 Score: 63.929 bits (154), Expect = 3.838e-9
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +   LTK  QGLG+TIAGY+  +      GIFVKSI+K S  + +G+I + DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  380 FDVKLTKNAQGLGITIAGYVGDKGS-EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 14 Score: 61.6178 bits (148), Expect = 1.943e-8
Identity = 40/146 (27.40%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  590 MLNTEWAELEI---------VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-----------------------PIPNCSSPEYCGSMSIIPT 913
            +L T+  E EI         V+L  +  GLG ++ G      S+ +G+ ++SI  GS  E++G +++GD ++ +D  N+RG T++Q   +LR +   + L + R                       P+ N  S E C  + IIPT
Sbjct:  362 LLETQVCEGEIKDADGDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTESGQPLQNADSSEAC--VPIIPT 505          

HSP 15 Score: 59.3066 bits (142), Expect = 9.757e-8
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRV 6265
            +EL ++ G  LG+SI+GG        +  ++  + I  + E   A  +G L  GDRI+ V+G DLR+A+H+QA++ +R  GN V
Sbjct: 1198 VELWREPGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPV 1281          

HSP 16 Score: 58.151 bits (139), Expect = 2.418e-7
Identity = 85/348 (24.43%), Postives = 143/348 (41.09%), Query Frame = 2
Query: 1556 IHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSG----IVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSN-----SSINNSMKTTNETLTLQPMIYTILSNDESPVN-----NCPENIDVSVVP-----PSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLIANILPN--SGFNVQKMNLKYASIDKTIEDTIKSTWNKIIG--GNY--DILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            + GIF+K I ++S A  NG +   D+I+E++   +    +   VE ++        +V+   NR     VY   + +A                  H  +N     S    ++     T   +P+       D S +N       P  I     P     P+   A+SSS+ E E                T+ ++ L     P+  S  N +K+ +  +S D   ED    +W KI    GN   ++ +  + K   GLG+SL G  D   ++        +I  I  +G  G DG  +  DELLE NG+ L+G  +Q   + +K  P++V+I+  R K+  V+Q++
Sbjct: 1228 MRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRPESVYCSPSSSALRQ---------------HPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETE---------------KTSSSNYLTG---PSTLSSVNSEKLQMT-SSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMS-------VFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDA-VNQMA 1533          

HSP 17 Score: 56.225 bits (134), Expect = 9.046e-7
Identity = 55/255 (21.57%), Postives = 113/255 (44.31%), Query Frame = 2
Query: 4931 TPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLT-IKRHPDNLVKMACIPASVNTSVA---------PCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVV 5656
            TP    +   R+  +   ++   V+++E+ K+  KG+GL +VG ++ + +  ++       +A +DG+LM GD+LL +N  DV   +   VA ++ KC + + K+ +  IK  P +  +     + V+   +         P   + ++    +D ++I     ++   G  D   + +     G G  + D        I++  +  +G+AA    LR GDRI+ I  +      +   +  L+     +E+ V
Sbjct: 1796 TPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGV--FVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALL-KCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISI---AGGVGSPLGDVP------IFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2038          

HSP 18 Score: 55.4546 bits (132), Expect = 1.549e-6
Identity = 38/108 (35.19%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  605 WAELEIVELLNDR--CGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPEYCGSMS 901
            W E +I ++L ++   GLGFS++  +      ST +VIRS+  G VAE++G L  GD LM++++IN+   + E+    L+ + + ++ + +A+P+P   SPE  GS+S
Sbjct:  722 W-ETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKPLP--LSPEE-GSVS 825          

HSP 19 Score: 55.0694 bits (131), Expect = 2.205e-6
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 2
Query: 1493 KGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            K  +GLGL+I G      + N  G+FV  I K  +A+++G+++  DQ++ +N + V      AV  +LK + G VKL+  R   GP +
Sbjct: 1827 KPGKGLGLSIVG------KRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1908          

HSP 20 Score: 54.6842 bits (130), Expect = 2.934e-6
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G ++ TGV +  I  G +AE +G L  GD L+ ++  +VR  T E VAA+L+ S   ++L + R
Sbjct: 1831 GLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGR 1901          

HSP 21 Score: 53.9138 bits (128), Expect = 5.195e-6
Identity = 49/223 (21.97%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            + M++   + G  G  ++ + +++   +  ++   +++SVA  DG+L   D++L IN   +   ++H     I++K +   E++ L I R P                  P   S +   + ++ + +S+ ++   +  +  V L     G GF I+        G+ VK +   G+A   G L  GD IL I D  +     + V + LR C   +++V+ R
Sbjct:  140 ETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAK---EQVQLVIARGP-----------------LPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIV---GGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          

HSP 22 Score: 53.5286 bits (127), Expect = 5.418e-6
Identity = 33/94 (35.11%), Postives = 53/94 (56.38%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIG-----GSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLC 6301
            ++LTK+ +GLG++I G     GS+     + +  + +  A   DGR+  GD+I+ V+G +LR  T+ QA++ LR  G  V L + R   KQ  C
Sbjct:  382 VKLTKNAQGLGITIAGYVGDKGSEP--SGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEAC 473          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 209.92 bits (533), Expect = 1.790e-53
Identity = 106/195 (54.36%), Postives = 142/195 (72.82%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET I+++K R GLGLSI+GG+DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLRNATHD+AI  LR    +V+L ++RD+    E+ +Y  L ++L KK  KGLG++IV K +D GV +SD+VKG IAE DGRL +GD LL +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1686 PATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPF 1880          

HSP 2 Score: 150.599 bits (379), Expect = 1.926e-35
Identity = 163/612 (26.63%), Postives = 264/612 (43.14%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR---------------ITISQDHAKNIE--------TEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSI-----------PPDRKRNSIQKVLNNQSITKKVSVNEQ---VIQEVPPTKTLT--QKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGG-SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-------------------------------PLCEDSLYFK---------LKVDLLKKSRKGLGITIVSK-----SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            G++  IE++K GK G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + II KC     KI+    R+ D + +MA  P        P   + + +E   +E  + S     N+  + ++ HV L K   G G  I + +  +  G+ +K +T  G AA +G ++ GD IL ++DE VV +  + V+  L+  K  +++ +                 +T S    KN +        +EP+P+    R S      + P    +       I+  +  + +  SI    + +  +I             D +  +  ++L    I  + + +++   V+++ P    LT  + E   K + +  V   +EL K   +GLGLSI+G  +DT    V + ++ +   A +DGRL  GD++L VNG+D+RNAT +     L+     VKL++ R K                                P   DS   K           V++ K     LGI+I         DV + I+ +    +A Q  +L+ GD ++ I        T  Q  TLLK  SG + L V
Sbjct: 1412 GELHMIELEK-GKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSII-KCAPSKVKIIFI--RNKDAVNQMAVCPVKATEPSFPNSSAFSNLE--VEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDV-LDLELQKKPGKGLGLSIVGKRNDT---GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2011          

HSP 3 Score: 103.99 bits (258), Expect = 3.007e-21
Identity = 46/92 (50.00%), Postives = 67/92 (72.83%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSS 877
            W  +E VEL+ND  GLGF ++G KSTGV++++I  G VA++NG L  GDH++ I D ++ GM+SEQVA +LRQ    ++L+IAR P+ N S+
Sbjct:  256 WQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSST 347          

HSP 4 Score: 90.8929 bits (224), Expect = 2.476e-17
Identity = 67/213 (31.46%), Postives = 96/213 (45.07%), Query Frame = 2
Query: 6032 VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD-----------------------KQPLCE------DSLYFKLKVDLLKKSRKGLGITIVS------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VETV  +    GLG  I+GG  T    V++  +     A  +GRL +GD IL +   DL   + +Q  Q LR  G RVKL I R                        +  +CE      D   F +K   L K+ +GLGITI            G+ +  + KGS  EQDGR++ GD ++ ++ TN+R FT  Q   +L+    +V L + R
Sbjct:  259 VETVELVNDGSGLGFGIVGGKST---GVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQVCEGEIKDADGDAFDVK---LTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 5 Score: 89.7373 bits (221), Expect = 5.887e-17
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 6032 VETVIELTKDRG-LGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP-------------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +ET+  L    G LG S++G      G   + + E+ E   A  DGRL   D+IL++NG+ L +  TH QAI  L+    +V+L I R   P                   L     +  ++   L     GLG  IV     GV +  ++ G +A+Q+GRL  GD +L+I DT++   + +QVA +L++C   V L++ R
Sbjct:  139 IETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAKEQVQLVIARGPLPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          

HSP 6 Score: 87.4261 bits (215), Expect = 3.590e-16
Identity = 43/104 (41.35%), Postives = 66/104 (63.46%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVD 4696
            W++PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA K G L  GDR++ V+G DL   S++ A+  I+ A +P+VF +QS+++
Sbjct: 1165 WNNPRRVELWREPGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIIN 1263          

HSP 7 Score: 86.6557 bits (213), Expect = 5.285e-16
Identity = 62/164 (37.80%), Postives = 94/164 (57.32%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSS-------------YMYRSYSKETVE-------ELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            +AMW   I  + L K S GLGFSI  YQD    AS+   VIVI SLVP GVA  DGR++PGDRL+F+NE+ ++  +S +E ++AL+    G V +G+AKP+  S              Y  +SY++E +        EL+  ++LE +   L  ++A+ S +++
Sbjct:  692 LAMWETDIQDILLEKGSLGLGFSILDYQDPIDPAST---VIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEH-ASLEEAVQALKGAPTGNVSIGVAKPLPLSPEEGSVSAKEDTLFYTAQSYAEEGLSDAPLFHAELALVETLEVD---LTSESALESRFSA 848          

HSP 8 Score: 85.1149 bits (209), Expect = 1.617e-15
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 2
Query: 2165 TIEDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            T E+ IKS W +I+G  Y+I+++ +NK +E  GLGISLE +             HH++R+I  +GP+G  G+  SGDELLE NG  L G  + +V+  LK LP  V +V  R+
Sbjct:  505 TDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGG-----------HHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQ 606          

HSP 9 Score: 80.8777 bits (198), Expect = 3.337e-14
Identity = 111/448 (24.78%), Postives = 174/448 (38.84%), Query Frame = 2
Query: 5438 VQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPP-------LQMPTVISPIIN------------DERKMSAVR------PSISHDKEPIYSSIPPDRK--RNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQII-------PGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ--------------------------------------PLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDV-GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            V G G      N     GI++K +  D  A   GTL+ GDRI+ ++   + +  ++  ++ +R   N +  +V  I I++   +++   P   S   R+    +  + P P       LQ      P+              ++  M+ VR      P+      P  +S   D +  + S    L   S     SVN + +Q    T    + E     + I       PG   +IEL K + GLGLS+ G  D    +V I  +    AA  DGRL   D +L +NG+ L   +H  A   ++   ++VK+   R+K                                       PL   S    L V+ L K + GLGI I  +  V GV I  L     A +DGR+K GD +L ++D  V     ++V  LLK+    V L +
Sbjct: 1186 VGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSI-INRPRPESVYCSPS--SSALRQHPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLS--SVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVE-LPKDQGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI 1627          

HSP 10 Score: 75.0998 bits (183), Expect = 1.735e-12
Identity = 95/423 (22.46%), Postives = 163/423 (38.53%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC---NANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP 6295
            G+G  +VG K   S    +       VA  +G+L  GD +LKI   D+ GMS   VA ++++C    +++ L I R P   V+ +    S    + P   S   +ET   E +I   +     GD F V L K+ QG G  I        ++ +GI+VK +T       +G ++ GD+I++++               LRG  N   + V R T    H                                      ++    K  A  P +   ++P  S  P       +Q   +++    +V  +E+ I      K+  Q+      +I+  V  V + ++  GLG+S+    +   G   +  +  +      G L++GD +L VNG  L    H   +  L+ +   V +   R  +P
Sbjct:  270 GLGFGIVGGK---STGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GKRVKLVIARGP---VENSSTGVSTGVQITPALPS--LLETQVCEGEIKDAD-----GDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDG------------TNLRGFTNQQAVEVLRHTGQSVHLT------------------------------------LVRRGLKQEACIPQVEEPRKPTESGQP-------LQNADSSEEKETQVDTDEEDI------KSKWQRIMGVGYEIV--VAKVNKFSESSGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKP 609          

HSP 11 Score: 72.7886 bits (177), Expect = 8.644e-12
Identity = 56/212 (26.42%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 6023 IPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---------DKQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            I G+ TV I+      LG+SI GG  + LG V   I  +H    AA   +L  GDRI+++ G+     TH QA+  L++    ++L++            +Q     ++ F                + K  +L++   GLG +IV        D+ + +  +     A +DGRL +GD ++ +N  ++   T ++  ++LKR  G V L V
Sbjct: 1924 IQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2135          

HSP 12 Score: 64.3142 bits (155), Expect = 3.674e-9
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +   LTK  QGLG+TIAGY+  +      GIFVKSI+K S  + +G+I + DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  380 FDVKLTKNAQGLGITIAGYVGDKGS-EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 13 Score: 63.929 bits (154), Expect = 4.030e-9
Identity = 102/421 (24.23%), Postives = 168/421 (39.90%), Query Frame = 2
Query: 4409 VEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDAT-KLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTT---PPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            ++++  + LG+SI+G +            DT    G+F++ I     AE  G+L  GD+LL VNG D            ++NAT   V         +++K S  T KL   ++     H +   S +S+       LT+   P   P  A S                           D SEI+ +R               +EI K     +G+ + G        +  +I     N VAA   +L +GD ++ I      GM+HS    ++K     S  I L +              A  + SV   ++ E+ + ++   + ++S++ LQ   G      + LE+   G GF I+  + +      IYVK V   G A+ +G L  GD+I+ +N    E V +E+  S+LKR +G
Sbjct: 1797 LQKKPGKGLGLSIVGKR-----------NDT----GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGED------------VRNATQEAV--------AALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKS----------------------DTSEIQGLRT--------------VEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNA---SGTIELQVV-------------AGGDVSVVTGQQQEH-LGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKG 2129          

HSP 14 Score: 60.8474 bits (146), Expect = 3.769e-8
Identity = 31/104 (29.81%), Postives = 57/104 (54.81%), Query Frame = 2
Query:  590 MLNTEWAELEI---------VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +L T+  E EI         V+L  +  GLG ++ G      S+ +G+ ++SI  GS  E++G +++GD ++ +D  N+RG T++Q   +LR +   + L + R
Sbjct:  362 LLETQVCEGEIKDADGDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 15 Score: 59.3066 bits (142), Expect = 1.025e-7
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRV 6265
            +EL ++ G  LG+SI+GG        +  ++  + I  + E   A  +G L  GDRI+ V+G DLR+A+H+QA++ +R  GN V
Sbjct: 1171 VELWREPGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPV 1254          

HSP 16 Score: 58.151 bits (139), Expect = 2.435e-7
Identity = 85/348 (24.43%), Postives = 143/348 (41.09%), Query Frame = 2
Query: 1556 IHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSG----IVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSN-----SSINNSMKTTNETLTLQPMIYTILSNDESPVN-----NCPENIDVSVVP-----PSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLIANILPN--SGFNVQKMNLKYASIDKTIEDTIKSTWNKIIG--GNY--DILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            + GIF+K I ++S A  NG +   D+I+E++   +    +   VE ++        +V+   NR     VY   + +A                  H  +N     S    ++     T   +P+       D S +N       P  I     P     P+   A+SSS+ E E                T+ ++ L     P+  S  N +K+ +  +S D   ED    +W KI    GN   ++ +  + K   GLG+SL G  D   ++        +I  I  +G  G DG  +  DELLE NG+ L+G  +Q   + +K  P++V+I+  R K+  V+Q++
Sbjct: 1201 MRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRPESVYCSPSSSALRQ---------------HPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETE---------------KTSSSNYLTG---PSTLSSVNSEKLQMT-SSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMS-------VFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDA-VNQMA 1506          

HSP 17 Score: 56.225 bits (134), Expect = 9.500e-7
Identity = 55/255 (21.57%), Postives = 113/255 (44.31%), Query Frame = 2
Query: 4931 TPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLT-IKRHPDNLVKMACIPASVNTSVA---------PCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVV 5656
            TP    +   R+  +   ++   V+++E+ K+  KG+GL +VG ++ + +  ++       +A +DG+LM GD+LL +N  DV   +   VA ++ KC + + K+ +  IK  P +  +     + V+   +         P   + ++    +D ++I     ++   G  D   + +     G G  + D        I++  +  +G+AA    LR GDRI+ I  +      +   +  L+     +E+ V
Sbjct: 1769 TPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGV--FVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALL-KCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISI---AGGVGSPLGDVP------IFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2011          

HSP 18 Score: 55.4546 bits (132), Expect = 1.627e-6
Identity = 38/108 (35.19%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  605 WAELEIVELLNDR--CGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPEYCGSMS 901
            W E +I ++L ++   GLGFS++  +      ST +VIRS+  G VAE++G L  GD LM++++IN+   + E+    L+ + + ++ + +A+P+P   SPE  GS+S
Sbjct:  695 W-ETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKPLP--LSPEE-GSVS 798          

HSP 19 Score: 55.0694 bits (131), Expect = 2.239e-6
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 2
Query: 1493 KGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            K  +GLGL+I G      + N  G+FV  I K  +A+++G+++  DQ++ +N + V      AV  +LK + G VKL+  R   GP +
Sbjct: 1800 KPGKGLGLSIVG------KRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1881          

HSP 20 Score: 54.6842 bits (130), Expect = 2.979e-6
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G ++ TGV +  I  G +AE +G L  GD L+ ++  +VR  T E VAA+L+ S   ++L + R
Sbjct: 1804 GLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGR 1874          

HSP 21 Score: 53.5286 bits (127), Expect = 5.642e-6
Identity = 33/94 (35.11%), Postives = 53/94 (56.38%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIG-----GSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLC 6301
            ++LTK+ +GLG++I G     GS+     + +  + +  A   DGR+  GD+I+ V+G +LR  T+ QA++ LR  G  V L + R   KQ  C
Sbjct:  382 VKLTKNAQGLGITIAGYVGDKGSEP--SGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEAC 473          

HSP 22 Score: 53.5286 bits (127), Expect = 5.786e-6
Identity = 49/223 (21.97%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            + M++   + G  G  ++ + +++   +  ++   +++SVA  DG+L   D++L IN   +   ++H     I++K +   E++ L I R P                  P   S +   + ++ + +S+ ++   +  +  V L     G GF I+        G+ VK +   G+A   G L  GD IL I D  +     + V + LR C   +++V+ R
Sbjct:  140 ETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAK---EQVQLVIARGP-----------------LPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIV---GGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Match: iffo2 (intermediate filament family orphan 2 [Source:Xenbase;Acc:XB-GENE-963325])

HSP 1 Score: 209.92 bits (533), Expect = 1.877e-53
Identity = 106/195 (54.36%), Postives = 142/195 (72.82%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET I+++K R GLGLSI+GG+DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLRNATHD+AI  LR    +V+L ++RD+    E+ +Y  L ++L KK  KGLG++IV K +D GV +SD+VKG IAE DGRL +GD LL +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1699 PATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPF 1893          

HSP 2 Score: 150.599 bits (379), Expect = 1.997e-35
Identity = 163/612 (26.63%), Postives = 264/612 (43.14%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR---------------ITISQDHAKNIE--------TEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSI-----------PPDRKRNSIQKVLNNQSITKKVSVNEQ---VIQEVPPTKTLT--QKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGG-SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-------------------------------PLCEDSLYFK---------LKVDLLKKSRKGLGITIVSK-----SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            G++  IE++K GK G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + II KC     KI+    R+ D + +MA  P        P   + + +E   +E  + S     N+  + ++ HV L K   G G  I + +  +  G+ +K +T  G AA +G ++ GD IL ++DE VV +  + V+  L+  K  +++ +                 +T S    KN +        +EP+P+    R S      + P    +       I+  +  + +  SI    + +  +I             D +  +  ++L    I  + + +++   V+++ P    LT  + E   K + +  V   +EL K   +GLGLSI+G  +DT    V + ++ +   A +DGRL  GD++L VNG+D+RNAT +     L+     VKL++ R K                                P   DS   K           V++ K     LGI+I         DV + I+ +    +A Q  +L+ GD ++ I        T  Q  TLLK  SG + L V
Sbjct: 1425 GELHMIELEK-GKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSII-KCAPSKVKIIFI--RNKDAVNQMAVCPVKATEPSFPNSSAFSNLE--VEEESVPSPVLPLNVGSFKNVLHVELPKDQGGLGIAISEEDTVN--GVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTISSDEKDMPQLLPLPSITLTSSTGEIKNGQQCLPLSNFSEPEPVRSSSRSSTPATFPSDPATCPIIPGCETTIDISKGRTGLGLSIVGGADTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRNATHDEAINVLRQTPQKVRLTVYRDEAQYKEEDMYDVLD-LELQKKPGKGLGLSIVGKRNDT---GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2024          

HSP 3 Score: 103.99 bits (258), Expect = 3.089e-21
Identity = 46/92 (50.00%), Postives = 67/92 (72.83%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSS 877
            W  +E VEL+ND  GLGF ++G KSTGV++++I  G VA++NG L  GDH++ I D ++ GM+SEQVA +LRQ    ++L+IAR P+ N S+
Sbjct:  256 WQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSST 347          

HSP 4 Score: 91.2781 bits (225), Expect = 2.338e-17
Identity = 67/213 (31.46%), Postives = 96/213 (45.07%), Query Frame = 2
Query: 6032 VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD-----------------------KQPLCE------DSLYFKLKVDLLKKSRKGLGITIVS------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VETV  +    GLG  I+GG  T    V++  +     A  +GRL +GD IL +   DL   + +Q  Q LR  G RVKL I R                        +  +CE      D   F +K   L K+ +GLGITI            G+ +  + KGS  EQDGR++ GD ++ ++ TN+R FT  Q   +L+    +V L + R
Sbjct:  259 VETVELVNDGSGLGFGIVGGKST---GVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIARGPVENSSTGVSTGVQITPALPSLLETQVCEGEIKDADGDAFDVK---LTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 5 Score: 89.7373 bits (221), Expect = 6.097e-17
Identity = 62/201 (30.85%), Postives = 97/201 (48.26%), Query Frame = 2
Query: 6032 VETVIELTKDRG-LGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP-------------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +ET+  L    G LG S++G      G   + + E+ E   A  DGRL   D+IL++NG+ L +  TH QAI  L+    +V+L I R   P                   L     +  ++   L     GLG  IV     GV +  ++ G +A+Q+GRL  GD +L+I DT++   + +QVA +L++C   V L++ R
Sbjct:  139 IETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAKEQVQLVIARGPLPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIVGGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          

HSP 6 Score: 87.0409 bits (214), Expect = 3.910e-16
Identity = 43/104 (41.35%), Postives = 66/104 (63.46%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVD 4696
            W++PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA K G L  GDR++ V+G DL   S++ A+  I+ A +P+VF +QS+++
Sbjct: 1178 WNNPRRVELWREPGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIIN 1276          

HSP 7 Score: 86.6557 bits (213), Expect = 5.427e-16
Identity = 62/164 (37.80%), Postives = 94/164 (57.32%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSS-------------YMYRSYSKETVE-------ELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            +AMW   I  + L K S GLGFSI  YQD    AS+   VIVI SLVP GVA  DGR++PGDRL+F+NE+ ++  +S +E ++AL+    G V +G+AKP+  S              Y  +SY++E +        EL+  ++LE +   L  ++A+ S +++
Sbjct:  719 LAMWETDIQDILLEKGSLGLGFSILDYQDPIDPAST---VIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEH-ASLEEAVQALKGAPTGNVSIGVAKPLPLSPEEGSVSAKEDTLFYTAQSYAEEGLSDAPLFHAELALVETLEVD---LTSESALESRFSA 875          

HSP 8 Score: 85.1149 bits (209), Expect = 1.633e-15
Identity = 47/113 (41.59%), Postives = 68/113 (60.18%), Query Frame = 2
Query: 2165 TIEDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            T E+ IKS W +I+G  Y+I+++ +NK +E  GLGISLE +             HH++R+I  +GP+G  G+  SGDELLE NG  L G  + +V+  LK LP  V +V  R+
Sbjct:  532 TDEEDIKSKWQRIMGVGYEIVVAKVNKFSESSGLGISLEASGG-----------HHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQ 633          

HSP 9 Score: 80.8777 bits (198), Expect = 3.046e-14
Identity = 111/448 (24.78%), Postives = 174/448 (38.84%), Query Frame = 2
Query: 5438 VQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPP-------LQMPTVISPIIN------------DERKMSAVR------PSISHDKEPIYSSIPPDRK--RNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQII-------PGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ--------------------------------------PLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDV-GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            V G G      N     GI++K +  D  A   GTL+ GDRI+ ++   + +  ++  ++ +R   N +  +V  I I++   +++   P   S   R+    +  + P P       LQ      P+              ++  M+ VR      P+      P  +S   D +  + S    L   S     SVN + +Q    T    + E     + I       PG   +IEL K + GLGLS+ G  D    +V I  +    AA  DGRL   D +L +NG+ L   +H  A   ++   ++VK+   R+K                                       PL   S    L V+ L K + GLGI I  +  V GV I  L     A +DGR+K GD +L ++D  V     ++V  LLK+    V L +
Sbjct: 1199 VGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSI-INRPRPESVYCSPS--SSALRQHPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETEKTSSSNYLTGPSTLS--SVNSEKLQMTSSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDAVNQMAVCPVKATEPSFPNSSAFSNLEVEEESVPSPVLPLNVGSFKNVLHVE-LPKDQGGLGIAISEEDTVNGVVIKSLTDHGAAAKDGRIKVGDCILAVDDEPVVGDPIEKVICLLKKAKTTVKLTI 1640          

HSP 10 Score: 73.9442 bits (180), Expect = 3.829e-12
Identity = 97/431 (22.51%), Postives = 175/431 (40.60%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC---NANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQ--------MPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP 6295
            G+G  +VG K   S    +       VA  +G+L  GD +LKI   D+ GMS   VA ++++C    +++ L I R P   V+ +    S    + P   S   +ET   E +I   +     GD F V L K+ QG G  I        ++ +GI+VK +T       +G ++ GD+I++++   +        ++ LR    ++ + + R  + Q+       EP       R+  E     S  PLQ        +P + +   +D +  S             +SS+  +++               +V  +E+ I      K+  Q+      +I+  V  V + ++  GLG+S+    +   G   +  +  +      G L++GD +L VNG  L    H   +  L+ +   V +   R  +P
Sbjct:  270 GLGFGIVGGK---STGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GKRVKLVIARGP---VENSSTGVSTGVQITPALPS--LLETQVCEGEIKDAD-----GDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEP-------RKPTE-----SGQPLQNADSSEACVPIIPTSFSSDAQSQSPAN----------WSSLQAEKE--------------TQVDTDEEDI------KSKWQRIMGVGYEIV--VAKVNKFSESSGLGISL----EASGGHHFLRSILPEGPVGRSGSLYSGDELLEVNGISLLGQNHIDVVNILKELPICVTVVCCRQVKP 636          

HSP 11 Score: 72.7886 bits (177), Expect = 8.158e-12
Identity = 56/212 (26.42%), Postives = 96/212 (45.28%), Query Frame = 2
Query: 6023 IPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---------DKQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            I G+ TV I+      LG+SI GG  + LG V   I  +H    AA   +L  GDRI+++ G+     TH QA+  L++    ++L++            +Q     ++ F                + K  +L++   GLG +IV        D+ + +  +     A +DGRL +GD ++ +N  ++   T ++  ++LKR  G V L V
Sbjct: 1937 IQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQVVAGGDVSVVTGQQQEHLGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKGTVTLTV 2148          

HSP 12 Score: 63.929 bits (154), Expect = 3.867e-9
Identity = 36/87 (41.38%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +   LTK  QGLG+TIAGY+  +      GIFVKSI+K S  + +G+I + DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  380 FDVKLTKNAQGLGITIAGYVGDKGS-EPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVR 465          

HSP 13 Score: 63.929 bits (154), Expect = 4.242e-9
Identity = 102/421 (24.23%), Postives = 168/421 (39.90%), Query Frame = 2
Query: 4409 VEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDAT-KLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTT---PPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            ++++  + LG+SI+G +            DT    G+F++ I     AE  G+L  GD+LL VNG D            ++NAT   V         +++K S  T KL   ++     H +   S +S+       LT+   P   P  A S                           D SEI+ +R               +EI K     +G+ + G        +  +I     N VAA   +L +GD ++ I      GM+HS    ++K     S  I L +              A  + SV   ++ E+ + ++   + ++S++ LQ   G      + LE+   G GF I+  + +      IYVK V   G A+ +G L  GD+I+ +N    E V +E+  S+LKR +G
Sbjct: 1810 LQKKPGKGLGLSIVGKR-----------NDT----GVFVSDIVKGGIAEIDGRLMQGDQLLMVNGED------------VRNATQEAV--------AALLKCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKS----------------------DTSEIQGLRT--------------VEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNA---SGTIELQVV-------------AGGDVSVVTGQQQEH-LGSTVSFSGLASSSILQDDLGPPQYKTIILERGPDGLGFSIVGGHGSPHGDLPIYVKTVFSKGAASEDGRLNRGDQIIAVNGQSLEGVTHEEAVSILKRTKG 2142          

HSP 14 Score: 61.6178 bits (148), Expect = 1.878e-8
Identity = 40/146 (27.40%), Postives = 68/146 (46.58%), Query Frame = 2
Query:  590 MLNTEWAELEI---------VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-----------------------PIPNCSSPEYCGSMSIIPT 913
            +L T+  E EI         V+L  +  GLG ++ G      S+ +G+ ++SI  GS  E++G +++GD ++ +D  N+RG T++Q   +LR +   + L + R                       P+ N  S E C  + IIPT
Sbjct:  362 LLETQVCEGEIKDADGDAFDVKLTKNAQGLGITIAGYVGDKGSEPSGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEACIPQVEEPRKPTESGQPLQNADSSEAC--VPIIPT 505          

HSP 15 Score: 59.3066 bits (142), Expect = 1.025e-7
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRV 6265
            +EL ++ G  LG+SI+GG        +  ++  + I  + E   A  +G L  GDRI+ V+G DLR+A+H+QA++ +R  GN V
Sbjct: 1184 VELWREPGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPV 1267          

HSP 16 Score: 58.151 bits (139), Expect = 2.541e-7
Identity = 85/348 (24.43%), Postives = 143/348 (41.09%), Query Frame = 2
Query: 1556 IHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSG----IVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSN-----SSINNSMKTTNETLTLQPMIYTILSNDESPVN-----NCPENIDVSVVP-----PSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLIANILPN--SGFNVQKMNLKYASIDKTIEDTIKSTWNKIIG--GNY--DILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            + GIF+K I ++S A  NG +   D+I+E++   +    +   VE ++        +V+   NR     VY   + +A                  H  +N     S    ++     T   +P+       D S +N       P  I     P     P+   A+SSS+ E E                T+ ++ L     P+  S  N +K+ +  +S D   ED    +W KI    GN   ++ +  + K   GLG+SL G  D   ++        +I  I  +G  G DG  +  DELLE NG+ L+G  +Q   + +K  P++V+I+  R K+  V+Q++
Sbjct: 1214 MRGIFIKHILEDSPAGKNGTLKTGDRIVEVDGTDLRDASHEQAVEAIRKAGNPVVFLVQSIINRPRPESVYCSPSSSALRQ---------------HPTTNPFSHPSPKKPALPLLQSTFGTKPLFRCTNPFDSSQLNINKGTMNPVRIAFRCSPTNPFAPTPFKASSSSDSETE---------------KTSSSNYLTG---PSTLSSVNSEKLQMT-SSTDPEKEDEFGYSWKKISQRYGNLPGELHMIELEKGKTGLGLSLAGNKDRSRMS-------VFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIKCAPSKVKIIFIRNKDA-VNQMA 1519          

HSP 17 Score: 56.225 bits (134), Expect = 1.017e-6
Identity = 55/255 (21.57%), Postives = 113/255 (44.31%), Query Frame = 2
Query: 4931 TPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLT-IKRHPDNLVKMACIPASVNTSVA---------PCEKSENAVETSTDENQISSNNNLQ---GYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVV 5656
            TP    +   R+  +   ++   V+++E+ K+  KG+GL +VG ++ + +  ++       +A +DG+LM GD+LL +N  DV   +   VA ++ KC + + K+ +  IK  P +  +     + V+   +         P   + ++    +D ++I     ++   G  D   + +     G G  + D        I++  +  +G+AA    LR GDRI+ I  +      +   +  L+     +E+ V
Sbjct: 1782 TPQKVRLTVYRDEAQYKEEDMYDVLDLELQKKPGKGLGLSIVGKRNDTGV--FVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALL-KCSLGTVKLEVGRIKTGPFHSERRTSQSSQVSEGTSSLTSFSFPMPGPAAADSGSKKSDTSEIQGLRTVEIKKGPTDSLGISI---AGGVGSPLGDVP------IFIAMMHANGVAAQTHKLRVGDRIVSICGQPTEGMTHSQAVTLLKNASGTIELQV 2024          

HSP 18 Score: 55.4546 bits (132), Expect = 1.614e-6
Identity = 38/108 (35.19%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  605 WAELEIVELLNDR--CGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPEYCGSMS 901
            W E +I ++L ++   GLGFS++  +      ST +VIRS+  G VAE++G L  GD LM++++IN+   + E+    L+ + + ++ + +A+P+P   SPE  GS+S
Sbjct:  722 W-ETDIQDILLEKGSLGLGFSILDYQDPIDPASTVIVIRSLVPGGVAEQDGRLLPGDRLMFVNEINLEHASLEEAVQALKGAPTGNVSIGVAKPLP--LSPEE-GSVS 825          

HSP 19 Score: 55.0694 bits (131), Expect = 2.203e-6
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 2
Query: 1493 KGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            K  +GLGL+I G      + N  G+FV  I K  +A+++G+++  DQ++ +N + V      AV  +LK + G VKL+  R   GP +
Sbjct: 1813 KPGKGLGLSIVG------KRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGRIKTGPFH 1894          

HSP 20 Score: 54.6842 bits (130), Expect = 2.907e-6
Identity = 28/71 (39.44%), Postives = 44/71 (61.97%), Query Frame = 2
Query:  647 GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            GLG S++G ++ TGV +  I  G +AE +G L  GD L+ ++  +VR  T E VAA+L+ S   ++L + R
Sbjct: 1817 GLGLSIVGKRNDTGVFVSDIVKGGIAEIDGRLMQGDQLLMVNGEDVRNATQEAVAALLKCSLGTVKLEVGR 1887          

HSP 21 Score: 53.5286 bits (127), Expect = 5.460e-6
Identity = 33/94 (35.11%), Postives = 53/94 (56.38%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIG-----GSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLC 6301
            ++LTK+ +GLG++I G     GS+     + +  + +  A   DGR+  GD+I+ V+G +LR  T+ QA++ LR  G  V L + R   KQ  C
Sbjct:  382 VKLTKNAQGLGITIAGYVGDKGSEP--SGIFVKSITKGSAVEQDGRIQVGDQIIVVDGTNLRGFTNQQAVEVLRHTGQSVHLTLVRRGLKQEAC 473          

HSP 22 Score: 53.5286 bits (127), Expect = 5.506e-6
Identity = 49/223 (21.97%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            + M++   + G  G  ++ + +++   +  ++   +++SVA  DG+L   D++L IN   +   ++H     I++K +   E++ L I R P                  P   S +   + ++ + +S+ ++   +  +  V L     G GF I+        G+ VK +   G+A   G L  GD IL I D  +     + V + LR C   +++V+ R
Sbjct:  140 ETMDLLKPQSGSLGFSVVGLKSENRGELGIFVQEIQEDSVAHRDGRLKEADQILSINGQPLDQTITHHQAIGILQKAK---EQVQLVIARGP-----------------LPQLISPSISRSPSEASTVSALSSPMHWQHVETVELVNDGSGLGFGIV---GGKSTGVIVKTILPGGVADQNGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGKRVKLVIAR 339          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 347.821 bits (891), Expect = 7.835e-96
Identity = 246/746 (32.98%), Postives = 370/746 (49.60%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPD----------KATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSI-SHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            WS PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++                 S  ES  ++P   N            PP+SP           + ++  ++++E  E E  +                  + +N  +     +G++  IE++K G+ G+GL L GNKD + M+ +I G      A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P     S +    S    E        +S  +L    D++ + L K   G G  I  C  +   G+ ++ +T  G AA +G L+ GD IL ++DE+V     +  +  L+  K  +++ V         A+N      P S                        +  ++ ERK ++  P++ + D EPI     P   R+S   V  +                            P    IIPG ET IE++K + GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +     ++L K+  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR  TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1134 WSQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRAP------------SQSESETEKPALCN-----------VPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGY------------------SWKNIQERYGSLTGQLHVIELEK-GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAI--CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTV--------RAENPACPAVPSS------------------------AVTVSGERKDNSQTPAVPAPDLEPI-----PSTSRSSTPAVFASD---------------------------PATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPF 1763          

HSP 2 Score: 98.5969 bits (244), Expect = 9.557e-20
Identity = 44/99 (44.44%), Postives = 68/99 (68.69%), Query Frame = 2
Query:  560 SETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            + T   HS  M    W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR
Sbjct:  241 ASTISAHSNPM---HWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 3 Score: 91.6633 bits (226), Expect = 1.257e-17
Identity = 55/137 (40.15%), Postives = 78/137 (56.93%), Query Frame = 2
Query: 2099 NILP--NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            +ILP    GF +    L+ A  D   E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  502 SILPIEEEGFPLLSAELEEAE-DVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRR 626          

HSP 4 Score: 90.8929 bits (224), Expect = 2.382e-17
Identity = 49/99 (49.49%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 2894 VAMW-SGPILVELTKESQGLGFSIEYYQDA--SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW +G   +EL K S+GLGFSI  YQD    +N  VIVI SLVP G+A  DGR+ PGDRL+F+N++ ++  S+ +E +EAL+    G V +G+AKP+
Sbjct:  684 LAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANT-VIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLEN-STLEEAVEALKGAPSGMVRIGVAKPL 780          

HSP 5 Score: 90.1225 bits (222), Expect = 3.980e-17
Identity = 59/189 (31.22%), Postives = 94/189 (49.74%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLC------------------EDSLYFK-LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P                     + ++++ ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 6 Score: 82.8037 bits (203), Expect = 5.834e-15
Identity = 69/211 (32.70%), Postives = 95/211 (45.02%), Query Frame = 2
Query: 6032 VETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYFKL----------KVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     SL   L          +VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  256 VET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 7 Score: 74.7146 bits (182), Expect = 1.489e-12
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LGLSI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  +++    +++++            +Q L    L F                + K   L +   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1806 ASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2020          

HSP 8 Score: 69.707 bits (169), Expect = 5.218e-11
Identity = 39/92 (42.39%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1460 NEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V+L   R
Sbjct:  372 DESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 9 Score: 62.7734 bits (151), Expect = 6.900e-9
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTEWAELEI----VELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            L+ + VD + + + T  A  E     +EL     GLGFS++  +      +T +VIRS+  G +AE++G L  GD LM+++DIN+   T E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  668 LAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP--LSPE 785          

HSP 10 Score: 59.3066 bits (142), Expect = 9.114e-8
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVA----PCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQ--------DHAKNIETEPQPISKD 5725
            V  IE+   G  G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R       +   PAS +  +         SE  V+ ST +N  S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++   +        ++ LR     + + + R   SQ        D AK+++   +   KD
Sbjct:  256 VETIELVNDGS-GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARG-----AVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKD 491          

HSP 11 Score: 55.8398 bits (133), Expect = 8.107e-7
Identity = 32/104 (30.77%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     + +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   +RL + R
Sbjct:  361 EMRVDASTQ--KNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 12 Score: 55.8398 bits (133), Expect = 9.511e-7
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  614 LEIVELLNDRCG-LGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYID-DINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +EI ELL   CG LGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+  +  + +T +Q  +IL+++ D ++L+IAR
Sbjct:  136 VEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIAR 223          

HSP 13 Score: 54.6842 bits (130), Expect = 2.131e-6
Identity = 54/223 (24.22%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 5036 GMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLG--MSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKN 5692
            G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN   VL   ++H     I++K +   + + L I R                 S+ P      +   S   + IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  + +  A +
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAING-QVLDQTITHQQAISILQKAK---DTVQLVIAR----------------GSLPPVSSPRISRSPSA-ASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASS 346          

HSP 14 Score: 54.299 bits (129), Expect = 2.459e-6
Identity = 54/197 (27.41%), Postives = 90/197 (45.69%), Query Frame = 2
Query: 5129 GQLMIGDELLKINSIDVLGMSHSNVAPIIKK---------C----------QMESEKI---MLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNAL 5644
            G+L  GDELL++N I++LG +H +V  I+K+         C          +M+S  I    LT K H D L +      + +  +A  +  +NA E  T      +            + LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + +
Sbjct:  584 GKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHID-LGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQ--------SIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGM 771          

HSP 15 Score: 52.7582 bits (125), Expect = 8.603e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 1427 RTKHRIRIN---------EQNEFHEYTTYLTKGE-QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +T  R+R+          E++    +T  L K   +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R    P +
Sbjct: 1651 QTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1764          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 347.821 bits (891), Expect = 8.221e-96
Identity = 249/758 (32.85%), Postives = 376/758 (49.60%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLS-----------LNSKSDMLKKKLT-TPPNSPD----------KATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSI-SHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            WS PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++    + S    L +     Y      P +             S+S+  K  L   PP+SP           + ++  ++++E  E E  +                  + +N  +     +G++  IE++K G+ G+GL L GNKD + M+ +I G      A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P     S +    S    E        +S  +L    D++ + L K   G G  I  C  +   G+ ++ +T  G AA +G L+ GD IL ++DE+V     +  +  L+  K  +++ V         A+N      P S                        +  ++ ERK ++  P++ + D EPI     P   R+S   V  +                            P    IIPG ET IE++K + GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +     ++L K+  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR  TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1148 WSQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIIN--RPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGY------------------SWKNIQERYGSLTGQLHVIELEK-GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAI--CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTV--------RAENPACPAVPSS------------------------AVTVSGERKDNSQTPAVPAPDLEPI-----PSTSRSSTPAVFASD---------------------------PATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPF 1810          

HSP 2 Score: 98.5969 bits (244), Expect = 9.616e-20
Identity = 44/99 (44.44%), Postives = 68/99 (68.69%), Query Frame = 2
Query:  560 SETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            + T   HS  M    W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR
Sbjct:  241 ASTISAHSNPM---HWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 3 Score: 91.6633 bits (226), Expect = 1.330e-17
Identity = 55/137 (40.15%), Postives = 78/137 (56.93%), Query Frame = 2
Query: 2099 NILP--NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            +ILP    GF +    L+ A  D   E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  502 SILPIEEEGFPLLSAELEEAE-DVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRR 626          

HSP 4 Score: 90.5077 bits (223), Expect = 2.541e-17
Identity = 49/99 (49.49%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 2894 VAMW-SGPILVELTKESQGLGFSIEYYQDA--SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW +G   +EL K S+GLGFSI  YQD    +N  VIVI SLVP G+A  DGR+ PGDRL+F+N++ ++  S+ +E +EAL+    G V +G+AKP+
Sbjct:  684 LAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANT-VIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLEN-STLEEAVEALKGAPSGMVRIGVAKPL 780          

HSP 5 Score: 90.1225 bits (222), Expect = 3.617e-17
Identity = 59/189 (31.22%), Postives = 94/189 (49.74%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLC------------------EDSLYFK-LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P                     + ++++ ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 6 Score: 82.8037 bits (203), Expect = 5.716e-15
Identity = 69/211 (32.70%), Postives = 95/211 (45.02%), Query Frame = 2
Query: 6032 VETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYFKL----------KVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     SL   L          +VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  256 VET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 7 Score: 75.0998 bits (183), Expect = 1.285e-12
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LGLSI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  +++    +++++            +Q L    L F                + K   L +   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1853 ASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2067          

HSP 8 Score: 69.707 bits (169), Expect = 5.194e-11
Identity = 39/92 (42.39%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1460 NEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V+L   R
Sbjct:  372 DESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 9 Score: 62.7734 bits (151), Expect = 7.100e-9
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTEWAELEI----VELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            L+ + VD + + + T  A  E     +EL     GLGFS++  +      +T +VIRS+  G +AE++G L  GD LM+++DIN+   T E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  668 LAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP--LSPE 785          

HSP 10 Score: 59.3066 bits (142), Expect = 8.839e-8
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVA----PCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQ--------DHAKNIETEPQPISKD 5725
            V  IE+   G  G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R       +   PAS +  +         SE  V+ ST +N  S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++   +        ++ LR     + + + R   SQ        D AK+++   +   KD
Sbjct:  256 VETIELVNDGS-GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARG-----AVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKD 491          

HSP 11 Score: 56.225 bits (134), Expect = 7.730e-7
Identity = 32/104 (30.77%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     + +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   +RL + R
Sbjct:  361 EMRVDASTQ--KNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 12 Score: 55.8398 bits (133), Expect = 8.918e-7
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  614 LEIVELLNDRCG-LGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYID-DINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +EI ELL   CG LGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+  +  + +T +Q  +IL+++ D ++L+IAR
Sbjct:  136 VEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIAR 223          

HSP 13 Score: 54.6842 bits (130), Expect = 1.807e-6
Identity = 56/232 (24.14%), Postives = 101/232 (43.53%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLG--MSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKN 5692
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN   VL   ++H     I++K +   + + L I R                 S+ P      +   S   + IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  + +  A +
Sbjct:  139 FELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAING-QVLDQTITHQQAISILQKAK---DTVQLVIAR----------------GSLPPVSSPRISRSPSA-ASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASS 346          

HSP 14 Score: 54.6842 bits (130), Expect = 2.248e-6
Identity = 54/197 (27.41%), Postives = 90/197 (45.69%), Query Frame = 2
Query: 5129 GQLMIGDELLKINSIDVLGMSHSNVAPIIKK---------C----------QMESEKI---MLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNAL 5644
            G+L  GDELL++N I++LG +H +V  I+K+         C          +M+S  I    LT K H D L +      + +  +A  +  +NA E  T      +            + LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + +
Sbjct:  584 GKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHID-LGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQ--------SIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGM 771          

HSP 15 Score: 52.7582 bits (125), Expect = 8.411e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 1427 RTKHRIRIN---------EQNEFHEYTTYLTKGE-QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +T  R+R+          E++    +T  L K   +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R    P +
Sbjct: 1698 QTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1811          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 347.821 bits (891), Expect = 8.395e-96
Identity = 249/758 (32.85%), Postives = 376/758 (49.60%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLS-----------LNSKSDMLKKKLT-TPPNSPD----------KATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSI-SHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            WS PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++    + S    L +     Y      P +             S+S+  K  L   PP+SP           + ++  ++++E  E E  +                  + +N  +     +G++  IE++K G+ G+GL L GNKD + M+ +I G      A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P     S +    S    E        +S  +L    D++ + L K   G G  I  C  +   G+ ++ +T  G AA +G L+ GD IL ++DE+V     +  +  L+  K  +++ V         A+N      P S                        +  ++ ERK ++  P++ + D EPI     P   R+S   V  +                            P    IIPG ET IE++K + GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +     ++L K+  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR  TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1135 WSQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIIN--RPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGY------------------SWKNIQERYGSLTGQLHVIELEK-GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAI--CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTV--------RAENPACPAVPSS------------------------AVTVSGERKDNSQTPAVPAPDLEPI-----PSTSRSSTPAVFASD---------------------------PATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPF 1797          

HSP 2 Score: 98.5969 bits (244), Expect = 9.763e-20
Identity = 44/99 (44.44%), Postives = 68/99 (68.69%), Query Frame = 2
Query:  560 SETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            + T   HS  M    W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR
Sbjct:  241 ASTISAHSNPM---HWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 3 Score: 91.2781 bits (225), Expect = 1.408e-17
Identity = 55/137 (40.15%), Postives = 78/137 (56.93%), Query Frame = 2
Query: 2099 NILP--NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            +ILP    GF +    L+ A  D   E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  502 SILPIEEEGFPLLSAELEEAE-DVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRR 626          

HSP 4 Score: 90.5077 bits (223), Expect = 2.537e-17
Identity = 49/99 (49.49%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 2894 VAMW-SGPILVELTKESQGLGFSIEYYQDA--SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW +G   +EL K S+GLGFSI  YQD    +N  VIVI SLVP G+A  DGR+ PGDRL+F+N++ ++  S+ +E +EAL+    G V +G+AKP+
Sbjct:  684 LAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANT-VIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLEN-STLEEAVEALKGAPSGMVRIGVAKPL 780          

HSP 5 Score: 90.1225 bits (222), Expect = 4.029e-17
Identity = 59/189 (31.22%), Postives = 94/189 (49.74%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLC------------------EDSLYFK-LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P                     + ++++ ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 6 Score: 82.8037 bits (203), Expect = 6.158e-15
Identity = 69/211 (32.70%), Postives = 95/211 (45.02%), Query Frame = 2
Query: 6032 VETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYFKL----------KVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     SL   L          +VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  256 VET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 7 Score: 75.0998 bits (183), Expect = 1.384e-12
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LGLSI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  +++    +++++            +Q L    L F                + K   L +   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1840 ASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2054          

HSP 8 Score: 69.707 bits (169), Expect = 5.366e-11
Identity = 39/92 (42.39%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1460 NEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V+L   R
Sbjct:  372 DESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 9 Score: 62.7734 bits (151), Expect = 7.214e-9
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTEWAELEI----VELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            L+ + VD + + + T  A  E     +EL     GLGFS++  +      +T +VIRS+  G +AE++G L  GD LM+++DIN+   T E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  668 LAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP--LSPE 785          

HSP 10 Score: 59.3066 bits (142), Expect = 8.832e-8
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVA----PCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQ--------DHAKNIETEPQPISKD 5725
            V  IE+   G  G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R       +   PAS +  +         SE  V+ ST +N  S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++   +        ++ LR     + + + R   SQ        D AK+++   +   KD
Sbjct:  256 VETIELVNDGS-GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARG-----AVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKD 491          

HSP 11 Score: 55.8398 bits (133), Expect = 7.989e-7
Identity = 32/104 (30.77%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     + +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   +RL + R
Sbjct:  361 EMRVDASTQ--KNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 12 Score: 55.8398 bits (133), Expect = 9.531e-7
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  614 LEIVELLNDRCG-LGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYID-DINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +EI ELL   CG LGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+  +  + +T +Q  +IL+++ D ++L+IAR
Sbjct:  136 VEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIAR 223          

HSP 13 Score: 54.6842 bits (130), Expect = 1.931e-6
Identity = 56/232 (24.14%), Postives = 101/232 (43.53%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLG--MSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKN 5692
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN   VL   ++H     I++K +   + + L I R                 S+ P      +   S   + IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  + +  A +
Sbjct:  139 FELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAING-QVLDQTITHQQAISILQKAK---DTVQLVIAR----------------GSLPPVSSPRISRSPSA-ASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASS 346          

HSP 14 Score: 54.299 bits (129), Expect = 2.382e-6
Identity = 54/197 (27.41%), Postives = 90/197 (45.69%), Query Frame = 2
Query: 5129 GQLMIGDELLKINSIDVLGMSHSNVAPIIKK---------C----------QMESEKI---MLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNAL 5644
            G+L  GDELL++N I++LG +H +V  I+K+         C          +M+S  I    LT K H D L +      + +  +A  +  +NA E  T      +            + LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + +
Sbjct:  584 GKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHID-LGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQ--------SIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGM 771          

HSP 15 Score: 52.7582 bits (125), Expect = 8.619e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 1427 RTKHRIRIN---------EQNEFHEYTTYLTKGE-QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +T  R+R+          E++    +T  L K   +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R    P +
Sbjct: 1685 QTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1798          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Mpdz (multiple PDZ domain protein [Source:MGI Symbol;Acc:MGI:1343489])

HSP 1 Score: 347.821 bits (891), Expect = 8.525e-96
Identity = 249/758 (32.85%), Postives = 376/758 (49.60%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLS-----------LNSKSDMLKKKLT-TPPNSPD----------KATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSI-SHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            WS PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++    + S    L +     Y      P +             S+S+  K  L   PP+SP           + ++  ++++E  E E  +                  + +N  +     +G++  IE++K G+ G+GL L GNKD + M+ +I G      A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P     S +    S    E        +S  +L    D++ + L K   G G  I  C  +   G+ ++ +T  G AA +G L+ GD IL ++DE+V     +  +  L+  K  +++ V         A+N      P S                        +  ++ ERK ++  P++ + D EPI     P   R+S   V  +                            P    IIPG ET IE++K + GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +     ++L K+  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR  TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1134 WSQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIIN--RPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGY------------------SWKNIQERYGSLTGQLHVIELEK-GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAI--CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTV--------RAENPACPAVPSS------------------------AVTVSGERKDNSQTPAVPAPDLEPI-----PSTSRSSTPAVFASD---------------------------PATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPF 1796          

HSP 2 Score: 98.5969 bits (244), Expect = 9.761e-20
Identity = 44/99 (44.44%), Postives = 68/99 (68.69%), Query Frame = 2
Query:  560 SETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            + T   HS  M    W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR
Sbjct:  241 ASTISAHSNPM---HWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 3 Score: 91.2781 bits (225), Expect = 1.420e-17
Identity = 55/137 (40.15%), Postives = 78/137 (56.93%), Query Frame = 2
Query: 2099 NILP--NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            +ILP    GF +    L+ A  D   E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  502 SILPIEEEGFPLLSAELEEAE-DVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRR 626          

HSP 4 Score: 90.5077 bits (223), Expect = 2.537e-17
Identity = 49/99 (49.49%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 2894 VAMW-SGPILVELTKESQGLGFSIEYYQDA--SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW +G   +EL K S+GLGFSI  YQD    +N  VIVI SLVP G+A  DGR+ PGDRL+F+N++ ++  S+ +E +EAL+    G V +G+AKP+
Sbjct:  684 LAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANT-VIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLEN-STLEEAVEALKGAPSGMVRIGVAKPL 780          

HSP 5 Score: 90.1225 bits (222), Expect = 4.029e-17
Identity = 59/189 (31.22%), Postives = 94/189 (49.74%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLC------------------EDSLYFK-LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P                     + ++++ ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 6 Score: 82.8037 bits (203), Expect = 6.209e-15
Identity = 69/211 (32.70%), Postives = 95/211 (45.02%), Query Frame = 2
Query: 6032 VETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYFKL----------KVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     SL   L          +VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  256 VET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 7 Score: 75.0998 bits (183), Expect = 1.384e-12
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LGLSI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  +++    +++++            +Q L    L F                + K   L +   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1839 ASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          

HSP 8 Score: 69.707 bits (169), Expect = 5.365e-11
Identity = 39/92 (42.39%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1460 NEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V+L   R
Sbjct:  372 DESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 9 Score: 62.7734 bits (151), Expect = 7.214e-9
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTEWAELEI----VELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            L+ + VD + + + T  A  E     +EL     GLGFS++  +      +T +VIRS+  G +AE++G L  GD LM+++DIN+   T E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  668 LAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP--LSPE 785          

HSP 10 Score: 59.3066 bits (142), Expect = 8.906e-8
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVA----PCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQ--------DHAKNIETEPQPISKD 5725
            V  IE+   G  G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R       +   PAS +  +         SE  V+ ST +N  S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++   +        ++ LR     + + + R   SQ        D AK+++   +   KD
Sbjct:  256 VETIELVNDGS-GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARG-----AVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKD 491          

HSP 11 Score: 55.8398 bits (133), Expect = 7.988e-7
Identity = 32/104 (30.77%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     + +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   +RL + R
Sbjct:  361 EMRVDASTQ--KNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 12 Score: 55.8398 bits (133), Expect = 9.530e-7
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  614 LEIVELLNDRCG-LGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYID-DINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +EI ELL   CG LGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+  +  + +T +Q  +IL+++ D ++L+IAR
Sbjct:  136 VEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIAR 223          

HSP 13 Score: 54.6842 bits (130), Expect = 1.931e-6
Identity = 56/232 (24.14%), Postives = 101/232 (43.53%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLG--MSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKN 5692
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN   VL   ++H     I++K +   + + L I R                 S+ P      +   S   + IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  + +  A +
Sbjct:  139 FELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAING-QVLDQTITHQQAISILQKAK---DTVQLVIAR----------------GSLPPVSSPRISRSPSA-ASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASS 346          

HSP 14 Score: 54.299 bits (129), Expect = 2.423e-6
Identity = 54/197 (27.41%), Postives = 90/197 (45.69%), Query Frame = 2
Query: 5129 GQLMIGDELLKINSIDVLGMSHSNVAPIIKK---------C----------QMESEKI---MLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNAL 5644
            G+L  GDELL++N I++LG +H +V  I+K+         C          +M+S  I    LT K H D L +      + +  +A  +  +NA E  T      +            + LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + +
Sbjct:  584 GKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPIALSEMDSLDINDLELTEKPHID-LGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGGQ--------SIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGM 771          

HSP 15 Score: 52.7582 bits (125), Expect = 8.619e-6
Identity = 36/120 (30.00%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 1427 RTKHRIRIN---------EQNEFHEYTTYLTKGE-QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +T  R+R+          E++    +T  L K   +GLGL+I G      + N  G+FV  I K  +AD +G+++  DQI+ +N + V      AV  +LK + G V L+  R    P +
Sbjct: 1684 QTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVG------KRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPFH 1797          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Match: Patj (PATJ, crumbs cell polarity complex component [Source:MGI Symbol;Acc:MGI:1277960])

HSP 1 Score: 183.726 bits (465), Expect = 5.796e-48
Identity = 96/195 (49.23%), Postives = 135/195 (69.23%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    I+PG E +IE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR+++H++AI  LR    +V+L ++RD+    ++       VDL KK+ +GLG++IV K S  GV ISD+VKG  A+ DGRL +GD +L +N  ++R  +Q+ VAT+LK   G V L +GRLR+  +
Sbjct:  238 PATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYRDEAQYRDEENLEVFLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDMRHASQETVATILKCVQGLVQLEIGRLRAGSW 432          

HSP 2 Score: 91.2781 bits (225), Expect = 6.804e-18
Identity = 108/433 (24.94%), Postives = 176/433 (40.65%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSV-QGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR 6283
            G+ M IEI K G+ G+GL +VG KD       I    +   AA DG+L  GD++L++N +D+   SH      I   +   +K+ L + R                                 DE Q     NL+    +F V L+K   +G G  I+   +   +G+++  +   G A  +G L  GD+IL +N E + +   ++V   L+  +  +++ +GR+      A             R+ S                      +     S+ RPS +    P+ +S             L N   TK+ S         PP K  T++E  T       VE + EL+    LG+SI GG  + LG   + I  +     AA   +L  GDRI+++NG+ L   +H  A+  L++   R+ L++FR
Sbjct:  246 GQEMIIEISK-GRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEA---ITALRQTPQKVRLVVYR---------------------------------DEAQYRDEENLE----VFLVDLQKKTGRGLGLSIVGKRSG--SGVFISDIVKGGAADLDGRLIRGDQILSVNGEDMRHASQETVATILKCVQGLVQLEIGRLRAGSWAAS------------RKTSQNSQG-----------------DQHSAHSSCRPSFA----PVITS-------------LQNLVGTKRSS--------DPPQKC-TEEEPRT-------VEIIRELSD--ALGISIAGGKGSPLGDIPIFIAMIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQVFR 571          

HSP 3 Score: 73.559 bits (179), Expect = 2.220e-12
Identity = 45/118 (38.14%), Postives = 67/118 (56.78%), Query Frame = 2
Query: 4982 TDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIP-ASVNTSVAPCE 5332
             D  G++  IE++K  K G+GL L GNKD S M+ ++ G      AA DG++ IGDELL+IN+  + G SH N + IIK       ++ L   R+ D + +MA  P   ++ S +P E
Sbjct:   15 ADLPGELHIIELEKD-KNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPT---RVKLVFIRNEDAVSQMAVAPFPELSHSPSPVE 128          

HSP 4 Score: 57.7658 bits (138), Expect = 1.695e-7
Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            I+E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R  + E+    LRQ+   +RL++ R
Sbjct:  250 IIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVVYR 331          

HSP 5 Score: 57.3806 bits (137), Expect = 2.081e-7
Identity = 53/213 (24.88%), Postives = 93/213 (43.66%), Query Frame = 2
Query: 4046 GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFIN-LTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTI 4681
            GD I  +NG+ +     +T++ +L   +    +++IG + A  +  S                     +  S ++  +Q +  +  R SF   +T LQ     + S           PR V + RE + +LGISI GGK + + +             IFI  I  +  A +  +L +GDR++S+NG  L   S+ DA++ +KNA   I+  +
Sbjct:  390 GDQILSVNGEDMRHASQETVATILKCVQGL-VQLEIGRLRAGSWAAS---------------------RKTSQNSQGDQHSAHSSCRPSFAPVITSLQNLVGTKRSSDPPQKCTEEEPRTVEIIRELSDALGISIAGGKGSPLGDIP-----------IFIAMIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQV 569          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|O55164|MPDZ_RAT (Multiple PDZ domain protein OS=Rattus norvegicus OX=10116 GN=Mpdz PE=1 SV=1)

HSP 1 Score: 358.607 bits (919), Expect = 2.349e-98
Identity = 262/758 (34.56%), Postives = 383/758 (50.53%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAI----------------RNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASV-----NTSVAPCEKS-ENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSI-SHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            WS PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A SP+VF +QS+  V+  + S    L          H   P    S ++   + L     + DKA S   +++E     +  S S      ++ D ++  A                 +N  +     +G++  IE++K G  G+GL L GNKD + M+ +I G      A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P S      +TS +P  K  E ++ TS     +SS  N      ++H+ L K   G G  I  C  +   G+ +K +T  G AA +G L+ GDRIL ++DELV     +  +  L+  K  +++ VG        A+N                        P  Q     +   + ERK S+  P++ + D EPI     P   R+S   +  +                            P    IIPG ET IE++K + GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +     V+L K+  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1133 WSQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGSPVVFMVQSI--VNRPRKSPLPSLP---------HSLYPKCSFSSTNPFAESLQL---TSDKAPSQSESESEKATLCSVPSSSPSVFSEMSSDYAQPSATTVAEDEDKEDEFGYSWKNIQERYGTLTGQLHMIELEK-GHSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNADAVNQMAVCPGSAADPLPSTSESPQNKEVEPSITTSASAVDLSSLTN------VYHLELPKDQGGLGIAI--CEEDTLNGVTIKSLTERGGAAKDGRLKPGDRILAVDDELVAGCPIEKFISLLKTAKTTVKLTVG--------AEN------------------------PGCQAVPSAAVTASGERKDSSQTPAVPAPDLEPI-----PSTSRSSTPAIFASD---------------------------PATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTVELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAAPF 1795          

HSP 2 Score: 99.3673 bits (246), Expect = 3.789e-19
Identity = 41/86 (47.67%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  599 TEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            T W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR
Sbjct:  251 THWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 3 Score: 90.8929 bits (224), Expect = 1.333e-16
Identity = 49/99 (49.49%), Postives = 68/99 (68.69%), Query Frame = 2
Query: 2894 VAMWSGPI-LVELTKESQGLGFSIEYYQDA--SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW   I  +EL K S+GLGFSI  YQD    +N  VIVI SLVP G+A  DGR+ PGDRL+F+N++ ++  S+ +E +EAL+    G V +G+AKP+
Sbjct:  683 LAMWEAGIQAIELEKGSRGLGFSILDYQDPIDPANT-VIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLEN-STLEEAVEALKGAPSGMVRIGVAKPL 779          

HSP 4 Score: 88.5817 bits (218), Expect = 6.815e-16
Identity = 47/111 (42.34%), Postives = 67/111 (60.36%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  526 EAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRR 625          

HSP 5 Score: 88.5817 bits (218), Expect = 8.063e-16
Identity = 58/189 (30.69%), Postives = 91/189 (48.15%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP-------------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + ++L I R   P                       + +  ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTIQLVIARGSLPHISSPRISRSPSAASTVSAHSNPTHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 6 Score: 87.8113 bits (216), Expect = 1.291e-15
Identity = 142/593 (23.95%), Postives = 235/593 (39.63%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKS-ENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR--------ITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP---LCE-DSLYF-------KLKVDL-----------------------------------------LKKSRKGLGITIVSKSD------VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRC-SGNVFLMVGR 6565
            V  IE+   G  G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R     V+    P+S+  +++    + E  V+ ST +N+ S         + F V L K+VQG G  I     +   + +GI+VK +T       +G ++ GD+I+ ++   +        ++ LR     + + + R        IT  +D AK+++   +   KD  ES+          L+  T I P              I  +  P+ S+                     ++   E V QE     T  Q+      +I+  V  V + +++ GLG+S+    +  +G   I  V  +      G+L++GD +L VNG +L    H   +  L+ +   V +   R   P   L E DSL         K  +DL                                         L+K  +GLG +I+   D        + I  LV G IAE+DGRL  GD L+ +ND N+ + T ++    LK   SG V + V +
Sbjct:  256 VETIELVNDGS-GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIAR---GAVEETPAPSSLGITLSSSTSTSEMRVDASTQKNEES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVELDGRIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAEITSREDTAKDVDLPAENYEKD-EESLS---------LKRSTSILP--------------IEEEGYPLLST---------------------ELEETEDVQQEA-ALLTKWQRIMGINYEIV--VAHVSKFSENSGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRRTVPPTALSEVDSLDIHDLELTEKPHIDLGEFIGSSETEDPMLAMSDVDQNAEEIQTPLAMWEAGIQAIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAK 777          

HSP 7 Score: 83.5741 bits (205), Expect = 2.493e-14
Identity = 72/226 (31.86%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 5984 TLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR---DKQP--------LCEDSLYFKLKVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            T++   +PT  Q    VET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++ P        L   +   +++VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  243 TVSAHSNPTHWQ---HVET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPAPSSLGITLSSSTSTSEMRVDASTQKNEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVELDGRIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 461          

HSP 8 Score: 75.0998 bits (183), Expect = 8.607e-12
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LGLSI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  +++    +++++            +Q L    L F                + K   L +   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1838 ASEIQGLRTVEIKKGPADALGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSTIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2052          

HSP 9 Score: 73.1738 bits (178), Expect = 3.222e-11
Identity = 47/122 (38.52%), Postives = 72/122 (59.02%), Query Frame = 2
Query: 1421 KVRTKHRIRINEQNEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQ--TAK 1780
            ++R     + NE++E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  +L+G+I I DQI+ ++  ++ G  N   VE+L+ T   V+L   R       EI ++  TAK
Sbjct:  360 EMRVDASTQKNEESE--TFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVELDGRIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAEITSREDTAK 478          

HSP 10 Score: 63.929 bits (154), Expect = 2.532e-8
Identity = 41/120 (34.17%), Postives = 70/120 (58.33%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTE---W-AELEIVELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            L+ + VD + + + T    W A ++ +EL     GLGFS++  +      +T +VIRS+  G +AE++G L  GD LM+++DIN+   T E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  667 LAMSDVDQNAEEIQTPLAMWEAGIQAIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP--LSPE 784          

HSP 11 Score: 56.6102 bits (135), Expect = 3.959e-6
Identity = 33/104 (31.73%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     E +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   +RL + R
Sbjct:  360 EMRVDASTQ--KNEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVELDGRIQIGDQIVAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 461          

HSP 12 Score: 56.225 bits (134), Expect = 4.491e-6
Identity = 34/88 (38.64%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  614 LEIVELLNDRCG-LGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYID-DINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +EI ELL   CG LGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+  +  + +T +Q  +IL+++ D I+L+IAR
Sbjct:  136 VEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTIQLVIAR 223          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|O75970|MPDZ_HUMAN (Multiple PDZ domain protein OS=Homo sapiens OX=9606 GN=MPDZ PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 1.504e-96
Identity = 274/861 (31.82%), Postives = 427/861 (49.59%), Query Frame = 2
Query: 4046 GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPL--SLNSKSDMLKKKLTTPPNSPDKA--------TSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            GD I  IN +    +       +L  +   G  IKI Y+ A+  E            EF + + Q+     S   M   I      R+        + +       ++ + N W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+  ++  + S    L +     Y      P   SL   +D   K  +   + P+KA          +   +  +D  ++S S  S   +         + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1051 GDCILSINEESTISVTNAQARAMLRRHSLIGPDIKITYVPAEHLE------------EFKISLGQQ-----SGRVMALDIFSSYTGRDIPELPEREEGEGEESELQNTAYSN-WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSI--INRPRKSPLPSLLHNLYPKYNFSSTNPFADSLQINAD---KAPSQSESEPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGYSWKNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPIEKFISLLKTAKMTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLTIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRIKAGPF 1811          

HSP 2 Score: 98.9821 bits (245), Expect = 4.568e-19
Identity = 47/113 (41.59%), Postives = 76/113 (67.26%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSPEYCG-SMSIIPTDQIDQHLD 937
            W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR  I   ++P   G ++S  PT   +  +D
Sbjct:  252 WQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVD 364          

HSP 3 Score: 95.9005 bits (237), Expect = 4.354e-18
Identity = 58/161 (36.02%), Postives = 88/161 (54.66%), Query Frame = 2
Query: 2042 PLNQRLAKENTTKTDVLIA-----NILPNS--GFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            P+N  + KEN  K +  ++     NILP    G+ +    ++     +  E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  484 PVNASIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRR 633          

HSP 4 Score: 92.8189 bits (229), Expect = 3.814e-17
Identity = 63/199 (31.66%), Postives = 95/199 (47.74%), Query Frame = 2
Query: 6041 VIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL-------------------YFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            V EL K    GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P     +                   +  ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  137 VFELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQTITHQQAISILQKAKDTVQLVIARGSLPQLVSPIVSRSPSAASTISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 335          

HSP 5 Score: 92.0485 bits (227), Expect = 5.956e-17
Identity = 55/119 (46.22%), Postives = 80/119 (67.23%), Query Frame = 2
Query: 2846 PIKTLT-ANRSLQYLK-DVAMWSGPIL-VELTKESQGLGFSIEYYQD----ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            P+  +T A +S + ++  +AMW   I  +EL K S+GLGFSI  YQD    AS+   VI+I SLVP G+A  DGR++PGDRL+F+N+V ++  SS +E +EAL+    G V +G+AKP+
Sbjct:  673 PVLAMTDAGQSTEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPAST---VIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLEN-SSLEEAVEALKGAPSGTVRIGVAKPL 787          

HSP 6 Score: 85.1149 bits (209), Expect = 8.728e-15
Identity = 76/261 (29.12%), Postives = 118/261 (45.21%), Query Frame = 2
Query: 5885 RKRNSIQKVLNNQSITKKVSVNEQVIQEVP-PTKTLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYF----------KLKVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            + ++++Q V+   S+ + VS    ++   P    T++   +P   Q +   ET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     +L            +L+VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  211 KAKDTVQLVIARGSLPQLVS---PIVSRSPSAASTISAHSNPVHWQHM---ET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTAPTALGITLSSSPTSTPELRVDASTQKGEESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 7 Score: 76.2554 bits (186), Expect = 4.436e-12
Identity = 54/196 (27.55%), Postives = 87/196 (44.39%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1873 LGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2068          

HSP 8 Score: 71.2478 bits (173), Expect = 1.503e-10
Identity = 110/447 (24.61%), Postives = 192/447 (42.95%), Query Frame = 2
Query: 4409 VEREQN-QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQN-ETDEKXXXXXXXXX---XXXXXTPDLS-EIEAIRNGHKSST---DESGKVMNI-------EIDKQGK-KGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIML------TIKRHPDNL----VKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQG-----YGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNA 5641
            VE  +N Q LGI+I G           +  D  L  SGIF+  I   S  E  G++ IGD++++V+G +L   +   A+  +++    ++ T   L+   M ++++                     L S+ D+ K    +P N+      + I +N E DE   S + ++    + E   P LS EIE I +  K       +  ++M I        + K  +  G+G+ L    + +  + +I            G+L  GDELL++N I +LG +H +V  I+K+  +E   +        T +   D+L    +++   P           ++E+ V   TD  Q  S   +Q         I H+ LEK  +G GF I+D  +  D A   I ++ +   GIA  +G L  GDR++ +ND  + N   +  ++ L+G  + 
Sbjct:  378 VELTKNVQGLGITIAG-----------YIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLT---LMRRGMKQEAE---------------------LMSREDVTKDADLSPVNA------SIIKENYEKDEDFLSSTRNTNILPTEEEGYPLLSAEIEEIEDAQKQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISL----EATVGHHFIRSVLPEGPVGHSGKLFSGDELLEVNGITLLGENHQDVVNILKELPIEVTMVCCRRTVPPTTQSELDSLDLCDIELTEKPHVDLGEFIGSSETEDPVLAMTDAGQ--STEEVQAPLAMWEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSG 777          

HSP 9 Score: 67.0106 bits (162), Expect = 2.329e-9
Identity = 39/91 (42.86%), Postives = 55/91 (60.44%), Query Frame = 2
Query: 1463 EFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V L   R
Sbjct:  372 ESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVLLTLMR 461          

HSP 10 Score: 62.3882 bits (150), Expect = 6.128e-8
Identity = 49/183 (26.78%), Postives = 84/183 (45.90%), Query Frame = 2
Query: 5036 GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R      + A     +  S +P    E  V+ ST + + S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++
Sbjct:  266 GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARGAIE-ERTAPTALGITLSSSPTSTPELRVDASTQKGEES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVD 432          

HSP 11 Score: 60.8474 bits (146), Expect = 1.890e-7
Identity = 35/101 (34.65%), Postives = 61/101 (60.40%), Query Frame = 2
Query:  605 W-AELEIVELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            W A ++ +EL     GLGFS++  +      ST ++IRS+  G +AE++G L  GD LM+++D+N+   + E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  694 WEAGIQHIELEKGSKGLGFSILDYQDPIDPASTVIIIRSLVPGGIAEKDGRLLPGDRLMFVNDVNLENSSLEEAVEALKGAPSGTVRIGVAKPLP--LSPE 792          

HSP 12 Score: 60.077 bits (144), Expect = 3.581e-7
Identity = 59/230 (25.65%), Postives = 106/230 (46.09%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKIN--SIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHA 5686
             E+ K    G+G  +VG  +++   +  ++   ++ SVA  DG+L   D++L IN  ++D   ++H     I++K +   + + L I R          +P  V+  V+   +S +A  T      IS+++N   +  +  + L     G GF I+   A    G+ VK +   G+A   G L  GD IL I D  +     + V + LR C N +++++ R  I +  A
Sbjct:  138 FELLKPPSGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQALDQT-ITHQQAISILQKAK---DTVQLVIAR--------GSLPQLVSPIVS---RSPSAAST------ISAHSNPVHWQHMETIELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAIEERTA 343          

HSP 13 Score: 57.3806 bits (137), Expect = 1.939e-6
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AA+ DGRL  GD+I+AVNG+ L   TH++A+  L+     V L + 
Sbjct: 1996 GLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMVL 2069          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|Q8VBX6|MPDZ_MOUSE (Multiple PDZ domain protein OS=Mus musculus OX=10090 GN=Mpdz PE=1 SV=2)

HSP 1 Score: 347.821 bits (891), Expect = 5.963e-95
Identity = 249/758 (32.85%), Postives = 376/758 (49.60%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLS-----------LNSKSDMLKKKLT-TPPNSPD----------KATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSI-SHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            WS PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++    + S    L +     Y      P +             S+S+  K  L   PP+SP           + ++  ++++E  E E  +                  + +N  +     +G++  IE++K G+ G+GL L GNKD + M+ +I G      A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P     S +    S    E        +S  +L    D++ + L K   G G  I  C  +   G+ ++ +T  G AA +G L+ GD IL ++DE+V     +  +  L+  K  +++ V         A+N      P S                        +  ++ ERK ++  P++ + D EPI     P   R+S   V  +                            P    IIPG ET IE++K + GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +     ++L K+  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR  TQ+ VA LLK   G V L VGR+++  +
Sbjct: 1134 WSQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIIEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIIN--RPRKSPLPSLPHSLYPKYSFSSTNPFADSLQLTTDQAPSQSESETEKPALCNVPPSSPSVFSEMGSDCAQPSATAVSEDEDKEDEFGY------------------SWKNIQERYGSLTGQLHVIELEK-GQSGLGLSLAGNKDRTRMSVFIVGIDPTGAAGRDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNADAVNQMAVCPGIAADSPSSTSDSPQNKEVEPCSTTSASAADLSSLTDVYQLELPKDQGGLGIAI--CEEDTINGVMIESLTEHGGAAKDGRLKPGDHILAVDDEVVAGCPVEKFISLLKTAKATVKLTV--------RAENPACPAVPSS------------------------AVTVSGERKDNSQTPAVPAPDLEPI-----PSTSRSSTPAVFASD---------------------------PATCPIIPGCETTIEISKGQTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEDVCDTFTIELQKRPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRHATQEAVAALLKCSLGAVTLEVGRVKAAPF 1796          

HSP 2 Score: 98.5969 bits (244), Expect = 6.828e-19
Identity = 44/99 (44.44%), Postives = 68/99 (68.69%), Query Frame = 2
Query:  560 SETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            + T   HS  M    W  +E +EL+ND  GLGF ++G K+TGV++++I  G VA+++G L  GDH++ I D ++ GM+SEQVA +LRQ  + ++L+IAR
Sbjct:  241 ASTISAHSNPM---HWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 3 Score: 91.2781 bits (225), Expect = 9.931e-17
Identity = 55/137 (40.15%), Postives = 78/137 (56.93%), Query Frame = 2
Query: 2099 NILP--NSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK--TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            +ILP    GF +    L+ A  D   E  + + W +I+G NY+I++++++K   N GLGISLE TV            HH+IR++  +GP+G  G   SGDELLE NG  L G  +Q+V+  LK LP  V +V  RR
Sbjct:  502 SILPIEEEGFPLLSAELEEAE-DVQQEAALLTKWQRIMGINYEIVVAHVSKFSENSGLGISLEATVG-----------HHFIRSVLPEGPVGHSGKLFSGDELLEVNGINLLGENHQDVVNILKELPIDVTMVCCRR 626          

HSP 4 Score: 90.5077 bits (223), Expect = 1.774e-16
Identity = 49/99 (49.49%), Postives = 69/99 (69.70%), Query Frame = 2
Query: 2894 VAMW-SGPILVELTKESQGLGFSIEYYQDA--SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW +G   +EL K S+GLGFSI  YQD    +N  VIVI SLVP G+A  DGR+ PGDRL+F+N++ ++  S+ +E +EAL+    G V +G+AKP+
Sbjct:  684 LAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANT-VIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLEN-STLEEAVEALKGAPSGMVRIGVAKPL 780          

HSP 5 Score: 90.1225 bits (222), Expect = 2.818e-16
Identity = 59/189 (31.22%), Postives = 94/189 (49.74%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLC------------------EDSLYFK-LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G      G   + + E+ E   A  DGRL   D+ILA+NG+ L +  TH QAI  L+   + V+L I R   P                     + ++++ ++   L     GLG  I+     GV +  ++ G +A+Q GRL  GD +L+I DT++   + +QVA +L++C   V LM+ R
Sbjct:  148 GLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIARGSLPPVSSPRISRSPSAASTISAHSNPMHWQHVETIELVNDGSGLGFGIIGGKATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIAR 336          

HSP 6 Score: 82.8037 bits (203), Expect = 4.343e-14
Identity = 69/211 (32.70%), Postives = 95/211 (45.02%), Query Frame = 2
Query: 6032 VETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD--KQPLCEDSLYFKL----------KVDL--------------LKKSRKGLGITIVSK------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VET IEL  D  GLG  IIGG  T    V++  +     A   GRL +GD IL +   DL   + +Q  Q LR  GNRVKL I R   ++     SL   L          +VD               L K+ +GLGITI            G+ +  + K S  E DGR++ GD ++ ++ TN++ FT  Q   +L+     V L + R
Sbjct:  256 VET-IELVNDGSGLGFGIIGGKAT---GVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQCGNRVKLMIARGAVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 7 Score: 75.0998 bits (183), Expect = 9.683e-12
Identity = 60/215 (27.91%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LGLSI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  +++    +++++            +Q L    L F                + K   L +   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct: 1839 ASEIQGLRTVEIKKGPADSLGLSIAGGVGSPLGDVPIFIAMMHPNGVAAQTQKLRVGDRIVTICGTSTDGMTHTQAVNLMKNASGSIEVQVVAGGDVSVVTGHQQELANPCLAFTGLTSSSIFPDDLGPPQSKTITLDRGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 2053          

HSP 8 Score: 69.707 bits (169), Expect = 3.753e-10
Identity = 39/92 (42.39%), Postives = 57/92 (61.96%), Query Frame = 2
Query: 1460 NEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +E   +   LTK  QGLG+TIAGYI  + ++   GIFVKSI+K+S  + +G+I I DQII ++  ++ G  N   VE+L+ T   V+L   R
Sbjct:  372 DESETFDVELTKNVQGLGITIAGYIGDK-KLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 9 Score: 62.7734 bits (151), Expect = 5.046e-8
Identity = 41/120 (34.17%), Postives = 68/120 (56.67%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTEWAELEI----VELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQS-SDHIRLIIARPIPNCSSPE 883
            L+ + VD + + + T  A  E     +EL     GLGFS++  +      +T +VIRS+  G +AE++G L  GD LM+++DIN+   T E+    L+ + S  +R+ +A+P+P   SPE
Sbjct:  668 LAMSDVDQNAEEIQTPLAMWEAGGQSIELEKGSRGLGFSILDYQDPIDPANTVIVIRSLVPGGIAEKDGRLFPGDRLMFVNDINLENSTLEEAVEALKGAPSGMVRIGVAKPLP--LSPE 785          

HSP 10 Score: 59.3066 bits (142), Expect = 6.230e-7
Identity = 65/257 (25.29%), Postives = 110/257 (42.80%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVA----PCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNAN---DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQ--------DHAKNIETEPQPISKD 5725
            V  IE+   G  G+G  ++G K   +    +       VA   G+L  GD +LKI   D+ GMS   VA ++++C     ++ L I R       +   PAS +  +         SE  V+ ST +N  S         + F V L K+VQG G  I     +   + +GI+VK +T      ++G ++ GD+I+ ++   +        ++ LR     + + + R   SQ        D AK+++   +   KD
Sbjct:  256 VETIELVNDGS-GLGFGIIGGK---ATGVIVKTILPGGVADQHGRLCSGDHILKIGDTDLAGMSSEQVAQVLRQC---GNRVKLMIARG-----AVEETPASSSLGITLSSSTSSTSEMRVDASTQKNDES---------ETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMRKGASQEAELTSRGDTAKDVDLPAENCEKD 491          

HSP 11 Score: 55.8398 bits (133), Expect = 5.588e-6
Identity = 32/104 (30.77%), Postives = 56/104 (53.85%), Query Frame = 2
Query:  563 ETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGS------KSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E  VD ST     + +E   VEL  +  GLG ++ G       + +G+ ++SI   S  E +G ++IGD ++ +D  N++G T++Q   +LR +   +RL + R
Sbjct:  361 EMRVDASTQ--KNDESETFDVELTKNVQGLGITIAGYIGDKKLEPSGIFVKSITKSSAVEHDGRIQIGDQIIAVDGTNLQGFTNQQAVEVLRHTGQTVRLTLMR 462          

HSP 12 Score: 55.8398 bits (133), Expect = 6.666e-6
Identity = 33/88 (37.50%), Postives = 56/88 (63.64%), Query Frame = 2
Query:  614 LEIVELLNDRCG-LGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYID-DINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +EI ELL   CG LGFS++G +S      G+ ++ I  GSVA R+G L+  D ++ I+  +  + +T +Q  +IL+++ D ++L+IAR
Sbjct:  136 VEIFELLKPPCGGLGFSVVGLRSENRGELGIFVQEIQEGSVAHRDGRLKETDQILAINGQVLDQTITHQQAISILQKAKDTVQLVIAR 223          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|F1MAD2|INADL_RAT (InaD-like protein OS=Rattus norvegicus OX=10116 GN=Patj PE=1 SV=2)

HSP 1 Score: 208.379 bits (529), Expect = 2.677e-52
Identity = 171/591 (28.93%), Postives = 274/591 (46.36%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVGNKDCSSM--------NCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHP------DNLVKMACIPASVNTSVAPCEKSENA----------------VETSTDENQISSNNNLQGYGDI---FHV-HLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMS-------AVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEH-----------------------PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            +EI ++    +G+ +VG +               +I    ++S A     L  GD++L+++ +D+   SH+     IK        ++ ++   P      +N  K        NT     ++   A                 E S +++ ++     Q Y D+    H+  LEK   G G  +          I+V  +  DG AA +G +R GD +L IN++++    + +    ++     +++V  R   ++D    +   P P+       +E      P   +  + +      ER+ S       AV  S+  ++E    S  PD    S  + +     + +VS + Q I   P    L Q  H                       P    I+PG E +IE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR+++H++AI  LR    +V+L I+RD+    ++       VDL KK+ +GLG++IV K S  GV ISD+VKG  A+ DGRL +GD +L +N  +VR  +Q+ VAT+LK   G V L +GRLR+  +
Sbjct: 1077 VEIFREPNVSLGISIVGGQTVIKRLKNGEELKGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDLQNASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPSVNNKGKTPPQNQDQNTQEKKAKRHGTAPPPMKLPPPYRAPSADTEESEEDSALTDKKIRQRYADLPGELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPDGPAAADGRMRVGDELLEINNQILYGRSHQNASAIIKTAPTRVKLVFIR---NEDAVNQMAVAPFPVPSHSPSPVEDLGGTEPVSSEEDSSVDAKPLPERESSKPEDLTQAVDDSMVAEQEKASES--PD----SAARQMKQPGYSAQVSSSSQEIPSAP--APLCQSTHADVTGSGNFQAPLSVDPAPLSVDPATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVIYRDEAQYRDEENLEVFLVDLQKKTGRGLGLSIVGKRSGSGVFISDIVKGGAADLDGRLIRGDQILSVNGEDVRQASQETVATILKCVQGLVQLEIGRLRAGSW 1656          

HSP 2 Score: 139.428 bits (350), Expect = 2.372e-31
Identity = 105/335 (31.34%), Postives = 161/335 (48.06%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGK--VANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATS-NKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNG--HKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNT-SVAPCEKSENAVETSTDEN 5371
            W  PR+V + RE N SLGISI+GG+  +  +K  EE         GIFI  +  DSPA K   L  GD++L V+G+DL   S+ +A+  IK+A +P+VF +QSL     +  S                             +  K  TPP + D+ T   K  ++ T            +  + T +  E  A+ +    +   D  G++  IE++K  K G+GL L GNKD S M+ ++ G   +  AA DG++ +GDELL+IN+  + G SH N + IIK       ++ L   R+ D + +MA  P  V + S +P E        S++E+
Sbjct: 1071 WGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEEL-------KGIFIKQVLEDSPAGKTKALKTGDKILEVSGVDLQNASHAEAVEAIKSAGNPVVFVVQSLSSTPRVIPS-----------------------------VNNKGKTPPQNQDQNTQEKKAKRHGTAPPPMKLPPPYRAPSADTEESEEDSALTDKKIRQRYADLPGELHIIELEKD-KNGLGLSLAGNKDRSRMSIFVVGINPDGPAAADGRMRVGDELLEINNQILYGRSHQNASAIIKTAPT---RVKLVFIRNEDAVNQMAVAPFPVPSHSPSPVEDLGGTEPVSSEED 1365          

HSP 3 Score: 102.064 bits (253), Expect = 5.518e-20
Identity = 43/84 (51.19%), Postives = 62/84 (73.81%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            W   E VEL+ND  GLGF ++G KS+GVV+R+I  G +A+R+G L+ GDH++ I   NV+GMTSEQVA +LR   + +R+++AR
Sbjct:  243 WGHTEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGSTNVQGMTSEQVAQVLRNCGNSVRMLVAR 326          

HSP 4 Score: 91.2781 bits (225), Expect = 1.161e-16
Identity = 62/190 (32.63%), Postives = 92/190 (48.42%), Query Frame = 2
Query: 6044 IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRD-------------KQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            IE     GLG S++      LG +   + EVH    A  D RL   D+ILA+N   L +N +H QAI  L+     ++L + R+                L E   +   +   L     GLG  IV     GV +  +V G +A++DGRL+ GD +L+I  TNV+  T +QVA +L+ C  +V ++V R
Sbjct:  137 IERPSTGGLGFSVVALRSQSLGLIDIFVKEVHPGSVADRDQRLKENDQILAINDTPLDQNISHQQAIALLQQATGSLRLVVAREVGHTQSRTSTSSADTTLPETVRWGHTEDVELINDGSGLGFGIVGGKSSGVVVRTIVPGGLADRDGRLQTGDHILKIGSTNVQGMTSEQVAQVLRNCGNSVRMLVAR 326          

HSP 5 Score: 79.337 bits (194), Expect = 4.073e-13
Identity = 54/138 (39.13%), Postives = 79/138 (57.25%), Query Frame = 2
Query: 2891 DVAMWSGPI-LVELTKESQGLGFSIEYYQDASSNV-PVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSS-------YMYR-------SYSKETVEELSTSQSLE 3256
            ++A+WS  +  VEL K+ +GLGFSI  YQD    +  VIVI SLV +GVA   G ++PGDRL+ +NE  +D  ++  E +E L+++  G V LGI KP+           +++        S S ETV E+ +S  LE
Sbjct:  677 ELALWSPEVKTVELVKDCKGLGFSILDYQDPLDPMRSVIVIRSLVADGVAERSGELLPGDRLVSVNEFSLDN-ATLAEAVEVLKAVPPGVVHLGICKPLVEEEKEEKEEHFIFHSNNNGDNSESPETVHEIHSSLILE 813          

HSP 6 Score: 72.7886 bits (177), Expect = 4.845e-11
Identity = 55/211 (26.07%), Postives = 96/211 (45.50%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK-----------------------QPLCEDSLYFK-LKVDLLKKSRKGLGITIVSKSDV-------GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNI 6580
            +EL  D  GLG  I+GG  +    V++  +     A  DGRL  GD IL +   +++  T +Q  Q LR+ GN V++ + RD                        + L  DS  F+   V+L+KK  + LGI IV            G+ +  ++ GS A  +G+++  D ++ ++  N++ F    V  +L+     V L + R ++++
Sbjct:  249 VELINDGSGLGFGIVGGKSS---GVVVRTIVPGGLADRDGRLQTGDHILKIGSTNVQGMTSEQVAQVLRNCGNSVRMLVARDPVGEIAVTPPTPASLPVALPVVATRTLGSDSSPFETYNVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVAVDGVNIQGFANQDVVEVLRNAGQVVHLTLVRRKTSL 456          

HSP 7 Score: 60.077 bits (144), Expect = 2.876e-7
Identity = 59/250 (23.60%), Postives = 108/250 (43.20%), Query Frame = 2
Query: 4046 GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFIN-LTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSD--YESHEQEPLSL 4786
            GD I  +NG+ + +   +T++ +L   +    +++IG + A  +  S                     +  S ++  +Q +  +  R SF   +T LQ     + S           PR V + RE + +LG+SI GGK + + +             IFI  I  +  A +  +L +GDR++S+NG  L   S+ DA++ +KNA   I+  + +  ++S +        +  QL     + H Q+P  L
Sbjct: 1614 GDQILSVNGEDVRQASQETVATILKCVQGL-VQLEIGRLRAGSWASS---------------------RKTSQNSQGDQHSAHSSCRPSFAPVITSLQNLVGTKRSSDPPQKCTEEEPRTVEIIRELSDALGVSIAGGKGSPLGDIP-----------IFIAMIQANGVAARTQKLKVGDRIVSINGQPLDGLSHTDAVNLLKNAFGRIILQVVADTNISAIATQLEMMSAGSQLGSPTADRHPQDPEEL 1830          

HSP 8 Score: 59.6918 bits (143), Expect = 4.380e-7
Identity = 38/135 (28.15%), Postives = 69/135 (51.11%), Query Frame = 2
Query: 2126 VQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYIN----------KTNEGLGI-SLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            ++K ++    I    E+ +KS W  ++G +Y+++++ ++          K ++ L I +L   ++VD   G     HHYI +I   GP+      +  DELLE NG +L+G   +E ++ LK +P    +V  RR
Sbjct:  511 LEKPDVYPEDIPGCPENELKSRWENLLGPDYEVMVATLDTQIADDEELQKYSKLLPIHTLRLGMEVDSFDG-----HHYISSIAPGGPVDTLNLLQPEDELLEVNGVQLYGKSRREAVSFLKEVPPPFTLVCCRR 640          

HSP 9 Score: 59.6918 bits (143), Expect = 4.646e-7
Identity = 27/82 (32.93%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            I+E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R  + E+    LRQ+   +RL+I R
Sbjct: 1474 IIEISKGRSGLGLSIVGGKDTPLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSSSHEEAITALRQTPQKVRLVIYR 1555          

HSP 10 Score: 58.9214 bits (141), Expect = 7.566e-7
Identity = 34/96 (35.42%), Postives = 51/96 (53.12%), Query Frame = 2
Query: 1451 NEQNEFHEYTTYLTKGE-QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            ++ + F  Y   L K + Q LG+ I GY+         GI+VKSI   S A  NGQI +ND+I+ ++  ++ G  N  VVE+L+    +V L   R
Sbjct:  356 SDSSPFETYNVELVKKDGQSLGIRIVGYVGTAHPGEASGIYVKSIIPGSAAYHNGQIQVNDKIVAVDGVNIQGFANQDVVEVLRNAGQVVHLTLVR 451          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Match: sp|Q8NI35|INADL_HUMAN (InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ PE=1 SV=3)

HSP 1 Score: 196.052 bits (497), Expect = 1.561e-48
Identity = 129/409 (31.54%), Postives = 214/409 (52.32%), Query Frame = 2
Query: 5405 GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMV-------VGRITISQDHAKNI-------ETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            G++  + LEK   G G  +          I+V  +  +G AA +G +R GD +L IN++++    + +    ++   + +++V       V ++ ++     +        ++  +PIS +   S+E  +   P        +S +   +++    + S S  + P+    P     ++             +SV+                  P    I+PG E +IE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLRN++H++AI  LR    +V+L ++RD+    ++       VDL KK+ +GLG++IV K +  GV ISD+VKG  A+ DGRL +GD +L +N  ++R+ +Q+ VAT+LK   G V L +GRLR+  +
Sbjct: 1235 GELHIIELEKDKNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTAPSKVKLVFIRNEDAVNQMAVTPFPVPSSSPSSIEDQSGTEPISSEEDGSVEVGIKQLPESESFKLAVSQM---KQQKYPTKVSFSSQEIPL---APASSYHSTDADFTGYGGFQAPLSVD------------------PATCPIVPGQEMIIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYRDEAHYRDEENLEIFPVDLQKKAGRGLGLSIVGKRNGSGVFISDIVKGGAADLDGRLIQGDQILSVNGEDMRNASQETVATILKCAQGLVQLEIGRLRAGSW 1619          

HSP 2 Score: 130.183 bits (326), Expect = 1.627e-28
Identity = 102/318 (32.08%), Postives = 147/318 (46.23%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGK--VANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQN----ETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDES---------GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMAC 5293
            W  PR+V + RE N SLGISI+GG+  +  +K  EE         GIFI  +  DSPA K   L  GD++L V+G+DL   S+ +A+  IKNA +P+VF +Q                                SL+S   ++       PN  +KA     NQN    E  EK    +   +        L++         + TD+          G++  IE++K  K G+GL L GNKD S M+ ++ G      AA DG++ IGDELL+IN+  + G SH N + IIK       K+ L   R+ D + +MA 
Sbjct: 1063 WGPPRIVEIFREPNVSLGISIVGGQTVIKRLKNGEEL-------KGIFIKQVLEDSPAGKTNALKTGDKILEVSGVDLQNASHSEAVEAIKNAGNPVVFIVQ--------------------------------SLSSTPRVI-------PNVHNKANKITGNQNQDTQEKKEKRQGTAPPPMKLPPPYKALTDDSDENEEEDAFTDQKIRQRYADLPGELHIIELEKD-KNGLGLSLAGNKDRSRMSIFVVGINPEGPAAADGRMRIGDELLEINNQILYGRSHQNASAIIKTA---PSKVKLVFIRNEDAVNQMAV 1330          

HSP 3 Score: 101.679 bits (252), Expect = 7.487e-20
Identity = 42/84 (50.00%), Postives = 63/84 (75.00%), Query Frame = 2
Query:  605 WAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            W  +E VEL+ND  GLGF ++G K++GVV+R+I  G +A+R+G L+ GDH++ I   NV+GMTSEQVA +LR   + +R+++AR
Sbjct:  243 WGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTNVQGMTSEQVAQVLRNCGNSVRMLVAR 326          

HSP 4 Score: 93.2041 bits (230), Expect = 2.761e-17
Identity = 93/374 (24.87%), Postives = 155/374 (41.44%), Query Frame = 2
Query: 1466 FHEYTTYLTKGE-QGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVPPSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYIN----------KTNEGLGI-SLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR---KEVDVSQLSRSSSTM 2542
            F  Y   L + + Q LG+ I GY+         GI+VKSI   S A  NG I +ND+I+ ++  ++ G  N  VVE+L+    +V L   R                                            KT++ T  L+P       +D   V        V  + P A     + E E  +   D  + +R+   +T K D            N+Q +  K   +  + E+ +KS W  ++G +Y+++++ ++          K ++ L I +L   V+VD   G     HHYI +I + GP+   G  +  DELLE NG +L+G   +E ++ LK +P    +V  RR    E  V +  R+ +++
Sbjct:  361 FETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVAVDGVNIQGFANHDVVEVLRNAGQVVHLTLVR-------------------------------------------RKTSSSTSPLEP------PSDRGTV--------VEPLKPPALFLTGAVETETNVDGEDEEIKERI---DTLKND------------NIQALE-KLEKVPDSPENELKSRWENLLGPDYEVMVATLDTQIADDAELQKYSKLLPIHTLRLGVEVDSFDG-----HHYISSIVSGGPVDTLGLLQPEDELLEVNGMQLYGKSRREAVSFLKEVPPPFTLVCCRRLFDDEASVDEPRRTETSL 656          

HSP 5 Score: 87.4261 bits (215), Expect = 1.583e-15
Identity = 61/190 (32.11%), Postives = 92/190 (48.42%), Query Frame = 2
Query: 6044 IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDK-------------QPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            IE     GLG S++      LG V   + +V     A  D RL   D+ILA+N   L +N +H QAI  L+     ++L + R+                L E   +  ++   L     GLG  IV     GV +  +V G +A++DGRL+ GD +L+I  TNV+  T +QVA +L+ C  +V ++V R
Sbjct:  137 IERPSTGGLGFSVVALRSQNLGKVDIFVKDVQPGSVADRDQRLKENDQILAINHTPLDQNISHQQAIALLQQTTGSLRLIVAREPVHTKSSTSSSLNDTTLPETVCWGHVEEVELINDGSGLGFGIVGGKTSGVVVRTIVPGGLADRDGRLQTGDHILKIGGTNVQGMTSEQVAQVLRNCGNSVRMLVAR 326          

HSP 6 Score: 81.2629 bits (199), Expect = 1.238e-13
Identity = 53/123 (43.09%), Postives = 73/123 (59.35%), Query Frame = 2
Query: 2891 DVAMWSGPI-LVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMF-----PSSYMYRSYSKETVEELS 3238
            ++A+WS  + +VEL K+ +GLGFSI  YQD       VIVI SLV +GVA   G ++PGDRL+ +NE  +D  +S  E +E L+++  G V LGI KP+       S Y+  S S E   E S
Sbjct:  676 ELALWSPEVKIVELVKDCKGLGFSILDYQDPLDPTRSVIVIRSLVADGVAERSGGLLPGDRLVSVNEYCLDN-TSLAEAVEILKAVPPGLVHLGICKPLVEDNEEESCYILHSSSNEDKTEFS 797          

HSP 7 Score: 78.5666 bits (192), Expect = 7.949e-13
Identity = 55/210 (26.19%), Postives = 96/210 (45.71%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD------------------------KQPLCEDSLYFKLKVDLLKKSRKGLGITIV-------SKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSN 6577
            +EL  D  GLG  I+GG  +    V++  +     A  DGRL  GD IL + G +++  T +Q  Q LR+ GN V++ + RD                        K P  + SL+    V+L++K  + LGI IV       +    G+ +  ++ GS A  +G ++  D ++ ++  N++ F    V  +L+     V L + R +++
Sbjct:  249 VELINDGSGLGFGIVGGKTS---GVVVRTIVPGGLADRDGRLQTGDHILKIGGTNVQGMTSEQVAQVLRNCGNSVRMLVARDPAGDISVTPPAPAALPVALPTVASKGPGSDSSLFETYNVELVRKDGQSLGIRIVGYVGTSHTGEASGIYVKSIIPGSAAYHNGHIQVNDKIVAVDGVNIQGFANHDVVEVLRNAGQVVHLTLVRRKTS 455          

HSP 8 Score: 58.9214 bits (141), Expect = 7.803e-7
Identity = 26/82 (31.71%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            I+E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R  + E+    LRQ+   +RL++ R
Sbjct: 1437 IIEISKGRSGLGLSIVGGKDTPLNAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRNSSHEEAITALRQTPQKVRLVVYR 1518          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A2J8XHZ6 (MPDZ isoform 9 OS=Pongo abelii OX=9601 GN=CR201_G0001761 PE=4 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 7.711e-99
Identity = 250/738 (33.88%), Postives = 385/738 (52.17%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN---NLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            W+ PR V + RE ++SLGISI+GG+    +       +  ++ GIFI H+  DSPA K G L  GDR++ V+G+DL   S++ A+  I+ A +P+VF +QS+++                 S  ES E E   L S             +   +++++KI+Q+   E E  +                 + IR  + + T   G++  IE++K G  G+GL L GNKD S M+ +I G   N  A  DG+L I DELL+IN   + G SH N + IIK C     KI+    R+ D + +MA  P +   +V P   +   ++    E  +++++   +L  + ++ H+ L K   G G  I +   +  +G+ +K +T  G+AA +G L+ GD+IL ++DE+VV    +  +  L+  K  +++ +        HA+N +++  P +     +      NS   L +P   SP                           P+  RN+      ++S T  +  ++                 P    IIPG ET IE++K R GLGLSI+GGSDT+LG ++IHEV+E+ AA  DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L ++RD+ P  E+ +   L ++L KK  KGLG++IV K +D GV +SD+VKG IA+ DGRL +GD +L +N  +VR+ TQ+ VA LLK   G V L VGR+++  +
Sbjct:   38 WNQPRRVELWREPSKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHVLEDSPAGKNGTLKPGDRIVEVDGMDLRDASHEQAVEAIRKAGNPVVFMVQSIINRPRAP------------SQSES-EPEKAPLCSVPPPPPSAFAEMGSDHTQSSASKISQDVDKEDEFGY---------------SWKNIRERYGTLT---GELHMIELEK-GHSGLGLSLAGNKDRSRMSVFIVGIDPNGAAGKDGRLQIADELLEINGQILYGRSHQNASSIIK-CAPSKVKIIFI--RNKDAVNQMAVCPGN---AVEPLPSNSENLQNKETEPTVTTSDAAVDLSSFKNVQHLELPKDQGGLGIAISE--EDTLSGVIIKSLTEHGVAATDGRLKVGDQILAVDDEIVVGYPVEKFISLLKTAKTTVKLTI--------HAENPDSQAVPSAAG---AASGEKKNSSQSLMVPQSGSP--------------------------EPESIRNT------SRSSTPAIFASD-----------------PATCPIIPGCETTIEISKGRTGLGLSIVGGSDTLLGAIIIHEVYEEGAACKDGRLWAGDQILEVNGIDLRKATHDEAINVLRQTPQRVRLTLYRDEAPYKEEEVCDTLAIELQKKPGKGLGLSIVGKRNDTGVFVSDIVKGGIADADGRLMQGDQILMVNGEDVRNATQEAVAALLKCSLGTVTLEVGRMKAGPF 670          

HSP 2 Score: 75.485 bits (184), Expect = 1.439e-9
Identity = 60/215 (27.91%), Postives = 95/215 (44.19%), Query Frame = 2
Query: 6014 AQIIPGVETV-IELTKDRGLGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD---------KQPLCEDSLYF----------------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            A  I G+ TV I+      LG+SI GG  + LG V   I  +H    AA   +L  GDRI+ + G      TH QA+  L++    +++++            +Q     SL F                + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LKR  G V LMV
Sbjct:  713 ASEIQGLRTVEIKKGPTDSLGISIAGGVGSPLGDVPIFIAMMHPTGVAAQTQKLRVGDRIVTICGTSTEGMTHTQAVNLLKNASGSIEMQVVAGGDVSVVTGHQQEPASSSLSFTGLTSSSIFQDDLGPPQCKSITLERGPDGLGFSIVGGYGSPHGDLPIYVKTVFAKGAASEDGRLKRGDQIIAVNGQSLEGVTHEEAVAILKRTKGTVTLMV 927          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A1S3KGP9 (multiple PDZ domain protein isoform X5 OS=Lingula unguis OX=7574 GN=LOC106181849 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 9.518e-99
Identity = 258/738 (34.96%), Postives = 385/738 (52.17%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPA--SVNTSVAPCEKSENAVETSTDENQISSN--NNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRIT-ISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSN 6577
            W  PR V +ER+  QSLGISI+GGKV       E     + ++GIFI H+   SPA K GQL  GDR+L V+G++L   ++D A++ I+NA SP+ F IQS++D +   D +++  ++  + D     + PL    +   L+++    P      T     ++ TD+  +S    S      T         +   +   D +G +  +EI++ G  G+GL L GNKD S+M+ ++ G   + +A  DG++ IGDELL++N   + G SH N + IIK   +    I L + R  D L  +A  P   +V+T       +  +  +S  E+ ISS    +   + D+  V ++K     G  IM+ +   + GIY+K +T    A +EG L  GD+IL ++D+ +V   YD  ++ LR  +  +++ V +    S D A NI     P+ +D +  ++   IN  P        SP+   ER+ S                                Q  T   +  E V  +  P K               G ET +E+ K + GLGLSI+GGSDT++G ++IHEV+E  AAA DGRL AGD+IL V G+DLR+ATHD AIQ LR     V + ++RD   L E+ LY    +DLLKK  +GLGI+IV K +DVGV ISD+VKG +AE DGRL +GD +L +ND N+R+ TQD  AT+LK   G V L +GRL++ 
Sbjct: 1283 WGPPRTVYLERQPGQSLGISIVGGKVDLFHVSPE-----HTITGIFIKHVLEGSPAGKSGQLKTGDRILEVDGVELKDATHDQAVAAIRNANSPVKFVIQSIMDKAPPSDRESSSQNSTVIPD-----RSPLPHAVRKLHLQQEPHMSPLDESVLTIETPGESTTDQPHDSSDSESDDEFGYT--------YKKLQRKYGDLNGVLHLLEIER-GSNGLGLSLAGNKDRSTMSVFVVGIDKDGLAFQDGRIRIGDELLEVNGQVLYGRSHLNASAIIKG--ITHPIIKLVLLRREDFLEHVAVKPLDNAVSTEDVSINSTSPSSPSSNREDTISSRTEQDFSTFPDVTTVTIDKGPARLGLAIMEGSVEGQPGIYIKSITPGSPAEHEGHLAVGDQILAVDDQSLVAVSYDKAIEFLRSAQGTVKLTVSKPGDSSSDTASNI-----PVDEDSQAGLDVRQINVEP-------ASPL---EREQS--------------------------------QDTTTSDTGPEMVDPQTCPIKI--------------GQETWLEIEKGKSGLGLSIVGGSDTMIGAIIIHEVYEDGAAARDGRLTAGDQILEVCGQDLRDATHDNAIQVLRQTPPVVTMLVYRDDAQLREEDLYDIFTIDLLKKPGRGLGISIVGKRNDVGVYISDIVKGGVAEADGRLMQGDQILSVNDDNMRNATQDHAATVLKTIMGKVTLTIGRLKTG 1938          

HSP 2 Score: 146.362 bits (368), Expect = 5.691e-31
Identity = 70/149 (46.98%), Postives = 102/149 (68.46%), Query Frame = 2
Query:  530 NFCGNPLSGLSETTVDHSTDM-LNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI---PNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPV 964
            +  G P +  + TT+   +DM ++TEW ++E+++LLND  GLGF ++G KSTGVV+++I  G VA++NG L  GDH++ I D+NVRGM SEQVAA+LRQS  H+RL++AR +   P   +P       I+PT ++D+HL  L  TLL V
Sbjct:  229 DHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVARGVTEPPTAQNP----LAPIVPTHELDEHLQHLYATLLEV 373          

HSP 3 Score: 123.635 bits (309), Expect = 5.411e-24
Identity = 57/117 (48.72%), Postives = 86/117 (73.50%), Query Frame = 2
Query: 2156 IDKTIEDTIKSTWNKIIGGNYDILISYINKTNEG--LGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            + K +E+ +K+TW  ++G  Y+++++ ++K  EG  LGISLEGTVDV++  G E +PHH+IR+I  DGP+G +G  +SGDELLE NG+KL G+ + +V+  LK LP  V+I+ ARRK
Sbjct:  626 LSKEVEEALKATWQPMVGDEYEVVVAQLSKFREGGGLGISLEGTVDVEN--GHEVRPHHFIRSILPDGPVGANGKLESGDELLEVNGRKLLGLSHVDVVKILKELPQHVRIICARRK 740          

HSP 4 Score: 106.686 bits (265), Expect = 7.865e-19
Identity = 72/178 (40.45%), Postives = 104/178 (58.43%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            + KAKS+ ++ V        +P      +RSL+ L  +AMWS  P+++EL K  +GLGFSI  YQD  + +  VIVI SLVP GVA +DGR++PGDRL+F+NE+ ++  +  Q V +AL+   KG V +G+AKP+ P      S   E V  + T        +T AE   IG++Y S
Sbjct:  776 LVKAKSEQTLNVTE------VPQLNKNKSRSLEPLTGLAMWSSEPVVIELVKGDRGLGFSILDYQDPLNPSETVIVIRSLVPGGVAQVDGRLVPGDRLMFVNEINLENATLDQAV-QALKGAPKGVVQIGVAKPL-PVPDTSLSSQPEMVMSMPT--------YTEAE---IGASYES 934          

HSP 5 Score: 97.4413 bits (241), Expect = 4.616e-16
Identity = 48/101 (47.52%), Postives = 68/101 (67.33%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTA 1777
            +   L+KG QGLG+TIAGY+  +    + GIFVKS+++ S AD+ G+I +NDQII+++ QS+ G  N   VE+L+ T  +V+LK  RY KG  YE L Q A
Sbjct:  431 FEVELSKGSQGLGITIAGYVGDK-SAELSGIFVKSVAEGSAADVEGRIRVNDQIIQVDGQSLEGYSNHQAVEVLRHTGQVVRLKLARYHKGAKYEQLQQYA 530          

HSP 6 Score: 86.2705 bits (212), Expect = 9.962e-13
Identity = 63/201 (31.34%), Postives = 100/201 (49.75%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFR--------------DKQP--LCEDS------LYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            ++LTK+ G  LG S++G      G   + + E+     AA DG+L   D+ILA++ + L  N +H  AI  L+     V+L + R              DK P  L  DS       + +++V  L     GLG  I+     GV +  ++ G +A+++GRL  GD +L+I D NVR    +QVA +L++   +V L+V R
Sbjct:  138 VQLTKEEGKSLGFSVVGLKSENRGELGIFVKEIQPGGIAAQDGQLQESDQILAIDKQPLANNISHQNAISILQKATGLVELVLARGPIPRSDHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVAR 338          

HSP 7 Score: 72.7886 bits (177), Expect = 1.275e-8
Identity = 53/205 (25.85%), Postives = 93/205 (45.37%), Query Frame = 2
Query: 6044 IELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------------------QPLCEDSL------YFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            +EL +D    LG+SI GG  + +G   V+I  +     A   G+L  GD I+++NG+     TH +A+Q L+     + L + + +                  QP  E+ +        ++K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD +  +N  ++   T ++   +LKR  G + L V
Sbjct: 1994 VELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQGTISLVVTQGEDVVLEVNGHSKVYELPSNQPEPEEDMPQEISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKGKIELTV 2198          

HSP 8 Score: 66.6254 bits (161), Expect = 1.106e-6
Identity = 56/216 (25.93%), Postives = 93/216 (43.06%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRG 5629
            + + +E D+QG  G+ +              I   + N  A   G+L +GD ++ IN     G++H     ++K+ Q     I L + +  D +++       VN      E   N  E   D  Q      + G   +  + LE+   G GF I+  + +      IYVK V   G AA +G L+ GD+I  +N E    V +E+  ++LKR +G
Sbjct: 1992 RTVELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQG---TISLVVTQGEDVVLE-------VNGHSKVYELPSNQPEPEEDMPQ-----EISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKG 2192          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A1S3KHV8 (multiple PDZ domain protein isoform X4 OS=Lingula unguis OX=7574 GN=LOC106181849 PE=4 SV=1)

HSP 1 Score: 368.622 bits (945), Expect = 9.657e-99
Identity = 258/738 (34.96%), Postives = 385/738 (52.17%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPA--SVNTSVAPCEKSENAVETSTDENQISSN--NNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRIT-ISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSN 6577
            W  PR V +ER+  QSLGISI+GGKV       E     + ++GIFI H+   SPA K GQL  GDR+L V+G++L   ++D A++ I+NA SP+ F IQS++D +   D +++  ++  + D     + PL    +   L+++    P      T     ++ TD+  +S    S      T         +   +   D +G +  +EI++ G  G+GL L GNKD S+M+ ++ G   + +A  DG++ IGDELL++N   + G SH N + IIK   +    I L + R  D L  +A  P   +V+T       +  +  +S  E+ ISS    +   + D+  V ++K     G  IM+ +   + GIY+K +T    A +EG L  GD+IL ++D+ +V   YD  ++ LR  +  +++ V +    S D A NI     P+ +D +  ++   IN  P        SP+   ER+ S                                Q  T   +  E V  +  P K               G ET +E+ K + GLGLSI+GGSDT++G ++IHEV+E  AAA DGRL AGD+IL V G+DLR+ATHD AIQ LR     V + ++RD   L E+ LY    +DLLKK  +GLGI+IV K +DVGV ISD+VKG +AE DGRL +GD +L +ND N+R+ TQD  AT+LK   G V L +GRL++ 
Sbjct: 1317 WGPPRTVYLERQPGQSLGISIVGGKVDLFHVSPE-----HTITGIFIKHVLEGSPAGKSGQLKTGDRILEVDGVELKDATHDQAVAAIRNANSPVKFVIQSIMDKAPPSDRESSSQNSTVIPD-----RSPLPHAVRKLHLQQEPHMSPLDESVLTIETPGESTTDQPHDSSDSESDDEFGYT--------YKKLQRKYGDLNGVLHLLEIER-GSNGLGLSLAGNKDRSTMSVFVVGIDKDGLAFQDGRIRIGDELLEVNGQVLYGRSHLNASAIIKG--ITHPIIKLVLLRREDFLEHVAVKPLDNAVSTEDVSINSTSPSSPSSNREDTISSRTEQDFSTFPDVTTVTIDKGPARLGLAIMEGSVEGQPGIYIKSITPGSPAEHEGHLAVGDQILAVDDQSLVAVSYDKAIEFLRSAQGTVKLTVSKPGDSSSDTASNI-----PVDEDSQAGLDVRQINVEP-------ASPL---EREQS--------------------------------QDTTTSDTGPEMVDPQTCPIKI--------------GQETWLEIEKGKSGLGLSIVGGSDTMIGAIIIHEVYEDGAAARDGRLTAGDQILEVCGQDLRDATHDNAIQVLRQTPPVVTMLVYRDDAQLREEDLYDIFTIDLLKKPGRGLGISIVGKRNDVGVYISDIVKGGVAEADGRLMQGDQILSVNDDNMRNATQDHAATVLKTIMGKVTLTIGRLKTG 1972          

HSP 2 Score: 146.747 bits (369), Expect = 5.633e-31
Identity = 70/149 (46.98%), Postives = 102/149 (68.46%), Query Frame = 2
Query:  530 NFCGNPLSGLSETTVDHSTDM-LNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI---PNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPV 964
            +  G P +  + TT+   +DM ++TEW ++E+++LLND  GLGF ++G KSTGVV+++I  G VA++NG L  GDH++ I D+NVRGM SEQVAA+LRQS  H+RL++AR +   P   +P       I+PT ++D+HL  L  TLL V
Sbjct:  229 DHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVARGVTEPPTAQNP----LAPIVPTHELDEHLQHLYATLLEV 373          

HSP 3 Score: 123.635 bits (309), Expect = 5.303e-24
Identity = 57/117 (48.72%), Postives = 86/117 (73.50%), Query Frame = 2
Query: 2156 IDKTIEDTIKSTWNKIIGGNYDILISYINKTNEG--LGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            + K +E+ +K+TW  ++G  Y+++++ ++K  EG  LGISLEGTVDV++  G E +PHH+IR+I  DGP+G +G  +SGDELLE NG+KL G+ + +V+  LK LP  V+I+ ARRK
Sbjct:  626 LSKEVEEALKATWQPMVGDEYEVVVAQLSKFREGGGLGISLEGTVDVEN--GHEVRPHHFIRSILPDGPVGANGKLESGDELLEVNGRKLLGLSHVDVVKILKELPQHVRIICARRK 740          

HSP 4 Score: 106.686 bits (265), Expect = 8.100e-19
Identity = 72/178 (40.45%), Postives = 104/178 (58.43%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            + KAKS+ ++ V        +P      +RSL+ L  +AMWS  P+++EL K  +GLGFSI  YQD  + +  VIVI SLVP GVA +DGR++PGDRL+F+NE+ ++  +  Q V +AL+   KG V +G+AKP+ P      S   E V  + T        +T AE   IG++Y S
Sbjct:  776 LVKAKSEQTLNVTE------VPQLNKNKSRSLEPLTGLAMWSSEPVVIELVKGDRGLGFSILDYQDPLNPSETVIVIRSLVPGGVAQVDGRLVPGDRLMFVNEINLENATLDQAV-QALKGAPKGVVQIGVAKPL-PVPDTSLSSQPEMVMSMPT--------YTEAE---IGASYES 934          

HSP 5 Score: 97.4413 bits (241), Expect = 4.189e-16
Identity = 48/101 (47.52%), Postives = 68/101 (67.33%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTA 1777
            +   L+KG QGLG+TIAGY+  +    + GIFVKS+++ S AD+ G+I +NDQII+++ QS+ G  N   VE+L+ T  +V+LK  RY KG  YE L Q A
Sbjct:  431 FEVELSKGSQGLGITIAGYVGDK-SAELSGIFVKSVAEGSAADVEGRIRVNDQIIQVDGQSLEGYSNHQAVEVLRHTGQVVRLKLARYHKGAKYEQLQQYA 530          

HSP 6 Score: 86.2705 bits (212), Expect = 1.016e-12
Identity = 63/201 (31.34%), Postives = 100/201 (49.75%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFR--------------DKQP--LCEDS------LYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            ++LTK+ G  LG S++G      G   + + E+     AA DG+L   D+ILA++ + L  N +H  AI  L+     V+L + R              DK P  L  DS       + +++V  L     GLG  I+     GV +  ++ G +A+++GRL  GD +L+I D NVR    +QVA +L++   +V L+V R
Sbjct:  138 VQLTKEEGKSLGFSVVGLKSENRGELGIFVKEIQPGGIAAQDGQLQESDQILAIDKQPLANNISHQNAISILQKATGLVELVLARGPIPRSDHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVAR 338          

HSP 7 Score: 72.7886 bits (177), Expect = 1.356e-8
Identity = 53/205 (25.85%), Postives = 93/205 (45.37%), Query Frame = 2
Query: 6044 IELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------------------QPLCEDSL------YFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            +EL +D    LG+SI GG  + +G   V+I  +     A   G+L  GD I+++NG+     TH +A+Q L+     + L + + +                  QP  E+ +        ++K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD +  +N  ++   T ++   +LKR  G + L V
Sbjct: 2028 VELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQGTISLVVTQGEDVVLEVNGHSKVYELPSNQPEPEEDMPQEISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKGKIELTV 2232          

HSP 8 Score: 66.6254 bits (161), Expect = 1.028e-6
Identity = 56/216 (25.93%), Postives = 93/216 (43.06%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRG 5629
            + + +E D+QG  G+ +              I   + N  A   G+L +GD ++ IN     G++H     ++K+ Q     I L + +  D +++       VN      E   N  E   D  Q      + G   +  + LE+   G GF I+  + +      IYVK V   G AA +G L+ GD+I  +N E    V +E+  ++LKR +G
Sbjct: 2026 RTVELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQG---TISLVVTQGEDVVLE-------VNGHSKVYELPSNQPEPEEDMPQ-----EISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKG 2226          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A1S3KGN9 (multiple PDZ domain protein isoform X3 OS=Lingula unguis OX=7574 GN=LOC106181849 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.180e-98
Identity = 258/740 (34.86%), Postives = 385/740 (52.03%), Query Frame = 2
Query: 4379 NGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPA--SVNTSVAPCEKSENAVETSTDENQISSN--NNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRIT-ISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSN 6577
              W  PR V +ER+  QSLGISI+GGKV       E     + ++GIFI H+   SPA K GQL  GDR+L V+G++L   ++D A++ I+NA SP+ F IQS++D +   D +++  ++  + D     + PL    +   L+++    P      T     ++ TD+  +S    S      T         +   +   D +G +  +EI++ G  G+GL L GNKD S+M+ ++ G   + +A  DG++ IGDELL++N   + G SH N + IIK   +    I L + R  D L  +A  P   +V+T       +  +  +S  E+ ISS    +   + D+  V ++K     G  IM+ +   + GIY+K +T    A +EG L  GD+IL ++D+ +V   YD  ++ LR  +  +++ V +    S D A NI     P+ +D +  ++   IN  P        SP+   ER+ S                                Q  T   +  E V  +  P K               G ET +E+ K + GLGLSI+GGSDT++G ++IHEV+E  AAA DGRL AGD+IL V G+DLR+ATHD AIQ LR     V + ++RD   L E+ LY    +DLLKK  +GLGI+IV K +DVGV ISD+VKG +AE DGRL +GD +L +ND N+R+ TQD  AT+LK   G V L +GRL++ 
Sbjct: 1463 QAWGPPRTVYLERQPGQSLGISIVGGKVDLFHVSPE-----HTITGIFIKHVLEGSPAGKSGQLKTGDRILEVDGVELKDATHDQAVAAIRNANSPVKFVIQSIMDKAPPSDRESSSQNSTVIPD-----RSPLPHAVRKLHLQQEPHMSPLDESVLTIETPGESTTDQPHDSSDSESDDEFGYT--------YKKLQRKYGDLNGVLHLLEIER-GSNGLGLSLAGNKDRSTMSVFVVGIDKDGLAFQDGRIRIGDELLEVNGQVLYGRSHLNASAIIKG--ITHPIIKLVLLRREDFLEHVAVKPLDNAVSTEDVSINSTSPSSPSSNREDTISSRTEQDFSTFPDVTTVTIDKGPARLGLAIMEGSVEGQPGIYIKSITPGSPAEHEGHLAVGDQILAVDDQSLVAVSYDKAIEFLRSAQGTVKLTVSKPGDSSSDTASNI-----PVDEDSQAGLDVRQINVEP-------ASPL---EREQS--------------------------------QDTTTSDTGPEMVDPQTCPIKI--------------GQETWLEIEKGKSGLGLSIVGGSDTMIGAIIIHEVYEDGAAARDGRLTAGDQILEVCGQDLRDATHDNAIQVLRQTPPVVTMLVYRDDAQLREEDLYDIFTIDLLKKPGRGLGISIVGKRNDVGVYISDIVKGGVAEADGRLMQGDQILSVNDDNMRNATQDHAATVLKTIMGKVTLTIGRLKTG 2120          

HSP 2 Score: 146.747 bits (369), Expect = 4.684e-31
Identity = 70/149 (46.98%), Postives = 102/149 (68.46%), Query Frame = 2
Query:  530 NFCGNPLSGLSETTVDHSTDM-LNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI---PNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPV 964
            +  G P +  + TT+   +DM ++TEW ++E+++LLND  GLGF ++G KSTGVV+++I  G VA++NG L  GDH++ I D+NVRGM SEQVAA+LRQS  H+RL++AR +   P   +P       I+PT ++D+HL  L  TLL V
Sbjct:  229 DHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVARGVTEPPTAQNP----LAPIVPTHELDEHLQHLYATLLEV 373          

HSP 3 Score: 123.635 bits (309), Expect = 4.690e-24
Identity = 57/117 (48.72%), Postives = 86/117 (73.50%), Query Frame = 2
Query: 2156 IDKTIEDTIKSTWNKIIGGNYDILISYINKTNEG--LGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            + K +E+ +K+TW  ++G  Y+++++ ++K  EG  LGISLEGTVDV++  G E +PHH+IR+I  DGP+G +G  +SGDELLE NG+KL G+ + +V+  LK LP  V+I+ ARRK
Sbjct:  626 LSKEVEEALKATWQPMVGDEYEVVVAQLSKFREGGGLGISLEGTVDVEN--GHEVRPHHFIRSILPDGPVGANGKLESGDELLEVNGRKLLGLSHVDVVKILKELPQHVRIICARRK 740          

HSP 4 Score: 106.686 bits (265), Expect = 8.234e-19
Identity = 71/178 (39.89%), Postives = 104/178 (58.43%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            + KAKS+ ++ V        +P      +RSL+ L  +AMWS  P+++EL K  +GLGFSI  YQD  + +  VIVI SLVP GVA +DGR++PGDRL+F+NE+ ++  +  Q  ++AL+   KG V +G+AKP+ P      S   E V  + T        +T AE   IG++Y S
Sbjct:  776 LVKAKSEQTLNVTE------VPQLNKNKSRSLEPLTGLAMWSSEPVVIELVKGDRGLGFSILDYQDPLNPSETVIVIRSLVPGGVAQVDGRLVPGDRLMFVNEINLENATLDQ-AVQALKGAPKGVVQIGVAKPL-PVPDTSLSSQPEMVMSMPT--------YTEAE---IGASYES 934          

HSP 5 Score: 97.8265 bits (242), Expect = 3.778e-16
Identity = 48/101 (47.52%), Postives = 68/101 (67.33%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTA 1777
            +   L+KG QGLG+TIAGY+  +    + GIFVKS+++ S AD+ G+I +NDQII+++ QS+ G  N   VE+L+ T  +V+LK  RY KG  YE L Q A
Sbjct:  431 FEVELSKGSQGLGITIAGYVGDK-SAELSGIFVKSVAEGSAADVEGRIRVNDQIIQVDGQSLEGYSNHQAVEVLRHTGQVVRLKLARYHKGAKYEQLQQYA 530          

HSP 6 Score: 86.2705 bits (212), Expect = 1.003e-12
Identity = 63/201 (31.34%), Postives = 100/201 (49.75%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFR--------------DKQP--LCEDS------LYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            ++LTK+ G  LG S++G      G   + + E+     AA DG+L   D+ILA++ + L  N +H  AI  L+     V+L + R              DK P  L  DS       + +++V  L     GLG  I+     GV +  ++ G +A+++GRL  GD +L+I D NVR    +QVA +L++   +V L+V R
Sbjct:  138 VQLTKEEGKSLGFSVVGLKSENRGELGIFVKEIQPGGIAAQDGQLQESDQILAIDKQPLANNISHQNAISILQKATGLVELVLARGPIPRSDHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVAR 338          

HSP 7 Score: 72.7886 bits (177), Expect = 1.238e-8
Identity = 53/205 (25.85%), Postives = 93/205 (45.37%), Query Frame = 2
Query: 6044 IELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------------------QPLCEDSL------YFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            +EL +D    LG+SI GG  + +G   V+I  +     A   G+L  GD I+++NG+     TH +A+Q L+     + L + + +                  QP  E+ +        ++K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD +  +N  ++   T ++   +LKR  G + L V
Sbjct: 2176 VELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQGTISLVVTQGEDVVLEVNGHSKVYELPSNQPEPEEDMPQEISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKGKIELTV 2380          

HSP 8 Score: 66.6254 bits (161), Expect = 9.452e-7
Identity = 56/216 (25.93%), Postives = 93/216 (43.06%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRG 5629
            + + +E D+QG  G+ +              I   + N  A   G+L +GD ++ IN     G++H     ++K+ Q     I L + +  D +++       VN      E   N  E   D  Q      + G   +  + LE+   G GF I+  + +      IYVK V   G AA +G L+ GD+I  +N E    V +E+  ++LKR +G
Sbjct: 2174 RTVELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQG---TISLVVTQGEDVVLE-------VNGHSKVYELPSNQPEPEEDMPQ-----EISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKG 2374          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Match: A0A1S3KGP4 (multiple PDZ domain protein isoform X1 OS=Lingula unguis OX=7574 GN=LOC106181849 PE=4 SV=1)

HSP 1 Score: 368.237 bits (944), Expect = 1.254e-98
Identity = 258/740 (34.86%), Postives = 385/740 (52.03%), Query Frame = 2
Query: 4379 NGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPA--SVNTSVAPCEKSENAVETSTDENQISSN--NNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRIT-ISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSN 6577
              W  PR V +ER+  QSLGISI+GGKV       E     + ++GIFI H+   SPA K GQL  GDR+L V+G++L   ++D A++ I+NA SP+ F IQS++D +   D +++  ++  + D     + PL    +   L+++    P      T     ++ TD+  +S    S      T         +   +   D +G +  +EI++ G  G+GL L GNKD S+M+ ++ G   + +A  DG++ IGDELL++N   + G SH N + IIK   +    I L + R  D L  +A  P   +V+T       +  +  +S  E+ ISS    +   + D+  V ++K     G  IM+ +   + GIY+K +T    A +EG L  GD+IL ++D+ +V   YD  ++ LR  +  +++ V +    S D A NI     P+ +D +  ++   IN  P        SP+   ER+ S                                Q  T   +  E V  +  P K               G ET +E+ K + GLGLSI+GGSDT++G ++IHEV+E  AAA DGRL AGD+IL V G+DLR+ATHD AIQ LR     V + ++RD   L E+ LY    +DLLKK  +GLGI+IV K +DVGV ISD+VKG +AE DGRL +GD +L +ND N+R+ TQD  AT+LK   G V L +GRL++ 
Sbjct: 1508 QAWGPPRTVYLERQPGQSLGISIVGGKVDLFHVSPE-----HTITGIFIKHVLEGSPAGKSGQLKTGDRILEVDGVELKDATHDQAVAAIRNANSPVKFVIQSIMDKAPPSDRESSSQNSTVIPD-----RSPLPHAVRKLHLQQEPHMSPLDESVLTIETPGESTTDQPHDSSDSESDDEFGYT--------YKKLQRKYGDLNGVLHLLEIER-GSNGLGLSLAGNKDRSTMSVFVVGIDKDGLAFQDGRIRIGDELLEVNGQVLYGRSHLNASAIIKG--ITHPIIKLVLLRREDFLEHVAVKPLDNAVSTEDVSINSTSPSSPSSNREDTISSRTEQDFSTFPDVTTVTIDKGPARLGLAIMEGSVEGQPGIYIKSITPGSPAEHEGHLAVGDQILAVDDQSLVAVSYDKAIEFLRSAQGTVKLTVSKPGDSSSDTASNI-----PVDEDSQAGLDVRQINVEP-------ASPL---EREQS--------------------------------QDTTTSDTGPEMVDPQTCPIKI--------------GQETWLEIEKGKSGLGLSIVGGSDTMIGAIIIHEVYEDGAAARDGRLTAGDQILEVCGQDLRDATHDNAIQVLRQTPPVVTMLVYRDDAQLREEDLYDIFTIDLLKKPGRGLGISIVGKRNDVGVYISDIVKGGVAEADGRLMQGDQILSVNDDNMRNATQDHAATVLKTIMGKVTLTIGRLKTG 2165          

HSP 2 Score: 146.747 bits (369), Expect = 4.758e-31
Identity = 70/149 (46.98%), Postives = 102/149 (68.46%), Query Frame = 2
Query:  530 NFCGNPLSGLSETTVDHSTDM-LNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPI---PNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPV 964
            +  G P +  + TT+   +DM ++TEW ++E+++LLND  GLGF ++G KSTGVV+++I  G VA++NG L  GDH++ I D+NVRGM SEQVAA+LRQS  H+RL++AR +   P   +P       I+PT ++D+HL  L  TLL V
Sbjct:  229 DHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVARGVTEPPTAQNP----LAPIVPTHELDEHLQHLYATLLEV 373          

HSP 3 Score: 123.635 bits (309), Expect = 5.045e-24
Identity = 57/117 (48.72%), Postives = 86/117 (73.50%), Query Frame = 2
Query: 2156 IDKTIEDTIKSTWNKIIGGNYDILISYINKTNEG--LGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            + K +E+ +K+TW  ++G  Y+++++ ++K  EG  LGISLEGTVDV++  G E +PHH+IR+I  DGP+G +G  +SGDELLE NG+KL G+ + +V+  LK LP  V+I+ ARRK
Sbjct:  626 LSKEVEEALKATWQPMVGDEYEVVVAQLSKFREGGGLGISLEGTVDVEN--GHEVRPHHFIRSILPDGPVGANGKLESGDELLEVNGRKLLGLSHVDVVKILKELPQHVRIICARRK 740          

HSP 4 Score: 106.301 bits (264), Expect = 9.073e-19
Identity = 71/178 (39.89%), Postives = 104/178 (58.43%), Query Frame = 2
Query: 2783 MSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSG-PILVELTKESQGLGFSIEYYQDA-SSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNS 3310
            + KAKS+ ++ V        +P      +RSL+ L  +AMWS  P+++EL K  +GLGFSI  YQD  + +  VIVI SLVP GVA +DGR++PGDRL+F+NE+ ++  +  Q  ++AL+   KG V +G+AKP+ P      S   E V  + T        +T AE   IG++Y S
Sbjct:  776 LVKAKSEQTLNVTE------VPQLNKNKSRSLEPLTGLAMWSSEPVVIELVKGDRGLGFSILDYQDPLNPSETVIVIRSLVPGGVAQVDGRLVPGDRLMFVNEINLENATLDQ-AVQALKGAPKGVVQIGVAKPL-PVPDTSLSSQPEMVMSMPT--------YTEAE---IGASYES 934          

HSP 5 Score: 97.8265 bits (242), Expect = 3.762e-16
Identity = 48/101 (47.52%), Postives = 68/101 (67.33%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTA 1777
            +   L+KG QGLG+TIAGY+  +    + GIFVKS+++ S AD+ G+I +NDQII+++ QS+ G  N   VE+L+ T  +V+LK  RY KG  YE L Q A
Sbjct:  431 FEVELSKGSQGLGITIAGYVGDK-SAELSGIFVKSVAEGSAADVEGRIRVNDQIIQVDGQSLEGYSNHQAVEVLRHTGQVVRLKLARYHKGAKYEQLQQYA 530          

HSP 6 Score: 86.2705 bits (212), Expect = 1.007e-12
Identity = 63/201 (31.34%), Postives = 100/201 (49.75%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFR--------------DKQP--LCEDS------LYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            ++LTK+ G  LG S++G      G   + + E+     AA DG+L   D+ILA++ + L  N +H  AI  L+     V+L + R              DK P  L  DS       + +++V  L     GLG  I+     GV +  ++ G +A+++GRL  GD +L+I D NVR    +QVA +L++   +V L+V R
Sbjct:  138 VQLTKEEGKSLGFSVVGLKSENRGELGIFVKEIQPGGIAAQDGQLQESDQILAIDKQPLANNISHQNAISILQKATGLVELVLARGPIPRSDHSGPPSADKTPTTLGPDSDMVISTEWTQIEVIDLLNDGSGLGFGIIGGKSTGVVVKTILPGGVADKNGRLHSGDHILQIGDVNVRGMGSEQVAAVLRQSGSHVRLVVAR 338          

HSP 7 Score: 72.7886 bits (177), Expect = 1.241e-8
Identity = 53/205 (25.85%), Postives = 93/205 (45.37%), Query Frame = 2
Query: 6044 IELTKDR--GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------------------QPLCEDSL------YFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            +EL +D    LG+SI GG  + +G   V+I  +     A   G+L  GD I+++NG+     TH +A+Q L+     + L + + +                  QP  E+ +        ++K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD +  +N  ++   T ++   +LKR  G + L V
Sbjct: 2221 VELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQGTISLVVTQGEDVVLEVNGHSKVYELPSNQPEPEEDMPQEISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKGKIELTV 2425          

HSP 8 Score: 67.0106 bits (162), Expect = 8.712e-7
Identity = 56/216 (25.93%), Postives = 93/216 (43.06%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRG 5629
            + + +E D+QG  G+ +              I   + N  A   G+L +GD ++ IN     G++H     ++K+ Q     I L + +  D +++       VN      E   N  E   D  Q      + G   +  + LE+   G GF I+  + +      IYVK V   G AA +G L+ GD+I  +N E    V +E+  ++LKR +G
Sbjct: 2219 RTVELERDEQGSLGISIAGGIGSPIGDTPVLIANLQPNGPAQKTGKLKVGDHIMSINGQPTEGLTHHEAVQLLKQFQG---TISLVVTQGEDVVLE-------VNGHSKVYELPSNQPEPEEDMPQ-----EISGQQQVKTISLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFAKGAAAEDGRLKRGDQIQAVNGESLEGVTHEEAVAILKRAKG 2419          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000041966.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12875129:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000041966.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 5.931e-52
Identity = 105/213 (49.30%), Postives = 143/213 (67.14%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIYXXXXXXXXXXXXXXXXNC 6637
            P    IIPG ET I+++K R GLGLSI+GG DT+LG ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L +FRD+    E+ L+    V+L KK  + LG++IV  ++D GV +SD+VKG + E DGRL +GD +L +N  +VRS TQ+ VA LLK C G + + +GR ++  + S+   S      +  NC
Sbjct: 1536 PVTCPIIPGCETTIDISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFRDEGQYKEEELWDIFNVELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSERRMSQASQLSESGNC 1748          

HSP 2 Score: 158.688 bits (400), Expect = 3.924e-38
Identity = 124/439 (28.25%), Postives = 217/439 (49.43%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHE--QEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGH--KSSTDESGKVMN----IEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN----NLQGYGDIFHVHLEKSVQGFGFFIM-DCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            W+ PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA + G L  GDR++ V+G+DL   S+++A+  I+ A +P+ F +QS+++      +D+ +      S   S++  +EP  ++  +  L   +       D  T  +I    T                +  D +E E    G+  K   +  G +      IE++K G+ G+GL L GN+D S M+ ++ G   +  A  DG++++GDELL+IN   + G SH N + IIK       K+ +   R+ D L +MA         V P ++  + ++T T+    SS N    +L     + H+ L     G G  +  D N N   G+ V+ +  +G A  EG+++ GDR++ ++DE+++    + V+  L   K+++++ + R
Sbjct: 1080 WNQPRKVELYREAGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLVQSIINRPRTSATDSVEDRTASDSKPNSNKLNREPEKVSPTTSFLSLPVVPHVGETDTDTLTEIPDRIT----------------LPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEK-GRSGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSA---PSKVKIIFIRNTDALSQMA---------VGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHLAEDNNGN---GVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR 1480          

HSP 3 Score: 93.9745 bits (232), Expect = 1.953e-18
Identity = 63/200 (31.50%), Postives = 96/200 (48.00%), Query Frame = 2
Query: 6038 TVIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFK-------------------LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            T IEL K    GLG S++G  +   G   + + E+     A  DG+L  GD+IL +NG+ L +N TH QA+  L+     V++ + R   P     +  +                   ++   L     GLG  IV     GV +  ++ G IA+QDGRLK GD +L I +T++     DQVA +L++C   V L++ R
Sbjct:  103 THIELVKPVSGGLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRASEHVQIIVARGPVPQLSSPVVSRTPSAASTLSAHSSATHCTQVETIELVNDGSGLGFGIVGGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 4 Score: 90.1225 bits (222), Expect = 3.136e-17
Identity = 35/86 (40.70%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  599 TEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            T   ++E +EL+ND  GLGF ++G K+TGV++++I  G +A+++G L+ GDH++ I + ++ G+ S+QVA +LRQ  + ++L+I+R
Sbjct:  217 THCTQVETIELVNDGSGLGFGIVGGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 5 Score: 88.9669 bits (219), Expect = 7.032e-17
Identity = 47/98 (47.96%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQDASSNVP-VIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW   I  +EL K  QGLGFSI  YQD       VIVI SLVP GVA +DGR++PGDRL+++N   +++ +S +E ++AL+  + G V +G+AKP+
Sbjct:  650 LAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLES-ASLEEAVQALKGANLGTVSIGVAKPL 746          

HSP 6 Score: 74.7146 bits (182), Expect = 1.256e-12
Identity = 98/402 (24.38%), Postives = 163/402 (40.55%), Query Frame = 2
Query: 4487 FAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSV-QGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAK 5689
             AED N  +G+ +  I  + PA K G +  GDRL++V+   L+  S +  +S + +  S +  TI           +D+T + N         E E  SL   S+ML   +T P               ET+   +S   S+ +     P    I              G    I+I K G+ G+GL +VG  D       I    +   AA DG+L  GD++L++N ID+   +H     ++++     +++ LT+ R                                 DE Q           DIF+V L+K   Q  G  I+     ++ G++V  +   G+  ++G L +GD+IL +N E V +   +SV   L+ C   ++M +GR      H++
Sbjct: 1416 LAEDNN-GNGVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR---------ADSTPVLNASNQTCRDLEPETTSL---SNMLLFSVTPP---------------ETETIRSSSRSSTPATLVSDPVTCPIIP------------GCETTIDISK-GRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQT---PQRVRLTMFR---------------------------------DEGQYKEEE----LWDIFNVELQKKPGQSLGLSIV--GRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSE 1733          

HSP 7 Score: 74.3294 bits (181), Expect = 1.550e-12
Identity = 117/567 (20.63%), Postives = 226/567 (39.86%), Query Frame = 2
Query: 5024 QGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTI------------KRHPDNLVKM------ACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL----YFKLKVD---------------------------LLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRS 6574
            +G   +G+ +   KD   M   I         + DG+L +GD +L IN      ++++    ++++  +    + +T             K+  D L  +       C+           E+SE    T ++ NQ       +  G    + +   V G G      N     GI++K +  D  A   GTL+ GDRI+ ++   + +  ++  ++ +R   N +E +V          ++I   P+  + D   S+E    +   P       S  +N  R+   V P+ S    P+   +  +   +++ +      I  ++++     +E       T K+   +   +PGV  +IEL K R GLGLS+ G  D    +V +  +    AA  DGR+  GD +L +NG+ L   +H  A   ++S  ++VK+   R+   L + ++     F   +D                           +L     G+G+ +   ++    I   +K   A ++G ++ GD L+ ++D  +   + ++V +LL     +V L + R  S
Sbjct:  950 KGNSSLGMTVSAVKDGVGM--LIRSIIHGGSISRDGRLGVGDLILAINGEPAGNLTNAQARAMLRRHSLIGPDMGITYVPAEYLEEYRASKQAKDELFAVDASATPRCVAELPEREDGEGEESELQTATFSNWNQPRKVELYREAGKSLGISI---VGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLV----------QSIINRPRTSATD---SVEDRTASDSKP------NSNKLN--REPEKVSPTTSFLSLPVVPHVG-ETDTDTLTE------IPDRITLPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFIRNTDALSQMAVGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHLAEDNNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICRADS 1483          

HSP 8 Score: 71.633 bits (174), Expect = 1.137e-11
Identity = 39/103 (37.86%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 2192 WNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 2494
            W   +G + ++++  + K +E  GLGISLE +             HHYIR++  +GP+G  G   SGDELLE NG  L G  ++EV++ LK LP  V +   R
Sbjct:  502 WQNTLGPSNEVIVVQVEKFSESSGLGISLEAS-----------GGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPVCVCMTCCR 593          

HSP 9 Score: 69.3218 bits (168), Expect = 5.038e-11
Identity = 51/188 (27.13%), Postives = 86/188 (45.74%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR----------DKQPLCEDSLYF-------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  ++    AA   +L  GDRI+++ G       H QA+  L++    V+L++            D+ P    S  F       + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LK+  G + L V
Sbjct: 1791 LGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDLGPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1978          

HSP 10 Score: 67.3958 bits (163), Expect = 2.250e-10
Identity = 42/106 (39.62%), Postives = 58/106 (54.72%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY------TKGPVYEILTQT 1774
            +   LTK  QGLG+TIAGYI  +      GIFVKSI+  S  + +G+I + DQII ++   + G  N   VE+L+ T   V LK  R       T  PV  ++T+T
Sbjct:  334 FDVSLTKNAQGLGITIAGYIGDK-NSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTET 438          

HSP 11 Score: 66.6254 bits (161), Expect = 3.759e-10
Identity = 56/227 (24.67%), Postives = 101/227 (44.49%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITI 5671
            V +IE+ K    G+G  +VG  N++   +  ++   +  SVA  DG+L  GD++L IN   +   ++H     ++++    SE + + + R P                  P   S     T +  + +S++++      +  + L     G GF I+        G+ VK +   GIA  +G L+ GD IL I +  +     D V + LR C N +++V+ R T+
Sbjct:  102 VTHIELVKPVSGGLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRA---SEHVQIIVARGP-----------------VPQLSSPVVSRTPSAASTLSAHSSATHCTQVETIELVNDGSGLGFGIV---GGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISRATV 305          

HSP 12 Score: 64.3142 bits (155), Expect = 1.873e-9
Identity = 99/439 (22.55%), Postives = 173/439 (39.41%), Query Frame = 2
Query: 4976 SSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVN-TSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGF----FIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNI------ETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPP--DRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSV 6253
            SS     +V  IE+   G  G+G  +VG K   +    +       +A  DG+L  GD +L+I   D+ G+    VA ++++C                N VK+    A+V+ TS  P     + + T T++               F V L K+ QG G     +I D N+ + +GI+VK +T       +G +  GD+I+ ++               ++G  N   + V R T    H K +      E  P P+     E+        PP L + + +  +  D      +    S       ++ PP    ++N I+      SI ++  + E+    + P+  +              V  V + ++  GLG+S+    +   G   I  V  +      G+L++GD +L VNG  LR  TH + +  L+ +
Sbjct:  214 SSATHCTQVETIELVNDGS-GLGFGIVGGK---TTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQC---------------GNRVKLVISRATVDDTSTLP-----STLPTVTEQQGHEEEEEEH---GAFDVSLTKNAQGLGITIAGYIGDKNS-EPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDG------------LDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTET-------KPPILSLDSTLERVAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIK-----LSIEEEEELTEKWQNTLGPSNEVI-------------VVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKEL 583          

HSP 13 Score: 63.929 bits (154), Expect = 2.451e-9
Identity = 90/450 (20.00%), Postives = 185/450 (41.11%), Query Frame = 2
Query: 4427 QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATS------------------PIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKK-GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKS---ENAVETSTD--------------ENQISSNNNLQGYG--------DIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGC 5632
            Q LGI+I G           +  D N   SGIF+  I   S  E+ G++++GD++++V+G+D+   +   A+  +++                     P+V  +       +  DS   +++       ++  +E L++++           PP +P++    K++                        + E E +    +++   S +V+ ++++K  +  G+G+ L    + S  + YI            G+L  GDELL++N I + G +H  V  I+K+               P  +    C PA +  + +   +S   + A+ET+ +              E ++  +   +  G        +I ++ LEK  QG GF I+D  +  D A   I ++ +  +G+A  +G L  GDR++ +N+  + +   +  ++ L+G 
Sbjct:  343 QGLGITIAG-----------YIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTETKPPILSLDSTLERVA------MDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLS------------------------IEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKEL--------------PVCVCMTCCRPAPLPPTDSQAGQSGLEDVAIETTENVLGEVEDFLVSGESEKRVRDHVTKETAGAPLAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGA 733          

HSP 14 Score: 57.7658 bits (138), Expect = 1.925e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA DGRL  GD+I+AVNG+ L   TH++A+  L+     + L + 
Sbjct: 1906 GLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTVL 1979          

HSP 15 Score: 57.3806 bits (137), Expect = 2.540e-7
Identity = 30/85 (35.29%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  647 GLGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINV-RGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSP 880
            GLGFS++G ++      G+ ++ I +GSVA  +G L+ GD ++ I+   + + +T +Q   +L+++S+H+++I+AR P+P  SSP
Sbjct:  114 GLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRASEHVQIIVARGPVPQLSSP 198          

HSP 16 Score: 55.8398 bits (133), Expect = 7.576e-7
Identity = 24/84 (28.57%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            V L  +  GLG ++ G      S+ +G+ ++SI +GS  E++G + +GD ++ +D ++++G T++Q   +LR +   + L + R
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR 419          

HSP 17 Score: 54.299 bits (129), Expect = 2.148e-6
Identity = 39/122 (31.97%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 2171 EDTIKSTWNKII---GGNYDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            ED    TW K++   G    +L +  + K   GLG+SL G  D         +   ++  I   G  G DG    GDELLE NG+ L+G  +Q   + +KS P++V+I+  R  +  +SQ++
Sbjct: 1251 EDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRD-------RSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFIRNTDA-LSQMA 1364          

HSP 18 Score: 53.9138 bits (128), Expect = 2.742e-6
Identity = 30/84 (35.71%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSI---IGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR 6283
            + LTK+ +GLG++I   IG  ++    + +  +    A   DGR+  GD+I+AV+G D++  T+ QA++ LR  G  V LK+ R
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR 419          

HSP 19 Score: 52.7582 bits (125), Expect = 6.462e-6
Identity = 50/231 (21.65%), Postives = 95/231 (41.13%), Query Frame = 2
Query: 4958 IRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC--NANDEAGIYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            IR  H+S   +   +  +E+ K     +G+ + G        +  +I       +AA   +L +GD ++ I      GM+HS    ++K                    V++  +      +  P +++     +S   + +       G      + LE+ + G GF I+    + + +  IYVK V   G AA +G L+ GD+I+ +N    E V +E+   +LK+ +G
Sbjct: 1767 IRRSHESLEQD---IRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTT---------------GTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDL-------GPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKG 1972          

HSP 20 Score: 52.373 bits (124), Expect = 7.775e-6
Identity = 60/265 (22.64%), Postives = 113/265 (42.64%), Query Frame = 2
Query: 4931 TPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVH--LEKSVQ----------GFGFFIMDCNAN--DEAGIYVKKVTVDGIAANEGTLREGDRILLI---NDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
            TP    +   R+  +   +E   + N+E+ K+  + +GL +VG ++ + +  ++       V   DG+LM GD++L +N  DV   +  +VA ++K C       +  IK     L +    P      ++   +   +      +   S + +LQG  +I   H  LE+ ++            G  I     +   +  I++  +   G+AA    LR GDRI+ I   + E + +    S+LK   G    L++V G  T++
Sbjct: 1619 TPQRVRLTMFRDEGQYKEEELWDIFNVELQKKPGQSLGLSIVGRRNDTGV--FVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCC-------VGPIKME---LGRFKAGPFHSERRMSQASQLSESGNCKITQQSFSGSGSLQGDFEIRRSHESLEQDIRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQ-LQVVAGDTTVT 1870          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000037958.1 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12879031:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000037958.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 6.122e-52
Identity = 105/213 (49.30%), Postives = 143/213 (67.14%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIYXXXXXXXXXXXXXXXXNC 6637
            P    IIPG ET I+++K R GLGLSI+GG DT+LG ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L +FRD+    E+ L+    V+L KK  + LG++IV  ++D GV +SD+VKG + E DGRL +GD +L +N  +VRS TQ+ VA LLK C G + + +GR ++  + S+   S      +  NC
Sbjct: 1550 PVTCPIIPGCETTIDISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFRDEGQYKEEELWDIFNVELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSERRMSQASQLSESGNC 1762          

HSP 2 Score: 158.688 bits (400), Expect = 4.547e-38
Identity = 124/439 (28.25%), Postives = 217/439 (49.43%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHE--QEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGH--KSSTDESGKVMN----IEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN----NLQGYGDIFHVHLEKSVQGFGFFIM-DCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            W+ PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA + G L  GDR++ V+G+DL   S+++A+  I+ A +P+ F +QS+++      +D+ +      S   S++  +EP  ++  +  L   +       D  T  +I    T                +  D +E E    G+  K   +  G +      IE++K G+ G+GL L GN+D S M+ ++ G   +  A  DG++++GDELL+IN   + G SH N + IIK       K+ +   R+ D L +MA         V P ++  + ++T T+    SS N    +L     + H+ L     G G  +  D N N   G+ V+ +  +G A  EG+++ GDR++ ++DE+++    + V+  L   K+++++ + R
Sbjct: 1094 WNQPRKVELYREAGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLVQSIINRPRTSATDSVEDRTASDSKPNSNKLNREPEKVSPTTSFLSLPVVPHVGETDTDTLTEIPDRIT----------------LPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEK-GRSGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSA---PSKVKIIFIRNTDALSQMA---------VGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHLAEDNNGN---GVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR 1494          

HSP 3 Score: 93.9745 bits (232), Expect = 1.829e-18
Identity = 63/200 (31.50%), Postives = 96/200 (48.00%), Query Frame = 2
Query: 6038 TVIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFK-------------------LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            T IEL K    GLG S++G  +   G   + + E+     A  DG+L  GD+IL +NG+ L +N TH QA+  L+     V++ + R   P     +  +                   ++   L     GLG  IV     GV +  ++ G IA+QDGRLK GD +L I +T++     DQVA +L++C   V L++ R
Sbjct:  103 THIELVKPVSGGLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRASEHVQIIVARGPVPQLSSPVVSRTPSAASTLSAHSSATHCTQVETIELVNDGSGLGFGIVGGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 4 Score: 89.7373 bits (221), Expect = 3.221e-17
Identity = 35/86 (40.70%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  599 TEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            T   ++E +EL+ND  GLGF ++G K+TGV++++I  G +A+++G L+ GDH++ I + ++ G+ S+QVA +LRQ  + ++L+I+R
Sbjct:  217 THCTQVETIELVNDGSGLGFGIVGGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 5 Score: 88.5817 bits (218), Expect = 7.224e-17
Identity = 47/98 (47.96%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQDASSNVP-VIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW   I  +EL K  QGLGFSI  YQD       VIVI SLVP GVA +DGR++PGDRL+++N   +++ +S +E ++AL+  + G V +G+AKP+
Sbjct:  650 LAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLES-ASLEEAVQALKGANLGTVSIGVAKPL 746          

HSP 6 Score: 74.7146 bits (182), Expect = 1.206e-12
Identity = 98/402 (24.38%), Postives = 163/402 (40.55%), Query Frame = 2
Query: 4487 FAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSV-QGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAK 5689
             AED N  +G+ +  I  + PA K G +  GDRL++V+   L+  S +  +S + +  S +  TI           +D+T + N         E E  SL   S+ML   +T P               ET+   +S   S+ +     P    I              G    I+I K G+ G+GL +VG  D       I    +   AA DG+L  GD++L++N ID+   +H     ++++     +++ LT+ R                                 DE Q           DIF+V L+K   Q  G  I+     ++ G++V  +   G+  ++G L +GD+IL +N E V +   +SV   L+ C   ++M +GR      H++
Sbjct: 1430 LAEDNN-GNGVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR---------ADSTPVLNASNQTCRDLEPETTSL---SNMLLFSVTPP---------------ETETIRSSSRSSTPATLVSDPVTCPIIP------------GCETTIDISK-GRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQT---PQRVRLTMFR---------------------------------DEGQYKEEE----LWDIFNVELQKKPGQSLGLSIV--GRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSE 1747          

HSP 7 Score: 72.7886 bits (177), Expect = 5.619e-12
Identity = 91/411 (22.14%), Postives = 172/411 (41.85%), Query Frame = 2
Query: 5438 VQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL----YFKLKVD---------------------------LLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRS 6574
            V G G      N     GI++K +  D  A   GTL+ GDRI+ ++   + +  ++  ++ +R   N +E +V          ++I   P+  + D   S+E    +   P       S  +N  R+   V P+ S    P+   +  +   +++ +      I  ++++     +E       T K+   +   +PGV  +IEL K R GLGLS+ G  D    +V +  +    AA  DGR+  GD +L +NG+ L   +H  A   ++S  ++VK+   R+   L + ++     F   +D                           +L     G+G+ +   ++    I   +K   A ++G ++ GD L+ ++D  +   + ++V +LL     +V L + R  S
Sbjct: 1115 VGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLV----------QSIINRPRTSATD---SVEDRTASDSKP------NSNKLN--REPEKVSPTTSFLSLPVVPHVG-ETDTDTLTE------IPDRITLPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFIRNTDALSQMAVGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHLAEDNNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICRADS 1497          

HSP 8 Score: 71.633 bits (174), Expect = 1.168e-11
Identity = 39/103 (37.86%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 2192 WNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 2494
            W   +G + ++++  + K +E  GLGISLE +             HHYIR++  +GP+G  G   SGDELLE NG  L G  ++EV++ LK LP  V +   R
Sbjct:  502 WQNTLGPSNEVIVVQVEKFSESSGLGISLEAS-----------GGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPVCVCMTCCR 593          

HSP 9 Score: 69.707 bits (169), Expect = 5.002e-11
Identity = 51/188 (27.13%), Postives = 86/188 (45.74%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR----------DKQPLCEDSLYF-------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  ++    AA   +L  GDRI+++ G       H QA+  L++    V+L++            D+ P    S  F       + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LK+  G + L V
Sbjct: 1805 LGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDLGPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1992          

HSP 10 Score: 67.3958 bits (163), Expect = 2.253e-10
Identity = 42/106 (39.62%), Postives = 58/106 (54.72%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY------TKGPVYEILTQT 1774
            +   LTK  QGLG+TIAGYI  +      GIFVKSI+  S  + +G+I + DQII ++   + G  N   VE+L+ T   V LK  R       T  PV  ++T+T
Sbjct:  334 FDVSLTKNAQGLGITIAGYIGDK-NSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTET 438          

HSP 11 Score: 66.6254 bits (161), Expect = 3.892e-10
Identity = 56/227 (24.67%), Postives = 101/227 (44.49%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITI 5671
            V +IE+ K    G+G  +VG  N++   +  ++   +  SVA  DG+L  GD++L IN   +   ++H     ++++    SE + + + R P                  P   S     T +  + +S++++      +  + L     G GF I+        G+ VK +   GIA  +G L+ GD IL I +  +     D V + LR C N +++V+ R T+
Sbjct:  102 VTHIELVKPVSGGLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRA---SEHVQIIVARGP-----------------VPQLSSPVVSRTPSAASTLSAHSSATHCTQVETIELVNDGSGLGFGIV---GGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISRATV 305          

HSP 12 Score: 64.3142 bits (155), Expect = 2.091e-9
Identity = 99/439 (22.55%), Postives = 173/439 (39.41%), Query Frame = 2
Query: 4976 SSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVN-TSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGF----FIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNI------ETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPP--DRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSV 6253
            SS     +V  IE+   G  G+G  +VG K   +    +       +A  DG+L  GD +L+I   D+ G+    VA ++++C                N VK+    A+V+ TS  P     + + T T++               F V L K+ QG G     +I D N+ + +GI+VK +T       +G +  GD+I+ ++               ++G  N   + V R T    H K +      E  P P+     E+        PP L + + +  +  D      +    S       ++ PP    ++N I+      SI ++  + E+    + P+  +              V  V + ++  GLG+S+    +   G   I  V  +      G+L++GD +L VNG  LR  TH + +  L+ +
Sbjct:  214 SSATHCTQVETIELVNDGS-GLGFGIVGGK---TTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQC---------------GNRVKLVISRATVDDTSTLP-----STLPTVTEQQGHEEEEEEH---GAFDVSLTKNAQGLGITIAGYIGDKNS-EPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDG------------LDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTET-------KPPILSLDSTLERVAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIK-----LSIEEEEELTEKWQNTLGPSNEVI-------------VVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKEL 583          

HSP 13 Score: 63.929 bits (154), Expect = 2.559e-9
Identity = 90/450 (20.00%), Postives = 185/450 (41.11%), Query Frame = 2
Query: 4427 QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATS------------------PIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKK-GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKS---ENAVETSTD--------------ENQISSNNNLQGYG--------DIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGC 5632
            Q LGI+I G           +  D N   SGIF+  I   S  E+ G++++GD++++V+G+D+   +   A+  +++                     P+V  +       +  DS   +++       ++  +E L++++           PP +P++    K++                        + E E +    +++   S +V+ ++++K  +  G+G+ L    + S  + YI            G+L  GDELL++N I + G +H  V  I+K+               P  +    C PA +  + +   +S   + A+ET+ +              E ++  +   +  G        +I ++ LEK  QG GF I+D  +  D A   I ++ +  +G+A  +G L  GDR++ +N+  + +   +  ++ L+G 
Sbjct:  343 QGLGITIAG-----------YIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTETKPPILSLDSTLERVA------MDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLS------------------------IEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKEL--------------PVCVCMTCCRPAPLPPTDSQAGQSGLEDVAIETTENVLGEVEDFLVSGESEKRVRDHVTKETAGAPLAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGA 733          

HSP 14 Score: 57.7658 bits (138), Expect = 1.698e-7
Identity = 30/88 (34.09%), Postives = 52/88 (59.09%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKI 6277
            +EL ++ G  LG+SI+GG        +  ++  + I  + E   A  +G L  GDRI+ V+G DLR+A+H++A++ +R  GN V+  +
Sbjct: 1100 VELYREAGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLV 1187          

HSP 15 Score: 57.7658 bits (138), Expect = 1.878e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA DGRL  GD+I+AVNG+ L   TH++A+  L+     + L + 
Sbjct: 1920 GLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTVL 1993          

HSP 16 Score: 57.3806 bits (137), Expect = 2.542e-7
Identity = 30/85 (35.29%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  647 GLGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINV-RGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSP 880
            GLGFS++G ++      G+ ++ I +GSVA  +G L+ GD ++ I+   + + +T +Q   +L+++S+H+++I+AR P+P  SSP
Sbjct:  114 GLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRASEHVQIIVARGPVPQLSSP 198          

HSP 17 Score: 55.8398 bits (133), Expect = 7.519e-7
Identity = 24/84 (28.57%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            V L  +  GLG ++ G      S+ +G+ ++SI +GS  E++G + +GD ++ +D ++++G T++Q   +LR +   + L + R
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR 419          

HSP 18 Score: 54.299 bits (129), Expect = 2.224e-6
Identity = 39/122 (31.97%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 2171 EDTIKSTWNKII---GGNYDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            ED    TW K++   G    +L +  + K   GLG+SL G  D         +   ++  I   G  G DG    GDELLE NG+ L+G  +Q   + +KS P++V+I+  R  +  +SQ++
Sbjct: 1265 EDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRD-------RSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFIRNTDA-LSQMA 1378          

HSP 19 Score: 53.9138 bits (128), Expect = 2.631e-6
Identity = 30/84 (35.71%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSI---IGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR 6283
            + LTK+ +GLG++I   IG  ++    + +  +    A   DGR+  GD+I+AV+G D++  T+ QA++ LR  G  V LK+ R
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR 419          

HSP 20 Score: 52.7582 bits (125), Expect = 6.802e-6
Identity = 50/231 (21.65%), Postives = 95/231 (41.13%), Query Frame = 2
Query: 4958 IRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC--NANDEAGIYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            IR  H+S   +   +  +E+ K     +G+ + G        +  +I       +AA   +L +GD ++ I      GM+HS    ++K                    V++  +      +  P +++     +S   + +       G      + LE+ + G GF I+    + + +  IYVK V   G AA +G L+ GD+I+ +N    E V +E+   +LK+ +G
Sbjct: 1781 IRRSHESLEQD---IRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTT---------------GTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDL-------GPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKG 1986          

HSP 21 Score: 52.373 bits (124), Expect = 7.587e-6
Identity = 60/265 (22.64%), Postives = 113/265 (42.64%), Query Frame = 2
Query: 4931 TPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVH--LEKSVQ----------GFGFFIMDCNAN--DEAGIYVKKVTVDGIAANEGTLREGDRILLI---NDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
            TP    +   R+  +   +E   + N+E+ K+  + +GL +VG ++ + +  ++       V   DG+LM GD++L +N  DV   +  +VA ++K C       +  IK     L +    P      ++   +   +      +   S + +LQG  +I   H  LE+ ++            G  I     +   +  I++  +   G+AA    LR GDRI+ I   + E + +    S+LK   G    L++V G  T++
Sbjct: 1633 TPQRVRLTMFRDEGQYKEEELWDIFNVELQKKPGQSLGLSIVGRRNDTGV--FVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCC-------VGPIKME---LGRFKAGPFHSERRMSQASQLSESGNCKITQQSFSGSGSLQGDFEIRRSHESLEQDIRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQ-LQVVAGDTTVT 1884          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: ENSAMXT00000021866.2 (pep primary_assembly:Astyanax_mexicanus-2.0:21:12814175:12879031:-1 gene:ENSAMXG00000021159.2 transcript:ENSAMXT00000021866.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 204.142 bits (518), Expect = 6.562e-52
Identity = 105/213 (49.30%), Postives = 143/213 (67.14%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIYXXXXXXXXXXXXXXXXNC 6637
            P    IIPG ET I+++K R GLGLSI+GG DT+LG ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR ATHD+AI  LR    RV+L +FRD+    E+ L+    V+L KK  + LG++IV  ++D GV +SD+VKG + E DGRL +GD +L +N  +VRS TQ+ VA LLK C G + + +GR ++  + S+   S      +  NC
Sbjct: 1433 PVTCPIIPGCETTIDISKGRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQTPQRVRLTMFRDEGQYKEEELWDIFNVELQKKPGQSLGLSIVGRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSERRMSQASQLSESGNC 1645          

HSP 2 Score: 158.688 bits (400), Expect = 3.897e-38
Identity = 124/439 (28.25%), Postives = 217/439 (49.43%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHE--QEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGH--KSSTDESGKVMN----IEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNN----NLQGYGDIFHVHLEKSVQGFGFFIM-DCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            W+ PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA + G L  GDR++ V+G+DL   S+++A+  I+ A +P+ F +QS+++      +D+ +      S   S++  +EP  ++  +  L   +       D  T  +I    T                +  D +E E    G+  K   +  G +      IE++K G+ G+GL L GN+D S M+ ++ G   +  A  DG++++GDELL+IN   + G SH N + IIK       K+ +   R+ D L +MA         V P ++  + ++T T+    SS N    +L     + H+ L     G G  +  D N N   G+ V+ +  +G A  EG+++ GDR++ ++DE+++    + V+  L   K+++++ + R
Sbjct:  977 WNQPRKVELYREAGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLVQSIINRPRTSATDSVEDRTASDSKPNSNKLNREPEKVSPTTSFLSLPVVPHVGETDTDTLTEIPDRIT----------------LPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEK-GRSGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSA---PSKVKIIFIRNTDALSQMA---------VGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHLAEDNNGN---GVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR 1377          

HSP 3 Score: 93.9745 bits (232), Expect = 1.991e-18
Identity = 63/200 (31.50%), Postives = 96/200 (48.00%), Query Frame = 2
Query: 6038 TVIELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFK-------------------LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            T IEL K    GLG S++G  +   G   + + E+     A  DG+L  GD+IL +NG+ L +N TH QA+  L+     V++ + R   P     +  +                   ++   L     GLG  IV     GV +  ++ G IA+QDGRLK GD +L I +T++     DQVA +L++C   V L++ R
Sbjct:  103 THIELVKPVSGGLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRASEHVQIIVARGPVPQLSSPVVSRTPSAASTLSAHSSATHCTQVETIELVNDGSGLGFGIVGGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 4 Score: 89.7373 bits (221), Expect = 3.422e-17
Identity = 35/86 (40.70%), Postives = 64/86 (74.42%), Query Frame = 2
Query:  599 TEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            T   ++E +EL+ND  GLGF ++G K+TGV++++I  G +A+++G L+ GDH++ I + ++ G+ S+QVA +LRQ  + ++L+I+R
Sbjct:  217 THCTQVETIELVNDGSGLGFGIVGGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISR 302          

HSP 5 Score: 88.5817 bits (218), Expect = 7.176e-17
Identity = 47/98 (47.96%), Postives = 67/98 (68.37%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQDASSNVP-VIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW   I  +EL K  QGLGFSI  YQD       VIVI SLVP GVA +DGR++PGDRL+++N   +++ +S +E ++AL+  + G V +G+AKP+
Sbjct:  650 LAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLES-ASLEEAVQALKGANLGTVSIGVAKPL 746          

HSP 6 Score: 74.7146 bits (182), Expect = 1.363e-12
Identity = 98/402 (24.38%), Postives = 163/402 (40.55%), Query Frame = 2
Query: 4487 FAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSV-QGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAK 5689
             AED N  +G+ +  I  + PA K G +  GDRL++V+   L+  S +  +S + +  S +  TI           +D+T + N         E E  SL   S+ML   +T P               ET+   +S   S+ +     P    I              G    I+I K G+ G+GL +VG  D       I    +   AA DG+L  GD++L++N ID+   +H     ++++     +++ LT+ R                                 DE Q           DIF+V L+K   Q  G  I+     ++ G++V  +   G+  ++G L +GD+IL +N E V +   +SV   L+ C   ++M +GR      H++
Sbjct: 1313 LAEDNN-GNGVIVQSIK-EGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICR---------ADSTPVLNASNQTCRDLEPETTSL---SNMLLFSVTPP---------------ETETIRSSSRSSTPATLVSDPVTCPIIP------------GCETTIDISK-GRTGLGLSIVGGCDTLLGAIIIHEVYEEGAAAKDGRLWAGDQILEVNGIDLRMATHDEAINVLRQT---PQRVRLTMFR---------------------------------DEGQYKEEE----LWDIFNVELQKKPGQSLGLSIV--GRRNDTGVFVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCCVGPIKMELGRFKAGPFHSE 1630          

HSP 7 Score: 72.4034 bits (176), Expect = 6.043e-12
Identity = 91/411 (22.14%), Postives = 172/411 (41.85%), Query Frame = 2
Query: 5438 VQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL----YFKLKVD---------------------------LLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRS 6574
            V G G      N     GI++K +  D  A   GTL+ GDRI+ ++   + +  ++  ++ +R   N +E +V          ++I   P+  + D   S+E    +   P       S  +N  R+   V P+ S    P+   +  +   +++ +      I  ++++     +E       T K+   +   +PGV  +IEL K R GLGLS+ G  D    +V +  +    AA  DGR+  GD +L +NG+ L   +H  A   ++S  ++VK+   R+   L + ++     F   +D                           +L     G+G+ +   ++    I   +K   A ++G ++ GD L+ ++D  +   + ++V +LL     +V L + R  S
Sbjct:  998 VGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLV----------QSIINRPRTSATD---SVEDRTASDSKP------NSNKLN--REPEKVSPTTSFLSLPVVPHVG-ETDTDTLTE------IPDRITLPHDSTEEEEDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRDRSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFIRNTDALSQMAVGPMKEFGDTIDTQTEPETCSSLNLPLPDLDMSKCVQHIILPVEESGVGLHLAEDNNGNGVIVQSIKEGPALKEGSIQPGDRLMAVDDEMLLGLSAEKVMSLLNSGKSSVKLTICRADS 1380          

HSP 8 Score: 71.2478 bits (173), Expect = 1.299e-11
Identity = 39/103 (37.86%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 2192 WNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 2494
            W   +G + ++++  + K +E  GLGISLE +             HHYIR++  +GP+G  G   SGDELLE NG  L G  ++EV++ LK LP  V +   R
Sbjct:  502 WQNTLGPSNEVIVVQVEKFSESSGLGISLEAS-----------GGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKELPVCVCMTCCR 593          

HSP 9 Score: 70.8626 bits (172), Expect = 1.897e-11
Identity = 130/660 (19.70%), Postives = 261/660 (39.55%), Query Frame = 2
Query: 4427 QSLGISILGGKVANVKEKEEFAEDTNL-VSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATS------------------PIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKK-GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKS---ENAVETSTD--------------ENQISSNNNLQGYG--------DIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQE--VPPTKTLTQKEHPTKAQIIPG--VETVIELTK-DRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLR 6247
            Q LGI+I G           +  D N   SGIF+  I   S  E+ G++++GD++++V+G+D+   +   A+  +++                     P+V  +       +  DS   +++       ++  +E L++++           PP +P++    K++                        + E E +    +++   S +V+ ++++K  +  G+G+ L    + S  + YI            G+L  GDELL++N I + G +H  V  I+K+               P  +    C PA +  + +   +S   + A+ET+ +              E ++  +   +  G        +I ++ LEK  QG GF I+D  +  D A   I ++ +  +G+A  +G L  GDR++ +N+  + +   +  ++ L+G            T+S   AK +  +   +     ++ + H  N               +D  + S +                      ++     +  +T ++++     QE   P  K + + + P    + PG   E  I + K +  LG+++    D +   ++I  +    + + DGRL  GD ILA+NG+   N T+ QA   LR
Sbjct:  343 QGLGITIAG-----------YIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTETKPPILSLDSTLERVA------MDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIKLS------------------------IEEEEELTEKWQNTLGPSNEVIVVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKEL--------------PVCVCMTCCRPAPLPPTDSQAGQSGLEDVAIETTENVLGEVEDFLVSGESEKRVRDHVTKETAGAPLAMWESEIQNIELEKGEQGLGFSILDYQDPVDPAKTVIVIRSLVPEGVAEMDGRLLPGDRLMYVNNTNLESASLEEAVQALKGANLG--------TVSIGVAKPLPIDSNDVDLSDEKAFDRHFNNEE-------------DDTFQSSMI----------------------ALHGSTCSADLTYQMNMQASTPQEEDFPMVKPVEEPDQP---DMTPGSNFERTITVVKGNSSLGMTVSAVKDGV--GMLIRSIIHGGSISRDGRLGVGDLILAINGEPAGNLTNAQARAMLR 895          

HSP 10 Score: 69.3218 bits (168), Expect = 5.709e-11
Identity = 51/188 (27.13%), Postives = 86/188 (45.74%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR----------DKQPLCEDSLYF-------KLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  + LG V   I  ++    AA   +L  GDRI+++ G       H QA+  L++    V+L++            D+ P    S  F       + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N  ++   T ++   +LK+  G + L V
Sbjct: 1688 LGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDLGPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTV 1875          

HSP 11 Score: 67.3958 bits (163), Expect = 2.426e-10
Identity = 42/106 (39.62%), Postives = 58/106 (54.72%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRY------TKGPVYEILTQT 1774
            +   LTK  QGLG+TIAGYI  +      GIFVKSI+  S  + +G+I + DQII ++   + G  N   VE+L+ T   V LK  R       T  PV  ++T+T
Sbjct:  334 FDVSLTKNAQGLGITIAGYIGDK-NSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTET 438          

HSP 12 Score: 66.6254 bits (161), Expect = 4.052e-10
Identity = 56/227 (24.67%), Postives = 101/227 (44.49%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVG--NKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITI 5671
            V +IE+ K    G+G  +VG  N++   +  ++   +  SVA  DG+L  GD++L IN   +   ++H     ++++    SE + + + R P                  P   S     T +  + +S++++      +  + L     G GF I+        G+ VK +   GIA  +G L+ GD IL I +  +     D V + LR C N +++V+ R T+
Sbjct:  102 VTHIELVKPVSGGLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRA---SEHVQIIVARGP-----------------VPQLSSPVVSRTPSAASTLSAHSSATHCTQVETIELVNDGSGLGFGIV---GGKTTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQCGNRVKLVISRATV 305          

HSP 13 Score: 64.3142 bits (155), Expect = 1.969e-9
Identity = 99/439 (22.55%), Postives = 173/439 (39.41%), Query Frame = 2
Query: 4976 SSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVN-TSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGF----FIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNI------ETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPP--DRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSV 6253
            SS     +V  IE+   G  G+G  +VG K   +    +       +A  DG+L  GD +L+I   D+ G+    VA ++++C                N VK+    A+V+ TS  P     + + T T++               F V L K+ QG G     +I D N+ + +GI+VK +T       +G +  GD+I+ ++               ++G  N   + V R T    H K +      E  P P+     E+        PP L + + +  +  D      +    S       ++ PP    ++N I+      SI ++  + E+    + P+  +              V  V + ++  GLG+S+    +   G   I  V  +      G+L++GD +L VNG  LR  TH + +  L+ +
Sbjct:  214 SSATHCTQVETIELVNDGS-GLGFGIVGGK---TTGVIVKTILPGGIADQDGRLKSGDHILRIGETDLYGLGSDQVAQVLRQC---------------GNRVKLVISRATVDDTSTLP-----STLPTVTEQQGHEEEEEEH---GAFDVSLTKNAQGLGITIAGYIGDKNS-EPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDG------------LDIQGFTNQQAVEVLRHTGQTVHLKLVRRGFMPEETPPPVVCVVTET-------KPPILSLDSTLERVAMDTSHEEKLNVDTSETSRNTATAAPPCTPEQKNGIK-----LSIEEEEELTEKWQNTLGPSNEVI-------------VVQVEKFSESSGLGISL----EASGGHHYIRSVLPEGPVGRSGKLYSGDELLEVNGISLRGETHKEVVSILKEL 583          

HSP 14 Score: 57.7658 bits (138), Expect = 1.976e-7
Identity = 30/88 (34.09%), Postives = 52/88 (59.09%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKI 6277
            +EL ++ G  LG+SI+GG        +  ++  + I  + E   A  +G L  GDRI+ V+G DLR+A+H++A++ +R  GN V+  +
Sbjct:  983 VELYREAGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGRNGTLKTGDRIVEVDGVDLRDASHEEAVEAIRKAGNPVEFLV 1070          

HSP 15 Score: 57.3806 bits (137), Expect = 2.186e-7
Identity = 31/74 (41.89%), Postives = 44/74 (59.46%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA DGRL  GD+I+AVNG+ L   TH++A+  L+     + L + 
Sbjct: 1803 GLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKGTITLTVL 1876          

HSP 16 Score: 57.3806 bits (137), Expect = 2.500e-7
Identity = 30/85 (35.29%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  647 GLGFSLMGSKST-----GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINV-RGMTSEQVAAILRQSSDHIRLIIAR-PIPNCSSP 880
            GLGFS++G ++      G+ ++ I +GSVA  +G L+ GD ++ I+   + + +T +Q   +L+++S+H+++I+AR P+P  SSP
Sbjct:  114 GLGFSVVGLRNENQGELGIFVQEIQTGSVAHCDGKLKEGDQILVINGQPLDQNITHQQAVTLLQRASEHVQIIVARGPVPQLSSP 198          

HSP 17 Score: 55.8398 bits (133), Expect = 7.912e-7
Identity = 24/84 (28.57%), Postives = 50/84 (59.52%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            V L  +  GLG ++ G      S+ +G+ ++SI +GS  E++G + +GD ++ +D ++++G T++Q   +LR +   + L + R
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR 419          

HSP 18 Score: 54.299 bits (129), Expect = 2.283e-6
Identity = 39/122 (31.97%), Postives = 61/122 (50.00%), Query Frame = 2
Query: 2171 EDTIKSTWNKII---GGNYDIL-ISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLS 2524
            ED    TW K++   G    +L +  + K   GLG+SL G  D         +   ++  I   G  G DG    GDELLE NG+ L+G  +Q   + +KS P++V+I+  R  +  +SQ++
Sbjct: 1148 EDEFGYTWKKVVERYGSLPGVLHMIELEKGRSGLGLSLAGNRD-------RSRMSVFVVGIDPSGAAGRDGRIVVGDELLEINGQILYGRSHQNASSIIKSAPSKVKIIFIRNTDA-LSQMA 1261          

HSP 19 Score: 53.9138 bits (128), Expect = 3.012e-6
Identity = 30/84 (35.71%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSI---IGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR 6283
            + LTK+ +GLG++I   IG  ++    + +  +    A   DGR+  GD+I+AV+G D++  T+ QA++ LR  G  V LK+ R
Sbjct:  336 VSLTKNAQGLGITIAGYIGDKNSEPSGIFVKSITTGSAVEQDGRIHVGDQIIAVDGLDIQGFTNQQAVEVLRHTGQTVHLKLVR 419          

HSP 20 Score: 52.373 bits (124), Expect = 7.162e-6
Identity = 50/231 (21.65%), Postives = 95/231 (41.13%), Query Frame = 2
Query: 4958 IRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGN--KDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC--NANDEAGIYVKKVTVDGIAANEGTLREGDRILLIND---ELVVNEDYDSVLKRLRG 5629
            IR  H+S   +   +  +E+ K     +G+ + G        +  +I       +AA   +L +GD ++ I      GM+HS    ++K                    V++  +      +  P +++     +S   + +       G      + LE+ + G GF I+    + + +  IYVK V   G AA +G L+ GD+I+ +N    E V +E+   +LK+ +G
Sbjct: 1664 IRRSHESLEQD---IRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTT---------------GTVQLQVVAGDTTVTGPPPDQTPGLTTSSIFHDDL-------GPPQCKTISLERGLDGLGFSIVGGFGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIVAVNGQSLEGVTHEEAVGILKKTKG 1869          

HSP 21 Score: 52.373 bits (124), Expect = 7.856e-6
Identity = 60/265 (22.64%), Postives = 113/265 (42.64%), Query Frame = 2
Query: 4931 TPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVH--LEKSVQ----------GFGFFIMDCNAN--DEAGIYVKKVTVDGIAANEGTLREGDRILLI---NDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
            TP    +   R+  +   +E   + N+E+ K+  + +GL +VG ++ + +  ++       V   DG+LM GD++L +N  DV   +  +VA ++K C       +  IK     L +    P      ++   +   +      +   S + +LQG  +I   H  LE+ ++            G  I     +   +  I++  +   G+AA    LR GDRI+ I   + E + +    S+LK   G    L++V G  T++
Sbjct: 1516 TPQRVRLTMFRDEGQYKEEELWDIFNVELQKKPGQSLGLSIVGRRNDTGV--FVSDIVKGGVVESDGRLMQGDQILSVNGEDVRSATQESVAALLKCC-------VGPIKME---LGRFKAGPFHSERRMSQASQLSESGNCKITQQSFSGSGSLQGDFEIRRSHESLEQDIRTVELCKGPSDSLGISIAGGVGSPLGDVPIFIAMMNPAGLAAQTQKLRVGDRIISICGTSTEGMAHSQAVSLLKNTTGTVQ-LQVVAGDTTVT 1767          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: patj (PATJ crumbs cell polarity complex component [Source:ZFIN;Acc:ZDB-GENE-030616-129])

HSP 1 Score: 199.519 bits (506), Expect = 1.429e-50
Identity = 134/389 (34.45%), Postives = 205/389 (52.70%), Query Frame = 2
Query: 5405 GDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR--ITISQDHAKNIETEPQPISKDR-----RESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVN-EQVIQEVPPTKTLTQKEH----PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLK 6529
            G++  V LEK  QG G  +          I+V  +T  G A+ +G +R GD +L IN++++    + +    ++   + +++V+ R    I+Q     + ++   +S +      R   ++H +  P     P    P+ N E+ +       S  K P            S+ K L N       SV+    I   PP+ T    E+    P    I+PG ETVIE++K R GLGLSI+GG DT L  ++IHEV+E+ AAA DGRLWAGD+IL VNG DLR+  H+ AI  LR    +V+L + RD+    ++       V+L KKS +GLG++IV K +  GV ISD+VKG  A+ DGRL +GD +L ++  ++R  +Q+ VA +LK
Sbjct: 1134 GELMLVELEKDRQGLGLSLAGNRDRSCMSIFVVGITPGGPASRDGRIRVGDELLEINNQVLYGRSHQNASAIIKSAASKVKLVLLRNEDAINQMAVAPVASQSSFLSSNEVQYHFRIPPDFHSVKEPSTEASPVTAEPLENKEKSLLEGE---SASKTP------------SLPKSLRNSGKLPAASVDVPAPIVSAPPSSTSPDFEYCSKDPATCPIVPGQETVIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPAKVRLTVLRDEAQYRDEENLDVFTVELQKKSGRGLGLSIVGKRNGTGVFISDVVKGGAADVDGRLMQGDQILSVDGDDMRQASQETVAAVLK 1507          

HSP 2 Score: 95.5153 bits (236), Expect = 6.459e-19
Identity = 40/92 (43.48%), Postives = 64/92 (69.57%), Query Frame = 2
Query:  581 STDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            S  + + +W  +E +EL+ND  GLGF ++G K+TGVV+R++   SVA+++G LR GDH++ I D   +G+TSEQV  +L+     +R++IAR
Sbjct:  228 SGSIQSEQWGHVEEIELINDGSGLGFGIVGGKATGVVVRTLVPNSVADKDGRLRTGDHILRIGDTPTQGLTSEQVVQVLQACGTRVRMLIAR 319          

HSP 3 Score: 93.2041 bits (230), Expect = 2.843e-18
Identity = 62/179 (34.64%), Postives = 94/179 (52.51%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRD--KQP-------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            GLG S++G     +G   V I +V     AA DGRL   D+ILA+NG  L ++ T  QAI  L+   +RV+L + RD   +P       +  +      +++L+     GLG  IV     GV +  LV  S+A++DGRL+ GD +L I DT  +  T +QV  +L+ C   V +++ R
Sbjct:  142 GLGFSVVGLRPDGVGAHGVFIKQVQPGGVAARDGRLQENDQILAINGIPLDQSVTQQQAIAFLQQQRDRVELVVARDTASKPNFPPSGSIQSEQWGHVEEIELINDG-SGLGFGIVGGKATGVVVRTLVPNSVADKDGRLRTGDHILRIGDTPTQGLTSEQVVQVLQACGTRVRMLIAR 319          

HSP 4 Score: 93.2041 bits (230), Expect = 2.965e-18
Identity = 56/146 (38.36%), Postives = 84/146 (57.53%), Query Frame = 2
Query: 4274 ENQINGQNENRNSFINLTV-----LQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGK--VANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSL 4690
            EN+ +  NEN  S + LT      L  ++  +  ++ I  + W  PR V V  +  +SLGISI+GG+  +  +K  EE         GIFI  + PDSPA +   L  GD++L V+G+DL   ++++A+  IK ATSP+VFT+QSL
Sbjct:  944 ENEADPDNENEISELTLTYTDTDDLPEREDGEGEETPI-FSHWGPPRRVEVWLDPGESLGISIVGGRTVIKRLKNGEEL-------KGIFIKQVLPDSPAGRTRALKTGDKILQVSGVDLQNANHEEAVQAIKTATSPVVFTVQSL 1081          

HSP 5 Score: 84.3445 bits (207), Expect = 1.361e-15
Identity = 46/98 (46.94%), Postives = 65/98 (66.33%), Query Frame = 2
Query: 2894 VAMWSGPI-LVELTKESQGLGFSIEYYQDASSNV-PVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +A+WS  + ++EL K  QGLGFSI  YQD   N   VIVI SLVP GVA   G ++PGD+L+F+N+  +D+ +  Q  +E L++   G+V LGI KP+
Sbjct:  704 LALWSQEVQVLELEKGEQGLGFSILDYQDPLDNARSVIVIRSLVPGGVAESHGGLLPGDQLVFVNDTHLDSCTLTQ-AVEVLKAAPAGKVYLGIKKPL 800          

HSP 6 Score: 77.411 bits (189), Expect = 1.750e-13
Identity = 62/215 (28.84%), Postives = 96/215 (44.65%), Query Frame = 2
Query: 6044 IELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSL----------------------------------YFKLKVDLLKKSRKGLGITIVSKS------DVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            IEL  D  GLG  I+GG  T    V++  +     A  DGRL  GD IL +     +  T +Q +Q L++ G RV++ I RD  PL E                                     Y   +V+L KK  + LGI+IV+++       +G+ +  +V GS AEQ G +   D ++ +N  N++ FT  +V  ++K+    V L + R
Sbjct:  242 IELINDGSGLGFGIVGGKAT---GVVVRTLVPNSVADKDGRLRTGDHILRIGDTPTQGLTSEQVVQVLQACGTRVRMLIARD--PLVEAQAPPLPPPAPAAAPVTSLPPPPIPARRTSRTANLEGYEIHEVNLKKKEGQSLGISIVARNTSTSEDGMGIFVKSVVPGSAAEQSGNIMVNDRIIAMNGVNLQGFTTQEVLDVMKQTGQTVHLTLVR 451          

HSP 7 Score: 62.003 bits (149), Expect = 9.532e-9
Identity = 34/74 (45.95%), Postives = 46/74 (62.16%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            GLG SI+GG  +  G + I+   V  K AAA+DGRL  GD+IL+VNG+ L  ATH+QA+  L+     V L + 
Sbjct: 1664 GLGFSIVGGFGSPHGDLPIYVKTVFSKGAAAVDGRLKRGDQILSVNGESLEGATHEQAVAILKKQRGVVTLSVL 1737          

HSP 8 Score: 60.077 bits (144), Expect = 3.512e-8
Identity = 40/162 (24.69%), Postives = 76/162 (46.91%), Query Frame = 2
Query: 2054 RLAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTI---EDTIKSTWNKIIGGNYDILI----------SYINKTNEGLGI-SLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARR 2497
            R + E   + DV  A ++      +  +  +   + K +   E  +++ W + +G  YD+++          + + K ++ L I ++   V++D   G     HHYI T+  +GP+   G  +  DELLE NG +L+G   +E +  L+ +P    +V  RR
Sbjct:  478 RRSAEIKVRADVQTAPVMEPMDPALTGIKQQSGRVRKNVPLTELELRTKWEQALGPQYDVMVVELDPVIEDDAELQKYSKLLPIHTMRLGVELDSFDG-----HHYISTVAPEGPVANHGLLRPEDELLEVNGVQLYGKSRREAVAFLREVPPPFTLVCCRR 634          

HSP 9 Score: 59.6918 bits (143), Expect = 4.190e-8
Identity = 48/187 (25.67%), Postives = 79/187 (42.25%), Query Frame = 2
Query: 6086 GGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD----------------------KQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            GG  + LG   + I  +     AA   RL  GDRI+++N + L   TH + +  L++    + L++  D                       +    +    K K   L+K  +GLG +IV        D+ + +  +     A  DGRLK+GD +L +N  ++   T +Q   +LK+  G V L V
Sbjct: 1550 GGKGSPLGDIPIFIAMIQANGVAARTHRLKVGDRIVSINAQSLDGLTHGEVVNMLKNAYGSIILQVIADTNISAIASQVESMSSSSALSTNTETQTTEPETPKPKSITLEKGTEGLGFSIVGGFGSPHGDLPIYVKTVFSKGAAAVDGRLKRGDQILSVNGESLEGATHEQAVAILKKQRGVVTLSV 1736          

HSP 10 Score: 59.3066 bits (142), Expect = 6.328e-8
Identity = 76/323 (23.53%), Postives = 144/323 (44.58%), Query Frame = 2
Query: 2219 DILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLSRSSSTMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLDQMQEIFTHHPGFRS---GSFLCHTDTAAKYHPKADNKIIYEDSYRYPIMSKAKSDNSIFVKSNSFSEMLPIKTLTANRS---LQYL-KDVAMWSGPI------LVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSK 3148
            ++++  + K  +GLG+SL G  D   ++        ++  IT  GP   DG  + GDELLE N + L+G  +Q     +KS  ++V++V  R ++  ++Q++ +                            ++    + S +++Q  F   P F S    S      TA     K  + +  E + + P + K+   NS  + + S     PI +   + +    +Y  KD A  + PI      ++E++K   GLG SI   +D  + +  IVI  +   G A  DGR+  GD+++ +N V++ +++ +  +    Q+ +K
Sbjct: 1135 ELMLVELEKDRQGLGLSLAGNRDRSCMS-------IFVVGITPGGPASRDGRIRVGDELLEINNQVLYGRSHQNASAIIKSAASKVKLVLLRNEDA-INQMAVAP---------------------------VASQSSFLSSNEVQYHFRIPPDFHSVKEPSTEASPVTAEPLENKEKSLLEGESASKTPSLPKSLR-NSGKLPAASVDVPAPIVSAPPSSTSPDFEYCSKDPA--TCPIVPGQETVIEISKGRSGLGLSIVGGKD--TQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPAK 1417          

HSP 11 Score: 57.7658 bits (138), Expect = 1.722e-7
Identity = 26/82 (31.71%), Postives = 46/82 (56.10%), Query Frame = 2
Query:  620 IVELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            ++E+   R GLG S++G K T    +VI  ++    A R+G L  GD ++ ++ +++R +  E   A LRQ+   +RL + R
Sbjct: 1343 VIEISKGRSGLGLSIVGGKDTQLDAIVIHEVYEEGAAARDGRLWAGDQILEVNGVDLRSVAHEDAIAALRQTPAKVRLTVLR 1424          

HSP 12 Score: 56.9954 bits (136), Expect = 3.291e-7
Identity = 28/86 (32.56%), Postives = 51/86 (59.30%), Query Frame = 2
Query:  608 AELEIVELLNDRCGLGFSLMGSKS---TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
             EL +VEL  DR GLG SL G++      + +  I  G  A R+G +R+GD L+ I++  + G + +  +AI++ ++  ++L++ R
Sbjct: 1134 GELMLVELEKDRQGLGLSLAGNRDRSCMSIFVVGITPGGPASRDGRIRVGDELLEINNQVLYGRSHQNASAIIKSAASKVKLVLLR 1219          

HSP 13 Score: 56.9954 bits (136), Expect = 3.403e-7
Identity = 58/209 (27.75%), Postives = 90/209 (43.06%), Query Frame = 2
Query: 4982 TDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVN-------TSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKS-VQGFGFFIMDCN---ANDEAGIYVKKVTVDGIAANEGTLREGDRILLIN 5575
            +++ G V  IE+   G  G+G  +VG K   +    +     NSVA  DG+L  GD +L+I      G++   V  +++ C     ++ + I R P  LV+    P           TS+ P               + S   NL+GY +I  V+L+K   Q  G  I+  N   + D  GI+VK V     A   G +   DRI+ +N
Sbjct:  233 SEQWGHVEEIELINDGS-GLGFGIVGGK---ATGVVVRTLVPNSVADKDGRLRTGDHILRIGDTPTQGLTSEQVVQVLQAC---GTRVRMLIARDP--LVEAQAPPLPPPAPAAAPVTSLPP---------PPIPARRTSRTANLEGY-EIHEVNLKKKEGQSLGISIVARNTSTSEDGMGIFVKSVVPGSAAEQSGNIMVNDRIIAMN 422          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Match: lnx2a (ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-GENE-060228-2])

HSP 1 Score: 93.9745 bits (232), Expect = 9.498e-19
Identity = 60/179 (33.52%), Postives = 100/179 (55.87%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ-----------PLCEDSLYFKLKVDLLKK-SRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            LG+SI+GG++T L  ++I EV+     A DGRL AGD+IL VN  D+ N  H  A  TL      ++L + R+++           P   +     +++ L K+ S + LGI +V ++D  GV + DL+ G +A +DGRL+  D +L +N+ ++R  T +Q A +++     V L++ R
Sbjct:  236 LGISIVGGNETPLINIVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNMPHSFARSTLGRPCATLQLTVLRERRCTARPPAVAPTPSSPEGSPASMRITLHKRESTEQLGIKLVRRTDEAGVFVLDLLDGGLAAKDGRLRSNDRVLAVNEHDLRHGTPEQAAQIIQASGERVNLLISR 414          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004677.1 (pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 gene:ENSPMAG00000004260.1 transcript:ENSPMAT00000004677.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 1.133e-37
Identity = 78/158 (49.37%), Postives = 108/158 (68.35%), Query Frame = 2
Query: 6107 GTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCED--SLYFKLKVDLLKKSRKGLGITIV-SKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            G +MIHEV+E+ AAA DGRLWAGD+IL VNG DLR+ATH+ AI  LR+    V+L ++RD+     D  S      V+LLKK+ +GLG++IV  KS  GV +S++V G  AE DGRL +GD +L ++  +VRS +Q+ VA +LK   G V + VGR++
Sbjct:    2 GAIMIHEVYEEGAAAKDGRLWAGDQILKVNGTDLRSATHEDAINALRASPQLVRLYVYRDEARYRGDDESALHVFTVELLKKAGRGLGLSIVGKKSGNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRMK 159          

HSP 2 Score: 54.6842 bits (130), Expect = 2.638e-8
Identity = 42/117 (35.90%), Postives = 60/117 (51.28%), Query Frame = 2
Query: 6044 IELTKD--RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSD 6388
            +EL K   RGLGLSI+G        V + EV    AA  DGRL  GD+IL+V+G+D+R+A+ +     L+     VK+++ R             +KV  L  SR+    + VS SD
Sbjct:   78 VELLKKAGRGLGLSIVGKKSG--NGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGR-------------MKVGSLLSSRRTSDTSQVSPSD 179          

HSP 3 Score: 51.9878 bits (123), Expect = 1.891e-7
Identity = 31/108 (28.70%), Postives = 55/108 (50.93%), Query Frame = 2
Query: 1427 RTKHRIRINEQNEFHEYTT-YLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKG 1747
            R + R R ++++  H +T   L K  +GLGL+I G      + + +G+FV  +     A+ +G++   DQI+ ++ + V       V  ILK   G+VK++  R   G
Sbjct:   60 RDEARYRGDDESALHVFTVELLKKAGRGLGLSIVG------KKSGNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGRMKVG 161          

HSP 4 Score: 51.6026 bits (122), Expect = 2.609e-7
Identity = 30/80 (37.50%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  623 VELLNDRC-GLGFSLMGSKS-TGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            VELL     GLG S++G KS  GV +  +  G  AE +G L  GD ++ +D  +VR  + E VAAIL+ +   +++ + R
Sbjct:   78 VELLKKAGRGLGLSIVGKKSGNGVFVSEVVHGGAAEADGRLTQGDQILSVDGEDVRSASQETVAAILKCAQGVVKMEVGR 157          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005746.1 (pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 gene:ENSPMAG00000005206.1 transcript:ENSPMAT00000005746.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 3.733e-15
Identity = 40/120 (33.33%), Postives = 69/120 (57.50%), Query Frame = 2
Query:  578 HSTDMLNTEWA----ELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIA-----RPIPNCSSPEYCGSMSIIP 910
            H T+   TE      + E +EL+    G+GF ++G+++TG+++++I  G VA+R+G L  GD ++ I D++VRG  SE+V +ILRQ    + L++A       +P   SP    +   +P
Sbjct:  179 HDTETPPTEVGGGLEQTESIELVTTGSGMGFGIVGNRATGIIVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLVAHGEPGEQLPATPSPALAQTPPYLP 298          

HSP 2 Score: 74.3294 bits (181), Expect = 9.536e-14
Identity = 52/173 (30.06%), Postives = 87/173 (50.29%), Query Frame = 2
Query: 6065 GLGLSIIG-GSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFR----DKQPLCE--DSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            GLG S++G  S      + I  +H         RL  GD+ILA+NG  L    + +QA++ L++    V+L + R     + P  E    L     ++L+     G+G  IV     G+ +  ++ G +A++DGRL  GD +L I D +VR    ++V ++L++C   V L+V
Sbjct:  102 GLGFSVMGVRSKNGHNGIFIKAIHADSIVGRWARLQEGDQILAINGMPLDERVSQEQAVRLLQTTTGPVQLVVARFSHDTETPPTEVGGGLEQTESIELVTTG-SGMGFGIVGNRATGIIVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLV 273          

HSP 3 Score: 51.2174 bits (121), Expect = 1.763e-6
Identity = 61/272 (22.43%), Postives = 104/272 (38.24%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMN-CYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDE 5812
            V  +++DK    G+G  ++G +  +  N  +I     +S+     +L  GD++L IN +           P+ ++   E    +L     P   V++     S +T   P E      +T +                   + L  +  G GF I+    N   GI VK +   G+A  +G L  GDRIL I D  V  +  + V+  LR C + + ++V        H +  E  P                 SP   Q P  + P++++E
Sbjct:   90 VHFVDLDKPEGVGLGFSVMGVRSKNGHNGIFIKAIHADSIVGRWARLQEGDQILAINGM-----------PLDERVSQEQAVRLLQTTTGP---VQLVVARFSHDTETPPTEVGGGLEQTES-------------------IELVTTGSGMGFGIV---GNRATGIIVKTILPGGVADRDGRLCTGDRILSIGDMDVRGKGSEEVISILRQCGSRVHLLVA-------HGEPGEQLPA--------------TPSPALAQTPPYLPPVVDEE 304          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002205.1 (pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 gene:ENSPMAG00000001988.1 transcript:ENSPMAT00000002205.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 1.429e-11
Identity = 57/213 (26.76%), Postives = 91/213 (42.72%), Query Frame = 2
Query: 6065 GLGLSIIGGSDTI--LGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSV--GNRVKLKIFRDKQ---PLCEDSLYFK--------------------------LKVDLLKKSRKGLGITIV------SKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRC-------SGNVFLMVGR 6565
            GLG S+      +  LG V I  +  + AA  DGRL AGDR++ VNG D+ + + DQ +  LR V  G+ V L + R      P  +++   K                          L++ L +    GLG+++          D+G+ +  ++ G  A +DGRL+ GD L+ +N   +   +       L+RC        G + L V R
Sbjct:  396 GLGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGSSVDLLVSRHDALLTPPAQEARLVKQMHPDQQAERSGGMIVTASGPCECLNLEIALSECGPAGLGVSVKGNRSRDGAHDLGIYVKSIIAGGAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRCMATDGSERGRIHLAVAR 608          

HSP 2 Score: 63.929 bits (154), Expect = 2.921e-10
Identity = 62/235 (26.38%), Postives = 102/235 (43.40%), Query Frame = 2
Query: 4988 ESGKVMNIEIDKQGKKGMGLLLVGNKDCSSM--NCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHL-EKSVQGFGFFIMDCNANDEA---GIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITIS 5674
             SG+   +++ K G +G+G  L       S   + YI        A  DG+L  GD L+ +N +DV  MS   V  I++     S  + L + RH D L+      A +   + P +++E +       +      NL+       + L E    G G  +    + D A   GIYVK +   G AA +G LR GD+++ +N E ++     + ++ LR C        GRI ++
Sbjct:  381 HSGRRFRVQLQK-GPEGLGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQVVSILRGVHPGS-SVDLLVSRH-DALLTPPAQEARLVKQMHPDQQAERSGGMIVTASGPCECLNLE-------IALSECGPAGLGVSVKGNRSRDGAHDLGIYVKSIIAGGAAAKDGRLRIGDQLVAVNREPLLGRSNAAAMETLRRCMATDGSERGRIHLA 605          

HSP 3 Score: 53.9138 bits (128), Expect = 4.155e-7
Identity = 29/77 (37.66%), Postives = 44/77 (57.14%), Query Frame = 2
Query: 2921 VELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKG 3151
            V+L K  +GLGFS+       S +  + I  ++P G A  DGR+  GDRLI +N V+V ++S  Q V+  L+ +  G
Sbjct:  388 VQLQKGPEGLGFSLTSRDTPVSGLGHVYIKHILPRGAAIADGRLHAGDRLIMVNGVDVSSMSQDQ-VVSILRGVHPG 463          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009934.1 (pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene:ENSPMAG00000008984.1 transcript:ENSPMAT00000009934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 5.725e-11
Identity = 53/183 (28.96%), Postives = 84/183 (45.90%), Query Frame = 2
Query: 6032 VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGL-GITI---VSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRL 6568
            VE  +E     GLG ++  G++   G   I EV E  A   DGRL AGDR++AVNG ++   T+ +A+  LRS    V L + R  + L        L   +L+   KG+ G+++   +      V +  +  GS A  +G L  GD +  +N  +V   T  +    +    G + +   RL
Sbjct:  370 VELTLEKGPGEGLGFTVTRGTED--GAAYIREVVEGPALR-DGRLRAGDRLIAVNGVEVAEMTYPRAVAMLRSTPQSVTLVVGRALKNLGVPPPAHTLPTIVLQPKEKGVAGLSLCGGIGSPHQAVLVGGVDAGSAAASEGSLAPGDRVHYVNGVSVLGMTLAEAQHTISSADGEILVKATRL 549          

HSP 2 Score: 54.299 bits (129), Expect = 3.996e-7
Identity = 25/82 (30.49%), Postives = 47/82 (57.32%), Query Frame = 2
Query:  647 GLGFSLMGSKSTG--------VVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPN 868
            GLGFS MG    G        V ++ +F G  A+ +  +  GD ++ ++ I ++G++ + V ++LR +SD + L++ RP P+
Sbjct:  100 GLGFSFMGDTDPGSPEAVRTVVRVKRLFPGQPADASARILPGDVILRVNGIPLKGLSHQAVLSVLRGTSDDVSLLLCRPEPS 181          

HSP 3 Score: 50.8322 bits (120), Expect = 3.904e-6
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 2
Query:  647 GLGFSLM-GSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSP 880
            GLGF++  G++     IR +  G  A R+G LR GD L+ ++ + V  MT  +  A+LR +   + L++ R + N   P
Sbjct:  381 GLGFTVTRGTEDGAAYIREVVEGP-ALRDGRLRAGDRLIAVNGVEVAEMTYPRAVAMLRSTPQSVTLVVGRALKNLGVP 458          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005799.1 (pep scaffold:Pmarinus_7.0:GL476764:271684:300503:1 gene:ENSPMAG00000005215.1 transcript:ENSPMAT00000005799.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 2.457e-10
Identity = 31/93 (33.33%), Postives = 55/93 (59.14%), Query Frame = 2
Query: 1487 LTKGEQGLGLTIAGY-ITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEI 1762
            + KG++GLGL+I G  +     +   GIF+K+I++   A  +G+I +NDQI+E++  S++G+       +LK T G+V+ +  R   G   E+
Sbjct:  530 MEKGDEGLGLSIIGMGVGADAGLEKLGIFIKTITEGGAAHRDGRIQVNDQIVEVDGISLVGVTQTFAATVLKNTQGVVRFRIGRERPGQESEV 622          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO33706 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRG3])

HSP 1 Score: 98.5969 bits (244), Expect = 2.428e-20
Identity = 42/91 (46.15%), Postives = 64/91 (70.33%), Query Frame = 2
Query:  596 NTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPN 868
             T W ++E ++L ND  GLGF ++G +S+GV I++I  G VA+++G L+  D +M I D+NV GM SEQVA +LR +  H+RL+I+R + N
Sbjct:  290 GTHWRQIETIDLHNDGTGLGFGIIGGRSSGVSIKTILPGGVADKDGRLQEHDQIMQIGDVNVGGMGSEQVAQVLRDAGSHVRLVISRLVEN 380          

HSP 2 Score: 94.7449 bits (234), Expect = 4.431e-19
Identity = 131/610 (21.48%), Postives = 239/610 (39.18%), Query Frame = 2
Query: 4997 KVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMP-TVISPIINDERKMSAVRPSISHDKEPIYS----SIPPD---RKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTK-DRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------------------QPLCEDS----------------------------LYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAE-----QDGRLKKGDLLLEINDTNV-------------------------RSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            ++  I I +Q    +G+ L G++D S   C +         A+DG++ +GD ++ +N   ++G+S      +++K  ++ + ++                  S++   A   +   A  T  D   + + + L+    +  +  E  V G G  I         G++V+ V  +   A  G L+ GD+IL ++   + N  ++  ++ +R  ++ +  VV          + I+ +  P+S D         + SP   + P T I+   + E           H   PI +    S P D   R   S+++   ++  T + +V+     E+P  +    +E   K   + G   ++ L+K + GLGLSI GG    +  + I +V     A  DGR+   D IL VN   +R  +H QA   L++ G  V+L + R +                  +P  + S                            +  K   D LK+S    G   VS +     +++L  G + E     +DGRL+KGD L+ ++D  +                         R +  DQ+   L+R +G V L V RL+
Sbjct: 1115 RMQTITIRRQMVGKLGVSLKGDEDGS--GCVVTSVMRGGAIAIDGRIGVGDHIVAVNDESLIGLSRHAARAVLRKQSLQKDIVV------------------SIDKQEASTREDSPAFLTPFDVPFVETESGLR----VVELRREPEV-GLGISIAGNKRGQRQGVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVV----------RTIQDKEDPLSLD--------TMGSPSSFEGPVTTINARTSHEPSQPITARDDLHKDIPISAKNLDSPPRDSSSRDFPSLEQAAPHKEQTIEANVSAPDHSEMPSYEDRI-RELQAKYPDVTGEHLLVSLSKGNTGLGLSIAGGKGVAVNRIFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAAEYLSRTRQQASPHSTEPDIKPSNIQTTESTPSISPRGVEVAAGPRRTPPPVAPKPSTDSLKRSSPQAGSVTVSPT----LLAELSGGQLVEYIDFVKDGRLRKGDQLIAVDDQAIVGLSHAEGTIVIHEVYEDGAAAKDGRLWAGDQI---LERTTGRVLLNVARLK 1673          

HSP 3 Score: 91.2781 bits (225), Expect = 4.300e-18
Identity = 106/455 (23.30%), Postives = 185/455 (40.66%), Query Frame = 2
Query: 4397 RVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVD------VSMMKDSDATKLSNCQLSDYESHE-QEPLSLNSKSDMLK------KKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEI----EAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIK-----------KCQMESEKIMLTIKR----------HPDNL-------------VKMACIPASVNTSVAPCEKSENAVETSTDENQIS---------SNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNA-----NDEAGIYVKKVTVDGIAANEGTLREGDRIL 5566
            RVV + RE    LGISI G K    +             G+ + H+  +S   + G+L  GD++L V+G DL   S+++A+  I+ A SP+ F ++++ D      +  M    + +     ++   SHE  +P++  ++ D+ K      K L +PP          +      E+       ++      PD SE+    + IR       D +G+ + + + K G  G+GL + G K  +    +I   K    A  DG++   DE+L++N   V GMSH   + ++K           + +  +E +  T ++           P N+             V++A  P      VAP   +++   +S     ++         S   L  Y D   V   +  +G     +D  A     + E  I + +V  DG AA +G L  GD+IL
Sbjct: 1228 RVVELRREPEVGLGISIAGNKRGQRQ-------------GVHVRHVLENSSVARLGELKAGDQILEVDGHDLRNASHEEAVEVIRRARSPVRFVVRTIQDKEDPLSLDTMGSPSSFEGPVTTINARTSHEPSQPIT--ARDDLHKDIPISAKNLDSPPRDSSSRDFPSL------EQAAPHKEQTIEANVSAPDHSEMPSYEDRIRELQAKYPDVTGEHLLVSLSK-GNTGLGLSIAGGKGVAVNRIFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAAEYLSRTRQQASPHSTEPDIKPSNIQTTESTPSISPRGVEVAAGPRRTPPPVAPKPSTDSLKRSSPQAGSVTVSPTLLAELSGGQLVEYIDF--VKDGRLRKGDQLIAVDDQAIVGLSHAEGTIVIHEVYEDGAAAKDGRLWAGDQIL 1658          

HSP 4 Score: 82.8037 bits (203), Expect = 1.530e-15
Identity = 52/125 (41.60%), Postives = 77/125 (61.60%), Query Frame = 2
Query: 2861 TANRSLQYLKDVAMWSGPI-LVELTKESQGLGFSIEYYQDASS-NVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM-FPSSYMYRSYSKETV 3226
            +++R  + + D +MWS  I  VEL K  +GLGFSI  YQD S+    VIVI SLV  GVA  DG + PGDRL+ +NEV ++  +S    ++ L+  ++G V++G+AKP+  P  Y   S   E++
Sbjct:  916 SSSRRQKSVSDQSMWSNKIEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEH-ASLDFAVQTLKGTNRGNVIIGVAKPIPVPDDYEEDSNQGESL 1039          

HSP 5 Score: 81.6481 bits (200), Expect = 4.059e-15
Identity = 62/220 (28.18%), Postives = 103/220 (46.82%), Query Frame = 2
Query: 6032 VETVIELTK--DRGLGLSIIGGSDTILGT--VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNA-THDQAIQTLRSVGNRVKLKIFRDKQPL--------------------------------CEDSLYFK-LKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSN 6577
            VETV+ L K    GLG S++G      G   + I E+ E+  A  DGRL   D+IL+++G+ L +  +H++AI  L+     V+L + R   P                                  +D  +++ ++   L     GLG  I+     GV I  ++ G +A++DGRL++ D +++I D NV     +QVA +L+    +V L++ RL  N
Sbjct:  162 VETVV-LNKPGQGGLGFSVVGLKSENRGELGIFIQEIQEEGVAGRDGRLRESDQILSIDGQQLDSGISHEEAIVLLQKTRGEVELIVARGGIPRTGTSRTTSGASSVISRTPSNVSLVSDASTTIPADDGTHWRQIETIDLHNDGTGLGFGIIGGRSSGVSIKTILPGGVADKDGRLQEHDQIMQIGDVNVGGMGSEQVAQVLRDAGSHVRLVISRLVEN 380          

HSP 6 Score: 79.337 bits (194), Expect = 1.815e-14
Identity = 41/91 (45.05%), Postives = 57/91 (62.64%), Query Frame = 2
Query: 1475 YTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKG 1747
            +   L KG +GLG+TIAGYI       + GIF+KSI+  S A L+G++ +NDQII++   S+ G +N   VEILK T  +V LK  R+  G
Sbjct:  614 FNVDLVKGTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVARHIPG 704          

HSP 7 Score: 73.9442 bits (180), Expect = 7.295e-13
Identity = 46/125 (36.80%), Postives = 72/125 (57.60%), Query Frame = 2
Query: 2174 DTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLSRSSSTM 2542
            + +K  +  IIG N +IL++ + K +   GLGISLEGT    D +     P H I  +  +GP+G +G  +SGD L+E NG  +  + + EV+T ++SLP   ++V AR+K  D  +   +S TM
Sbjct:  767 EAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGS----MPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKK--DYPEEPETSVTM 885          

HSP 8 Score: 68.5514 bits (166), Expect = 3.467e-11
Identity = 115/534 (21.54%), Postives = 202/534 (37.83%), Query Frame = 2
Query: 5183 GMS-HSNV-APIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDI--FHVHLEKSVQGFGF----FIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPG------VETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHE---KEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK-----------------------------------------------QPLCEDSLYFKLKVDL--LKKSRKGLGITIVSKSDVG------VCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQD-QVATLLKRCSGNVFLMVGR 6565
            GMS HS +    +K  Q       L+  RH     K   IP  +N+     ++  + +   +  NQ +  +   G  D+  F+V L K  +G G     +I + N+++ AGI++K +     AA +G LR  D+I+ +    +  ++    ++ L+     + + V R  I   H++       P S  R+     H          P  ++P++    K  AV                              +S   K     Q  +E+    T   K+H    Q I G      V  + + +   GLG+S+ G    + G++  H +H    +     +G + +GD ++ VNG  + +  H++ +  ++S+    +L + R K                                               Q    D   +  K++   L+K+ KGLG +I+   D        + I  LV G +AEQDG L  GD L+ +N+ N+   + D  V TL     GNV + V +
Sbjct:  536 GMSCHSTLNQQTLKDIQAVCHATQLSTNRH-SKTSKRYVIP--LNSQPTDTQRHPSGMSCHSTLNQQTLKDIQAGEEDVELFNVDLVKGTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVAR-HIPGKHSRPETPHSTPHSPGRQTPQSSHS---------PRSVTPVVIQPEKSIAV------------------------------ESADAKAEAELQ--RELQTLDTEAVKQH---YQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGSMPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKKDYPEEPETSVTMSQSEVESLPTVQLDDVSSTIDAPVGTGPSPSSSRRQKSVSDQSMWSNKIEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRGNVIIGVAK 1021          

HSP 9 Score: 63.1586 bits (152), Expect = 1.428e-9
Identity = 87/413 (21.07%), Postives = 179/413 (43.34%), Query Frame = 2
Query: 4496 DTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDK-QGKKGMGLLLVGNK---DCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDN----------------LVKMACIPASVNTSVA--PCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCN--ANDEAGIYVKKVTV-DGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVG 5659
            +++ ++GIFI  I   S A   G+L + D+++ V  + L   +  +A+  +K  T P+V      + V+       ++      + +    Q P S +S      + +T     P+K+    I     D K  +     L          + EA++  +++   ++ +++  E+ K     G+G+ L G +   D S     I           +G +  GD L+++N + VL + H+ V  +I+   ME   ++   K +P+                  V++  + ++++  V   P   S    ++ +D++  S+         I +V LEK+ +G GF I+D    +N E  + V +  V  G+A  +G+L  GDR++ +N+  + +   D  ++ L+G  N   +++G
Sbjct:  637 NSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQ-TGPVVS-----LKVARHIPGKHSRPETPHSTPHSPGRQTPQSSHSP-----RSVTPVVIQPEKS----IAVESADAKAEAELQRELQTL-------DTEAVKQHYQTIIGDNMEILVAEMTKFSPAGGLGISLEGTQYPLDGSMPWHRIHAVNPEGPVGKNGIIQSGDHLIEVNGVGVLDLGHNEVVTLIQSLPMEFRLVVARKKDYPEEPETSVTMSQSEVESLPTVQLDDVSSTIDAPVGTGPSPSSSRRQKSVSDQSMWSNK--------IEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGT-NRGNVIIG 1018          

HSP 10 Score: 59.6918 bits (143), Expect = 1.750e-8
Identity = 88/431 (20.42%), Postives = 177/431 (41.07%), Query Frame = 2
Query: 4424 NQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTI------QSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAP----------IIKKCQMESEKIMLTIKRHP--DNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVV 5656
            N  LG+SI GGK   V               IFI  +    PAE+ G++   D +L VN   +   S+  A + +KN  + +   +         +  +  + S  +   + + S+ ++ E  P       ++      TPP    K +++ + ++       + S + L+  S    +  I+ +++G     D+      I +D Q   G+          +     I    ++  AA DG+L  GD++L+  +  VL ++ + + P           + + Q+ +E         P  +  + +   P +   +  P    +++   S DE +  S + LQ       + LE+  +G GF I+  + +      IYVK V   G A+ +G L+ GD+I+ +N + +V   ++S + +L+  +  + + V
Sbjct: 1434 NTGLGLSIAGGKGVAVNR-------------IFIVDVKSGGPAEQDGRIKQADEILEVNRTPVRGMSHYQASTVLKNTGTSVELALGRSREAAEYLSRTRQQASPHSTEPDIKPSNIQTTESTPSISPRGVEVAAGPRRTPPPVAPKPSTDSLKRSSPQAGSVTVSPTLLAELSGGQLVEYIDFVKDGRLRKGDQL-----IAVDDQAIVGL--------SHAEGTIVIHEVYEDGAAAKDGRLWAGDQILERTTGRVL-LNVARLKPGNSSRPSSLSSLPQLQIGAESTSSIENSFPPVNYDLDIPSEPEANQRATPPLPVQQDSPSQSDDEEE--SESPLQ----TKIIELERGPEGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTV 1831          

HSP 11 Score: 56.225 bits (134), Expect = 1.739e-7
Identity = 53/184 (28.80%), Postives = 83/184 (45.11%), Query Frame = 2
Query:  602 EWAELEIVELLNDRCGLGFSLMG-------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPN-CSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPVSDLKAMQLYQQISVTDADQEAANIYQEHNLLQLVQTQLPPAIFQSTINTHYQTEI 1129
            E  EL  V+L+    GLG ++ G        +  G+ I+SI  GS A  +G LR+ D ++ +  +++ G  + +   IL+Q+   + L +AR IP   S PE   S    P  Q  Q       ++ PV     +Q  + I+V  AD +A    Q    LQ + T+         +  HYQT I
Sbjct:  609 EDVELFNVDLVKGTRGLGITIAGYIGEANSDELAGIFIKSIAHGSTAALDGRLRVNDQIIQVGSVSLHGKNNGEAVEILKQTGPVVSLKVARHIPGKHSRPETPHSTPHSPGRQTPQS-SHSPRSVTPV----VIQPEKSIAVESADAKAEAELQRE--LQTLDTE--------AVKQHYQTII 777          

HSP 12 Score: 54.6842 bits (130), Expect = 5.016e-7
Identity = 31/83 (37.35%), Postives = 48/83 (57.83%), Query Frame = 2
Query: 6041 VIELTKD-RGLGLSIIGGSDTILGTVMIH--EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            +IEL +   GLG SI+GG  +  G + I+   V    AA+ DGRL  GD+I+AVNG+ L   +H+ A+  L+    ++ L + 
Sbjct: 1750 IIELERGPEGLGFSIVGGHGSPHGDLPIYVKTVFPTGAASRDGRLKRGDQIIAVNGQSLVGVSHESAVSQLKKTRGKIILTVL 1832          

HSP 13 Score: 51.2174 bits (121), Expect = 5.651e-6
Identity = 31/95 (32.63%), Postives = 56/95 (58.95%), Query Frame = 2
Query:  605 WA-ELEIVELLNDRCGLGFSLM------GSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSS-DHIRLIIARPIP 865
            W+ ++E VEL     GLGFS++        + T +VIRS+  G VAE++G L  GD LM ++++N+   + +     L+ ++  ++ + +A+PIP
Sbjct:  930 WSNKIEYVELEKADKGLGFSILDYQDPSNPEKTVIVIRSLVHGGVAEQDGSLHPGDRLMSVNEVNLEHASLDFAVQTLKGTNRGNVIIGVAKPIP 1024          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO46059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR65])

HSP 1 Score: 84.7297 bits (208), Expect = 3.638e-18
Identity = 65/194 (33.51%), Postives = 100/194 (51.55%), Query Frame = 2
Query: 6044 IELTKDRG---LGLSIIGGSDTI-----LGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKL--KIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKS-------DVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRS 6574
            +E+T +RG   LG SI GG+D        G + I +V    AAA DGRL   D IL+VNG +  +  H QA+  L++ G++V L  +  R   P  E+ +        L K  KGLG +I   S       D G+ I+ +++G  A+QDGRL+ GD ++ +N  N+   + +    +LK     V ++V RL +
Sbjct:    5 LEITLERGGSGLGFSIAGGTDNPHVDDDFG-IYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAAGSQVTLVREKKRGNAPTREEIV--------LIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLTA 189          

HSP 2 Score: 55.0694 bits (131), Expect = 5.087e-8
Identity = 32/90 (35.56%), Postives = 53/90 (58.89%), Query Frame = 2
Query: 6026 PGVETVIELTKDRGLGLSIIGGSDT--ILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR 6283
            P  E ++ +   +GLG SI GGS    + G   + I ++ E  AA  DGRL  GD+I++VN ++L + +H+ A+Q L++   RV + + R
Sbjct:   97 PTREEIVLIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSR 186          

HSP 3 Score: 48.1358 bits (113), Expect = 8.785e-6
Identity = 48/239 (20.08%), Postives = 91/239 (38.08%), Query Frame = 2
Query: 5021 KQGKKGMGLLLVGNKDC----SSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEA----GIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQP 5713
            ++G  G+G  + G  D          YI        AA DG+L + D +L +N  + + + H      +K       ++ L  ++   N               AP  +                            + L K  +G GF I   + N       GIY+ K+   G A  +G L+ GD+I+ +N + + +  ++  ++ L+  K  + +VV R+T    +++  ++ P P
Sbjct:   10 ERGGSGLGFSIAGGTDNPHVDDDFGIYITKVIPGGAAAQDGRLQVNDCILSVNGTNTVDIEHQQAVDALKAA---GSQVTLVREKKRGN---------------APTRE---------------------------EIVLIKGSKGLGFSIAGGSGNQHVPGDNGIYITKIIEGGAAQQDGRLQVGDKIISVNLQNLEDVSHEDAVQVLKATKERVTIVVSRLTAY--YSEQTDSAPSP 201          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO45624 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSE9])

HSP 1 Score: 85.1149 bits (209), Expect = 1.204e-17
Identity = 63/174 (36.21%), Postives = 92/174 (52.87%), Query Frame = 2
Query: 6050 LTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGV-CIS--DLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVG 6562
            L +D+G+GL +IGG DT LG + I ++     A   G L  GD++L VN + L   TH  A++ L++    VKL + R K P   DS  F   V+L K S+  LGI +     VG  CI    +V   +A +DGR++KGD +L +N  + +  T  +V  LL+     V L  G
Sbjct:    3 LKEDQGIGLMVIGGLDTPLGMLYIKDIQPGTPAEKCGHLRTGDQLLQVNDECLVGVTHAYALEVLKNTPPLVKLTVARKKDP-DRDSDVF--TVELKKDSKGSLGIHV--SGGVGTNCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLFSG 171          

HSP 2 Score: 58.151 bits (139), Expect = 1.227e-8
Identity = 58/198 (29.29%), Postives = 96/198 (48.48%), Query Frame = 2
Query: 5954 QVIQEVPPTKTLT--QKEHPTKAQIIPGVETVIELTKDR--GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKL------KIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSK-----SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFT 6502
            +V++  PP   LT  +K+ P +   +      +EL KD    LG+ + GG  T    + +  V     AA DGR+  GDR+L+VNG+  +  TH + +  L+++  RV+L      K F  K+ L +      +K   L+K   GLG ++         D  + I  + K S + + G L+ GD +LE+N  ++R  T
Sbjct:   65 EVLKNTPPLVKLTVARKKDPDRDSDV----FTVELKKDSKGSLGIHVSGGVGT--NCIDVRHVVPLGVAAKDGRIRKGDRVLSVNGRSTKGLTHQEVLNLLQNLPRRVRLFSGGNGKAF--KEILQKTPPEPSVKEITLEKGPSGLGFSVGGGRDSLYGDTPIYIKYVFKDSASSRSG-LEIGDEVLEVNGRHMRGMT 253          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO33432 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS78])

HSP 1 Score: 84.7297 bits (208), Expect = 3.102e-16
Identity = 67/215 (31.16%), Postives = 94/215 (43.72%), Query Frame = 2
Query: 6062 RGLGLSIIGGSDTIL-----GTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ------------------------------PLCED--SLYFKLKVDLLKKSRKGLGITIVS--------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            +GLG++I GG  +         + I  + E   A  DG L  GD+IL VNG D+ NATH QA+  L+S G  + L + R+KQ                              P  ED  +   K  + L +   KGLG +I            D G+ IS + K   AE+DGRLK GD +L IN  ++++   D    +L      V L+V R R
Sbjct:  576 KGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAKDESVKEEPKKTGVRFAPEPEMEDIETRPEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYRDR 790          

HSP 2 Score: 74.7146 bits (182), Expect = 3.980e-13
Identity = 58/177 (32.77%), Postives = 88/177 (49.72%), Query Frame = 2
Query: 6068 LGLSIIGGSDTI---LGT----VMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYF------KLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG SI+GGSD      G     + I ++     AA    L  GDR+L VNGKD+RNATH  A+  L +  + +KL +  D  P   + + F      KL +  ++   KG     + K+D G+ IS + +G+ A +DGRL  G  +LE+N  ++   T  +    L+     V L+V
Sbjct:  850 LGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATT-NLKIGDRVLMVNGKDMRNATHQDAVAALIANVSLIKLLVRHDPPPKGLNDVNFHKSPGEKLGIS-IRGGAKGHPGNPLDKTDEGIFISKVSEGAAAHKDGRLMVGQRILEVNGVSLLGATHLEAVRALRSMGDRVTLLV 1024          

HSP 3 Score: 66.2402 bits (160), Expect = 1.382e-10
Identity = 63/224 (28.12%), Postives = 100/224 (44.64%), Query Frame = 2
Query: 6026 PGVETV-IELTKDRGLGLSIIGGSDTIL-----GTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------QPLCEDSLYF---------------------------KLKVD---LLKKSRKGLGITIVSKSD----------VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFT-QDQVATLLKRCS 6538
            P  ET+ ++   D+GLG SI GG  +         + I ++ +   A  DGRL  GD++L++N +D++NA HD A+  L S  + V L ++RD+       PL      +                           + +++   +LKK    LG +IV  SD           G+ IS +V   +A     LK GD +L +N  ++R+ T QD VA L+   S
Sbjct:  697 PEKETITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPSPARAEINHEIILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATT-NLKIGDRVLMVNGKDMRNATHQDAVAALIANVS 919          

HSP 4 Score: 63.5438 bits (153), Expect = 8.946e-10
Identity = 58/233 (24.89%), Postives = 100/233 (42.92%), Query Frame = 2
Query: 5033 KGMGLLLVGNKDCSSM-----NCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIK-------------KCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNA-----NDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            KG+G+ + G K  +         +I    +N  A  DG L +GD++LK+N +D+   +H     ++K             K ++E   +  T K   D  VK    P       AP  + E+ +ET  ++  I+    L+  GD          +G GF I          + + GI++ K+  DG A  +G L+ GD++L IN   + N  +D  +  L    + + ++V R
Sbjct:  576 KGLGINIAGGKGSTPYKENDEGIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYVVREKQEIEKRTVPKTAK---DESVKEE--PKKTGVRFAPEPEMED-IETRPEKETIT----LKRGGD----------KGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIVYR 788          

HSP 5 Score: 54.6842 bits (130), Expect = 5.135e-7
Identity = 29/94 (30.85%), Postives = 52/94 (55.32%), Query Frame = 2
Query: 4400 VVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTI 4681
             +T++R  ++ LG SI GGK +   +  +         GIFI+ I  D  AE+ G+L +GD++LS+N  D+    +DDA++ + +  S +   +
Sbjct:  701 TITLKRGGDKGLGFSIAGGKGSTPYKDGD--------PGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNMLTSGPSFVTLIV 786          

HSP 6 Score: 51.9878 bits (123), Expect = 2.974e-6
Identity = 31/93 (33.33%), Postives = 53/93 (56.99%), Query Frame = 2
Query: 4406 TVEREQNQSLGISILGGKVAN-VKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTI 4681
            T+ R+  + LGI+I GGK +   KE +E         GIFI+ I+ + PA + G L++GD++L VNG+D+   ++  A+  +K+    I   +
Sbjct:  570 TIHRD-TKGLGINIAGGKGSTPYKENDE---------GIFISRISENGPAGRDGILHVGDKILKVNGVDISNATHHQAVDVLKSTGKDITLYV 652          

HSP 7 Score: 51.2174 bits (121), Expect = 5.416e-6
Identity = 52/223 (23.32%), Postives = 93/223 (41.70%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVGNKDCSSM-----NCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPAS-----VNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFH-VHLEKSVQGFGFFIMDCNAN-------DEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRL 5623
            I + + G KG+G  + G K  +         +I     +  A  DG+L +GD++L INS D+    H +   +     + S    +T+  + D ++     P +      N S +   K  N       +    S        +I H + L+K     GF I+  + +       DE GI++ K+   G+AA    L+ GDR+L++N + + N  +   +  L
Sbjct:  702 ITLKRGGDKGLGFSIAGGKGSTPYKDGDPGIFISKIAKDGTAERDGRLKVGDKVLSINSRDMKNAKHDDAVNM-----LTSGPSFVTLIVYRDRVINKKMTPLTRAGKQYNPSPSRAGKQYNPSPARAGKQYSPS----PARAEINHEIILKKGNNPLGFSIVGGSDHASHPFGMDEPGIFISKIVPTGVAATT-NLKIGDRVLMVNGKDMRNATHQDAVAAL 914          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Match: EDO45887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU6])

HSP 1 Score: 75.485 bits (184), Expect = 2.731e-13
Identity = 100/414 (24.15%), Postives = 162/414 (39.13%), Query Frame = 2
Query: 5447 FGFFIMDCNAND--EAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVN-------EDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHD----KEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK------QP---LCEDSLYF---------KLKVDLLKKSRKGLGITIVSKS-----------DVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFL 6553
             GF +      D  E G+ V+++     A+  G L+  DRIL +N + +++       E +DS          A+   V ++ +S   +       +P   D+  S  +           P VI  +  D+ K S  +P I  +    + P+   IP  R     +   +   I       +   Q  PP         P  +  +     ++EL K   GLG SI    +   G   + +  +  K AA  DGRL  GD+I+ VNG  +      +A+  LRS    VKL I R++      +P   L EDS  +           K+ L      GLG+++  K            D+G+ +  ++ G  A +DGRLK  D LL +N+ +    T  +    L+R   N  L
Sbjct:  131 LGFTVKPYKTADGREIGLIVREIAAGKCASRNGKLQVADRILEVNGQNLMDLSNSRAQEVFDS----------AIRSPVIKLAVSASSSFVSGNTKKPTKHDKPPSASFQ--------PEPVVIKAVYKDKEKASMSKPEIPQNFGLPRSPVSPGIP--RSPGFPKSPRSPDGIEPPPGFRDNS-QGAPP---------PMLSSKVVSKRMLLELNKGGDGLGFSITTRDNPAGGHTPIFVKSILAKGAAIEDGRLRGGDQIIEVNGMPMTGKNQGEAVNILRSTEGVVKLLIQREELVQSPTKPAIELNEDSTRYLREQGKQVLTFKIPLNMSGAAGLGVSVKGKVADTDSGRDSPIDMGIFVKSVIAGGAAFKDGRLKAEDQLLSVNNVSFMRLTNTEAIDGLRRAMQNTRL 514          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 195.282 bits (495), Expect = 8.691e-53
Identity = 100/195 (51.28%), Postives = 134/195 (68.72%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET IE+ K   GLGLSI+GG DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLR A+HD AI  LR    RV+L +FRD+    E+ L+    V+L KK  +GLG++IV  ++D GV +SD+V G + + DGRL +GD +L +N  +VRS TQ+ VA LLK C G + L VGR ++  +
Sbjct:  139 PATCPIIPGCETTIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFRDEGQYKEEDLWDSFDVELHKKPGQGLGLSIVGRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAGPF 333          

HSP 2 Score: 76.2554 bits (186), Expect = 1.825e-13
Identity = 63/243 (25.93%), Postives = 105/243 (43.21%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLV--------------------KMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            G +  IE++K G+ G+GL L GN+D S M+ ++ G   N  A  DG++++GDELL+IN   + G SH N + IIK    + + I ++I  + ++LV                     +AC PA+    +  CE +                           + + K   G G  I+         I + +V  +G A+ +G L  GD+IL +N   +    +D  +  LR     + + V R
Sbjct:   19 GVLHMIELEK-GQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKIIFVSISVNDESLVDPTSSCPFFWLGFSRSSTPSTLACDPATCPI-IPGCETT---------------------------IEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFR 232          

HSP 3 Score: 69.3218 bits (168), Expect = 3.167e-11
Identity = 60/216 (27.78%), Postives = 99/216 (45.83%), Query Frame = 2
Query: 6023 IPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKL---KIFRDKQPLCEDSL---YFKLKVDL-------------------------LKKSRKGLGITIVSKSDV---GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +PGV  +IEL K + GLGLS+ G  D    +V +  +    AA  DGR+  GD +L +NG+ L   +H  A   ++S  ++VK+    I  + + L + +    +F L                             + K   GLG++IV   D     + I ++ +   A +DGRL  GD +LE+N  ++R+ + D    +L++    V L V R
Sbjct:   17 LPGVLHMIELEKGQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKIIFVSISVNDESLVDPTSSCPFFWLGFSRSSTPSTLACDPATCPIIPGCETTIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFR 232          

HSP 4 Score: 55.0694 bits (131), Expect = 7.026e-7
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 1427 RTKHRIRI---------NEQNEFHEYTTYL-TKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +T  R+R+          E++ +  +   L  K  QGLGL+I G        N  G+FV  I    + D +G+++  DQI+ +N + V      AV  +LK   G +KL+  R+  GP +
Sbjct:  221 QTPQRVRLTVFRDEGQYKEEDLWDSFDVELHKKPGQGLGLSIVG------RRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAGPFH 334          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain crumbs cell polarity complex component [Source:NCBI gene;Acc:101165593])

HSP 1 Score: 197.978 bits (502), Expect = 4.361e-50
Identity = 100/195 (51.28%), Postives = 134/195 (68.72%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            P    IIPG ET IE+ K   GLGLSI+GG DT+LG ++IHEV+E+ AA+ DGRLWAGD+IL VNG DLR A+HD AI  LR    RV+L +FRD+    E+ L+    V+L KK  +GLG++IV  ++D GV +SD+V G + + DGRL +GD +L +N  +VRS TQ+ VA LLK C G + L VGR ++  +
Sbjct: 1252 PATCPIIPGCETTIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFRDEGQYKEEDLWDSFDVELHKKPGQGLGLSIVGRRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAGPF 1446          

HSP 2 Score: 128.642 bits (322), Expect = 5.929e-29
Identity = 117/444 (26.35%), Postives = 200/444 (45.05%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVD---VSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTD-------ENQISSNNNLQG--------YGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            W+ PR V + RE  +SLGISI+GG+    +       +  ++ GIFI HI  DSPA + G L  GDR++ V+G+DL   S+++A+  I+   +P+ F +QS+V    VS +K                   Q+P  L+  S      L   P  P        +  E+D    + + +    E     + E     +  +  +   G +  IE++K G+ G+GL L GN+D S M+ ++ G   N  A  DG++++GDELL+IN   + G SH N + IIK    + + I     +  D L+ +  + + +  +V      E+ V+ ++         ++ S+ + L           G    + + K   G G  I+         I + +V  +G A+ +G L  GD+IL +N   +    +D  +  LR     + + V R
Sbjct:  939 WNQPRKVELFREHGKSLGISIVGGRGMGSR-----LSNGEVMRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRGGNPVTFLVQSIVQRPRVSQLK-------------------QQPFGLSEISPT--GTLLALPVVP--------HAGESDTDALAEAPAEAGEEGEEEKVDEFGYTWSDRRYGS-LPGVLHMIELEK-GQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKIIFEGCMKPGDKLLAVNGV-SVLGYTVDKVLNDESLVDPTSSCPFFWLGFSRSSTPSTLACDPATCPIIPGCETTIEICKGCTGLGLSIVGGCDTLLGAIIIHEVYEEGAASKDGRLWAGDQILEVNGIDLRAASHDDAINVLRQTPQRVRLTVFR 1345          

HSP 3 Score: 102.064 bits (253), Expect = 6.144e-21
Identity = 43/100 (43.00%), Postives = 69/100 (69.00%), Query Frame = 2
Query:  557 LSETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +S T    ST   N+ W  +E +EL+ND  GLGF ++G K+TGV++++I  G +A+++G LR GDH++ I D ++ GM SEQVA +LRQ  + ++L++ R
Sbjct:  226 VSRTPSAASTLSANSSWQHVETIELVNDGTGLGFGIVGGKTTGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTR 325          

HSP 4 Score: 97.4413 bits (241), Expect = 1.641e-19
Identity = 66/195 (33.85%), Postives = 96/195 (49.23%), Query Frame = 2
Query: 6044 IELTK--DRGLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDL-RNATHDQAIQTLRSVGNRVKLKIFRDKQP----------------LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +EL K    GLG S++G      G   + I E+     A  DG+L   D+ILA+NG+ L +  +H QAI  L+S   RV L + R   P                L  +S +  ++   L     GLG  IV     GV +  ++ G IA+QDGRL+ GD +L I DT++     +QVA +L++C   V L+V R
Sbjct:  131 VELQKPASGGLGFSLVGLKSENRGELGIFIQEIQPGSVADCDGKLKEADQILAINGQPLDQTVSHQQAIGLLQSASERVHLTVARGPIPQLTSPIVSRTPSAASTLSANSSWQHVETIELVNDGTGLGFGIVGGKTTGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTR 325          

HSP 5 Score: 81.6481 bits (200), Expect = 9.236e-15
Identity = 45/98 (45.92%), Postives = 66/98 (67.35%), Query Frame = 2
Query: 2894 VAMWSGPIL-VELTKESQGLGFSIEYYQDASSNVP-VIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW   I  +EL K   GLGFSI  YQD       VIVI SLVP+GVA  DGR++PGDRL+++N+  ++  +S ++ ++AL+    G+V +G+AKP+
Sbjct:  625 LAMWELEIQNIELEKGEGGLGFSILDYQDPLDPAKTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLEN-ASLEDAVQALKGAKLGKVQIGVAKPL 721          

HSP 6 Score: 77.411 bits (189), Expect = 1.961e-13
Identity = 66/208 (31.73%), Postives = 91/208 (43.75%), Query Frame = 2
Query: 6032 VETVIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFR-----------------------DKQPLCEDSLYFKLKVDLLKKSRKGLGITIVS------KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            VET IEL  D  GLG  I+GG  T    V++  +     A  DGRL +GD IL +   DL     +Q  Q LR  GNRVKL + R                        KQ   E++  F +    L K+ +GLGITI            G+ +  + K S  +QDGR+  GD +  ++  N++  T  Q   LL+     V L + R
Sbjct:  245 VET-IELVNDGTGLGFGIVGGKTT---GVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTRAPVEETPSAVMSVVLPTVSEQQVPKQNKEEEAESFNV---CLTKNAQGLGITIAGYVGDKNSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIR 445          

HSP 7 Score: 73.9442 bits (180), Expect = 2.071e-12
Identity = 41/106 (38.68%), Postives = 61/106 (57.55%), Query Frame = 2
Query: 2192 WNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKE 2503
            W KI+G + +++++ + K +E  GLGISLE +           + HHYIR++  +GP+G  G   SGDEL+E NG  L G  ++EV+  LK LP  V +   R  E
Sbjct:  493 WQKILGPSNEVIVAQVEKFSESSGLGISLEAS-----------RGHHYIRSVLPEGPVGRCGQLFSGDELVEVNGISLIGETHKEVVRILKELPIFVYMTCCRPPE 587          

HSP 8 Score: 71.2478 bits (173), Expect = 1.522e-11
Identity = 65/229 (28.38%), Postives = 103/229 (44.98%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNK--DCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDV-LGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQ 5677
            V ++E+ K    G+G  LVG K  +   +  +I   +  SVA  DG+L   D++L IN   +   +SH      I   Q  SE++ LT+ R P        IP   +  V+          T +  + +S+N++ Q    +  + L     G GF I+        G+ VK +   GIA  +G LR GD IL I D  +     + V + LR C N +++VV R  + +
Sbjct:  128 VAHVELQKPASGGLGFSLVGLKSENRGELGIFIQEIQPGSVADCDGKLKEADQILAINGQPLDQTVSHQQA---IGLLQSASERVHLTVARGP--------IPQLTSPIVS---------RTPSAASTLSANSSWQ---HVETIELVNDGTGLGFGIV---GGKTTGVIVKTILPGGIADQDGRLRSGDHILRIGDTDLHGMGSEQVAQVLRQCGNRVKLVVTRAPVEE 330          

HSP 9 Score: 69.707 bits (169), Expect = 4.074e-11
Identity = 39/95 (41.05%), Postives = 57/95 (60.00%), Query Frame = 2
Query: 1451 NEQNEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            N++ E   +   LTK  QGLG+TIAGY+  +      GIFVKSI+K+S  D +G+I + DQI  ++  ++ G  N   VE+L+ T   V+LK  R
Sbjct:  352 NKEEEAESFNVCLTKNAQGLGITIAGYVGDK-NSEPSGIFVKSITKDSAVDQDGRIHVGDQITAVDGVNIQGHTNQQAVELLRHTGQTVRLKLIR 445          

HSP 10 Score: 67.3958 bits (163), Expect = 2.103e-10
Identity = 53/195 (27.18%), Postives = 88/195 (45.13%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGGSDTILGTVMIH-EVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ------------PLC---EDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            +ELTK     LG+SI GG  + LG + I   +      A   +L  GDRI+++ G      +H QA+  L++    ++L++                 P C   +D    + K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N   +   T ++   +LKR  G V L V
Sbjct: 1499 VELTKGPSDSLGISIAGGVGSPLGDIPIFIAMMNPVGLAAQTQLKVGDRIVSICGTSAEGMSHSQAVTLLKNTPGTIQLQVVAGGDSTVTGPSQEQLTPSCIFQDDIGPPQYKTITLERGPDGLGFSIVGGHGSPHGDLPIYVKTVFGKGAAAEDGRLKRGDQIIAVNGQTLEGVTHEEAVGILKRTKGTVTLTV 1693          

HSP 11 Score: 67.0106 bits (162), Expect = 2.895e-10
Identity = 63/247 (25.51%), Postives = 111/247 (44.94%), Query Frame = 2
Query: 5129 GQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDC-NANDEAG--IYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPI---INDERKMSAVRPSISHD 5851
            GQL  GDEL+++N I ++G +H  V  I+K+  +    + +T  R P+   + +  P S   +       E A + +  E  I S+  +    +I ++ LEK   G GF I+D  +  D A   I ++ +  DG+A  +G L  GDR++ +ND  + N   +  ++ L+G K      +G++ I          +P P+S                 + +PT I P    ++DER +      +  D
Sbjct:  543 GQLFSGDELVEVNGISLIGETHKEVVRILKELPI---FVYMTCCRPPETQSERS-DPRSEQVTEESAGNPEAATQDTVTEEGIGSSLAMWEL-EIQNIELEKGEGGLGFSILDYQDPLDPAKTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGAK------LGKVQIGV-------AKPLPVSLS---------------VSIPTFIDPCEGDLSDERMLDHTYSGVEED 756          

HSP 12 Score: 56.225 bits (134), Expect = 4.962e-7
Identity = 38/119 (31.93%), Postives = 60/119 (50.42%), Query Frame = 2
Query:  536 CGNPLSGLSETTVDHSTDMLNTEWAELEI--VELLNDRCGLGFSLMGSK------STGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSS-DHIRLIIARPIP 865
             GNP +   +T  +         W ELEI  +EL     GLGFS++  +       T +VIRS+    VAE +G L  GD LMY++D N+   + E     L+ +    +++ +A+P+P
Sbjct:  605 AGNPEAATQDTVTEEGIGSSLAMW-ELEIQNIELEKGEGGLGFSILDYQDPLDPAKTVIVIRSLVPDGVAETDGRLLPGDRLMYVNDTNLENASLEDAVQALKGAKLGKVQIGVAKPLP 722          

HSP 13 Score: 55.8398 bits (133), Expect = 7.368e-7
Identity = 36/116 (31.03%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGL 6361
            +EL ++ G  LG+SI+GG        +  ++  + I  + E   A  +G L  GDRI+ V+G DLR+A+H++A++ +R  GN V   +          S+  + +V  LK+   GL
Sbjct:  945 VELFREHGKSLGISIVGGRGMGSRLSNGEVMRGIFIKHILEDSPAGQNGTLRTGDRIVEVDGVDLRDASHEEAVEAIRRGGNPVTFLV---------QSIVQRPRVSQLKQQPFGL 1051          

HSP 14 Score: 53.9138 bits (128), Expect = 2.353e-6
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 1427 RTKHRIRIN---------EQNEFHEYTTYL-TKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVY 1756
            +T  R+R+          E++ +  +   L  K  QGLGL+I G        N  G+FV  I    + D +G+++  DQI+ +N + V      AV  +LK   G +KL+  R+  GP +
Sbjct: 1334 QTPQRVRLTVFRDEGQYKEEDLWDSFDVELHKKPGQGLGLSIVG------RRNDTGVFVSDIVSGGLVDADGRLLQGDQILSVNGEDVRSATQEAVAALLKCCIGPIKLEVGRFKAGPFH 1447          

HSP 15 Score: 53.1434 bits (126), Expect = 5.016e-6
Identity = 33/87 (37.93%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 6023 IPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIF 6280
            +PGV  +IEL K + GLGLS+ G  D    +V +  +    AA  DGR+  GD +L +NG+ L   +H  A   ++S  ++VK+ IF
Sbjct: 1108 LPGVLHMIELEKGQTGLGLSLAGNRDRSRMSVFVVGIDPNGAAGRDGRILVGDELLEINGQVLYGQSHQNASSIIKSALSKVKI-IF 1193          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: MPDZ (multiple PDZ domain protein-like [Source:NCBI gene;Acc:101166191])

HSP 1 Score: 168.703 bits (426), Expect = 3.454e-41
Identity = 90/194 (46.39%), Postives = 123/194 (63.40%), Query Frame = 2
Query: 6005 PTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKS-DVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNI 6580
            P    ++ G ET IE+ K   GLGLSI+GG DT+LG V+IHEV++  AA  DGRL AGD+IL VN  DLR ATHD+AI  LR    +V+L IFR ++   E+ L+    + L  +  +GLG T V KS D G+ +SD+++G  A+ DGRL  GD +L IN  +VR+ +QD    LL+  SG V L V R ++ +
Sbjct: 1459 PVSCPVVAGRETTIEIHKGNVGLGLSIVGGCDTLLGAVIIHEVNDGGAAQRDGRLQAGDQILEVNSIDLRQATHDEAIAVLRLTTQQVRLCIFRHQEAYREEDLWDVFSLKLSPRPGEGLGFTTVGKSNDTGIFVSDVIRGGAADSDGRLLPGDQILSINGVDVRAASQDHAQKLLQSSSGAVLLEVARFKARV 1652          

HSP 2 Score: 121.324 bits (303), Expect = 9.577e-27
Identity = 111/412 (26.94%), Postives = 180/412 (43.69%), Query Frame = 2
Query: 4385 WSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQ-GKKGMGLLLVGNKDCSSMNCYIC--GFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSV 5611
            W  PR V + R   QSLGISI+GG+    +          ++ G+FI HI+PDSPA   G L  GDR+L V+G+DL   S+++A+  I+ A   +V  ++S  D      +   +    Q + + S E+E LS    S   +   T  P      TS++++         + +     +      L    ++          SGK+  IE++K     G+G+ L G+KD S     +C           LDG++ +GDELL+IN   + G S+ N + II     +  KI+L I+      VK       V     P          + DE +  S        D+  + L +   G G  +++  + +  G+ V  +  DG A+ +G ++ GDRIL +  E V     + V
Sbjct: 1011 WDQPRSVRLTRAAGQSLGISIMGGRGMGRR-----LSSGEMMRGVFIKHISPDSPAAHNGTLRAGDRILEVSGVDLRDASHEEAVEAIRRAGDSVVLLVRSGQD-RCQSPAPTCRTPTPQSNSHSSKEEEALSSLFLSVSHRNPFTPTPFKAPSPTSDRMDGRIPVNATAAAAAEDGDDACRKKMLQRYGSL----------SGKLHMIELEKDPAVPGLGITLAGSKDGSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTIISNAPSKV-KIVL-IRNKAGKAVKENRTEGEVVIDWHP---------DAADEEESCS--------DLKRIVLTQDHAGLGIRLVEDPSWE--GVVVGSLIQDGSASKDGRIKVGDRILEVGGEPVAGLSVEKV 1385          

HSP 3 Score: 85.1149 bits (209), Expect = 9.644e-16
Identity = 65/200 (32.50%), Postives = 102/200 (51.00%), Query Frame = 2
Query: 6041 VIELTKD-RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRD-------KQP-LCEDSLYFKLKVDL---------LKKSRKGLGITIVSK-------SDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +IELT D +GLG  IIGG  +    +M+  +    AA  D RL +GD+IL +   DL     +QA Q LR+ G++VKL I R+         P L +DS   K+ +DL           K+ +GLG T+ S           GV +  + KGS  +QDGR+  GD++L ++  +++  ++ +   +L+R    V L + R
Sbjct:  166 IIELTNDGKGLGFGIIGGRAS---GIMVKTILPGGAAGRDTRLRSGDQILRIGDTDLAGMNSEQAAQVLRNAGSKVKLLIARNVTKDNHLSSPVLSQDSSDDKI-IDLNDDYEFSLQFTKNSRGLGFTVSSYVGDLNSVYSAGVMVKSIAKGSTVDQDGRMHIGDIILSVDGVSLQGCSEQRAMEVLRRTGPLVRLRLLR 361          

HSP 4 Score: 83.5741 bits (205), Expect = 2.475e-15
Identity = 46/98 (46.94%), Postives = 63/98 (64.29%), Query Frame = 2
Query: 2894 VAMWSGPI-LVELTKESQGLGFSIEYYQDAS-SNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            +AMW     +VEL K   GLGFSI  YQD   +   V++I SLVP GVA  DGR++PGDRL+F+NE +++  SS    +  L+S   G V +G+AKP+
Sbjct:  593 LAMWEKDAQVVELEKGELGLGFSILDYQDPEDATKTVLIIRSLVPGGVADRDGRLLPGDRLMFVNETDLEG-SSLDYAVHVLKSTDYGPVRIGVAKPL 689          

HSP 5 Score: 81.6481 bits (200), Expect = 9.193e-15
Identity = 35/85 (41.18%), Postives = 57/85 (67.06%), Query Frame = 2
Query:  602 EWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            E   +EI+EL ND  GLGF ++G +++G+++++I  G  A R+  LR GD ++ I D ++ GM SEQ A +LR +   ++L+IAR
Sbjct:  160 ERRHVEIIELTNDGKGLGFGIIGGRASGIMVKTILPGGAAGRDTRLRSGDQILRIGDTDLAGMNSEQAAQVLRNAGSKVKLLIAR 244          

HSP 6 Score: 80.4925 bits (197), Expect = 2.544e-14
Identity = 90/378 (23.81%), Postives = 163/378 (43.12%), Query Frame = 2
Query: 5489 GIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPI----YSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDR---GLGLSIIGGSDTILG--TVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLC--------------------EDSLYFKLKVDLLKKSRKGLGITIVS-KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKR 6532
            G+++K ++ D  AA+ GTLR GDRIL ++   + +  ++  ++ +R    A + VV  +   QD  ++    P P  +            +P     P   S    +E  +S++  S+SH + P     + +  P   R           +  ++ VN              +K+   +   + G   +IEL KD    GLG+++ G  D      +V +  V  +    LDGR+  GD +L +NGK L   ++  A   + +  ++VK+ + R+K                        E+     LK  +L +   GLGI +V   S  GV +  L++   A +DGR+K GD +LE+    V   + ++V++L+ +
Sbjct: 1049 GVFIKHISPDSPAAHNGTLRAGDRILEVSGVDLRDASHEEAVEAIR---RAGDSVVLLVRSGQDRCQS----PAPTCR------------TP----TPQSNSHSSKEEEALSSLFLSVSH-RNPFTPTPFKAPSPTSDR-----------MDGRIPVNATAAAAAEDGDDACRKKMLQRYGSLSGKLHMIELEKDPAVPGLGITLAGSKDGSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTIISNAPSKVKIVLIRNKAGKAVKENRTEGEVVIDWHPDAADEEESCSDLKRIVLTQDHAGLGIRLVEDPSWEGVVVGSLIQDGSASKDGRIKVGDRILEVGGEPVAGLSVEKVSSLISK 1391          

HSP 7 Score: 70.0922 bits (170), Expect = 3.466e-11
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 2
Query: 2171 EDTIKSTWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAAR 2494
            E+ ++  W   +G  Y++ +  + + +E  GLGISLE               HHY+ +I  +GP+G  G    GD +LE NG  L G  ++EV+  LK LP  V +V +R
Sbjct:  437 EENLRKRWQHAVGPRYEVTVCQLQRFSETSGLGISLEARAG-----------HHYLCSILPEGPVGQSGKILIGDRILEVNGIPLVGETHKEVVNILKELPRSVHLVCSR 535          

HSP 8 Score: 65.855 bits (159), Expect = 5.997e-10
Identity = 133/583 (22.81%), Postives = 218/583 (37.39%), Query Frame = 2
Query: 5009 IEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGF----FIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDR----RESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISH---------DKEPIYSS--IPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTL----RSV-------------------GNRVKLKI------FRDKQ--------PLCED-------------SLYFK-LKVDLLKKSRKGLGITIVSKSD------VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLK 6529
            IE+   GK G+G  ++G +    M   I        A  D +L  GD++L+I   D+ GM+    A +++       K+ L I R   N+ K   + + V +            + S+D+  I  N++ +     F +   K+ +G GF    ++ D N+   AG+ VK +        +G +  GD IL +          D V   L+GC     M V R T              P+ + R     E +    +  PP  Q P   S   ++     A    I            ++  Y+S   PPD K        + +++ K+          V P   +T             V  +   ++  GLG+S+    +   G   +  +  +      G++  GDRIL VNG  L   TH + +  L    RSV                    N V+L +      F DK         P  ED             +++ K  +V  L+K   GLG +I+   D        + I  LV G +A++DGRL  GD L+ +N+T++   + D    +LK
Sbjct:  167 IELTNDGK-GLGFGIIGGRASGIMVKTIL---PGGAAGRDTRLRSGDQILRIGDTDLAGMNSEQAAQVLRNA---GSKVKLLIAR---NVTKDNHLSSPVLS------------QDSSDDKIIDLNDDYE-----FSLQFTKNSRGLGFTVSSYVGDLNSVYSAGVMVKSIAKGSTVDQDGRMHIGDIILSV----------DGV--SLQGCSEQRAMEVLRRT-------------GPLVRLRLLRKAERLSPSFLQDPPLQQQPLRHSHSFHEGSAFKAGLGKIQETGICSLREISRQAAYASRRPPPDFKDGVKLSPEDEENLRKRWQ------HAVGPRYEVT-------------VCQLQRFSETSGLGISL----EARAGHHYLCSILPEGPVGQSGKILIGDRILEVNGIPLVGETHKEVVNILKELPRSVHLVCSRVVPPSIPESEEDDDNDVQLSLKELLAEFNDKLDQGCVIPCPTAEDITKRGVPPMSPPLAMWEKDAQVVELEKGELGLGFSILDYQDPEDATKTVLIIRSLVPGGVADRDGRLLPGDRLMFVNETDLEGSSLDYAVHVLK 674          

HSP 9 Score: 65.0846 bits (157), Expect = 1.108e-9
Identity = 64/241 (26.56%), Postives = 101/241 (41.91%), Query Frame = 2
Query: 4991 SGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLE-KSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITI-------SQDHAK 5689
            +G+   IEI K G  G+GL +VG  D       I    D   A  DG+L  GD++L++NSID+   +H     +++   + ++++ L I RH                            E   +E+            D+F + L  +  +G GF  +    +++ GI+V  V   G A ++G L  GD+IL IN   V     D   K L+    A+ + V R          SQD+AK
Sbjct: 1466 AGRETTIEIHK-GNVGLGLSIVGGCDTLLGAVIIHEVNDGGAAQRDGRLQAGDQILEVNSIDLRQATHDEAIAVLR---LTTQQVRLCIFRHQ---------------------------EAYREED----------LWDVFSLKLSPRPGEGLGFTTV--GKSNDTGIFVSDVIRGGAADSDGRLLPGDQILSINGVDVRAASQDHAQKLLQSSSGAVLLEVARFKARVQYSRQSQDYAK 1663          

HSP 10 Score: 61.2326 bits (147), Expect = 1.823e-8
Identity = 37/97 (38.14%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 6044 IELTKDRG--LGLSIIGG--------SDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCE 6304
            + LT+  G  LG+SI+GG        S  ++  V I  +     AA +G L AGDRIL V+G DLR+A+H++A++ +R  G+ V L + R  Q  C+
Sbjct: 1017 VRLTRAAGQSLGISIMGGRGMGRRLSSGEMMRGVFIKHISPDSPAAHNGTLRAGDRILEVSGVDLRDASHEEAVEAIRRAGDSVVL-LVRSGQDRCQ 1112          

HSP 11 Score: 60.4622 bits (145), Expect = 2.530e-8
Identity = 31/97 (31.96%), Postives = 56/97 (57.73%), Query Frame = 2
Query: 1445 RINEQNEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNR 1735
            +I + N+ +E++   TK  +GLG T++ Y+     V   G+ VKSI+K S  D +G++ I D I+ ++  S+ G      +E+L+ T  +V+L+  R
Sbjct:  265 KIIDLNDDYEFSLQFTKNSRGLGFTVSSYVGDLNSVYSAGVMVKSIAKGSTVDQDGRMHIGDIILSVDGVSLQGCSEQRAMEVLRRTGPLVRLRLLR 361          

HSP 12 Score: 60.4622 bits (145), Expect = 2.573e-8
Identity = 54/197 (27.41%), Postives = 81/197 (41.12%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTV--MIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDK-----------------QP---------LCEDSLYFKLKVDLLKKSRKGLGITIVS-----KSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMV 6559
            LG+SI GG  +  G V   I  +     AA   +L  GD+IL +N       THD+A   L++    V L++  D                  QP         LC      K K   L++   GLG +IV        D+ + +  +     A +DGRLK+GD ++ +N   +   T  +   +LKR  G V L +
Sbjct: 1717 LGISIAGGVGSPHGNVPLFIATMDTNGLAAKTEKLQTGDQILCINDVSTEGMTHDEAGALLKNAAGSVTLQVTADSGGGSRQDHSAVHAASSSQPGSLTWFHNNLCPR----KYKTITLERGSSGLGFSIVGGFGSPHGDLPIYVKTIFNKGAAVEDGRLKRGDQIIAVNGHCLEGVTHAEAVDILKRTKGTVVLTL 1909          

HSP 13 Score: 59.6918 bits (143), Expect = 5.258e-8
Identity = 35/110 (31.82%), Postives = 65/110 (59.09%), Query Frame = 2
Query:  605 W-AELEIVELLNDRCGLGFSLMG------SKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDH--IRLIIARPIPNCSSPEYCGSMSII 907
            W  + ++VEL     GLGFS++       +  T ++IRS+  G VA+R+G L  GD LM++++ ++ G + +    +L+ S+D+  +R+ +A+P+P     E CG ++ I
Sbjct:  596 WEKDAQVVELEKGELGLGFSILDYQDPEDATKTVLIIRSLVPGGVADRDGRLLPGDRLMFVNETDLEGSSLDYAVHVLK-STDYGPVRIGVAKPLPL----ELCGGLTPI 700          

HSP 14 Score: 59.3066 bits (142), Expect = 6.998e-8
Identity = 34/82 (41.46%), Postives = 47/82 (57.32%), Query Frame = 2
Query: 2255 GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRK 2500
            GLGI+L G+ D     G   +    + ++   GP GLDG  + GDELLE NGK L+G  YQ   T + + P++V+IV  R K
Sbjct: 1213 GLGITLAGSKD-----GSRARLSVCVASVDPQGPTGLDGRIQVGDELLEINGKILYGRSYQNASTIISNAPSKVKIVLIRNK 1289          

HSP 15 Score: 56.225 bits (134), Expect = 4.881e-7
Identity = 86/393 (21.88%), Postives = 163/393 (41.48%), Query Frame = 2
Query: 4487 FAEDTNLV--SGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEI--------EAIRNGHKSSTDESGKVMNIEIDKQGK-KGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKK--------CQMESEKIMLTIKRHPDNLVKMAC--IPASVN-----TSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAG---IYVKKVTVDGIAANEGTLREGDRILLIND 5578
            +  D N V  +G+ +  I   S  ++ G+++IGD +LSV+G+ L   S   A+  ++  T P       LV + +++   A +LS   L D    +Q+PL         +   +    S  KA   KI +            ++ ++    PD  +         E +R   + +     +V   ++ +  +  G+G+ L    +  + + Y+C           G+++IGD +L++N I ++G +H  V  I+K+        C       +   +   DN V+++   + A  N       V PC  +E+  +         S        D   V LEK   G GF I+D    ++A    + ++ +   G+A  +G L  GDR++ +N+
Sbjct:  293 YVGDLNSVYSAGVMVKSIAKGSTVDQDGRMHIGDIILSVDGVSLQGCSEQRAMEVLRR-TGP-------LVRLRLLRK--AERLSPSFLQD-PPLQQQPL---------RHSHSFHEGSAFKAGLGKIQETGICSLREISRQAAYASRRPPPDFKDGVKLSPEDEENLRKRWQHAVGPRYEVTVCQLQRFSETSGLGISL----EARAGHHYLCSILPEGPVGQSGKILIGDRILEVNGIPLVGETHKEVVNILKELPRSVHLVCSRVVPPSIPESEEDDDNDVQLSLKELLAEFNDKLDQGCVIPCPTAEDITKRGVPP---MSPPLAMWEKDAQVVELEKGELGLGFSILDYQDPEDATKTVLIIRSLVPGGVADRDGRLLPGDRLMFVNE 658          

HSP 16 Score: 53.5286 bits (127), Expect = 3.375e-6
Identity = 26/81 (32.10%), Postives = 47/81 (58.02%), Query Frame = 2
Query:  623 VELLNDRCGLGFSLMGSKST---GVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
            +E+     GLG S++G   T    V+I  +  G  A+R+G L+ GD ++ ++ I++R  T ++  A+LR ++  +RL I R
Sbjct: 1472 IEIHKGNVGLGLSIVGGCDTLLGAVIIHEVNDGGAAQRDGRLQAGDQILEVNSIDLRQATHDEAIAVLRLTTQQVRLCIFR 1552          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: ENSORLT00000033630.1 (pep primary_assembly:ASM223467v1:4:6346408:6376678:1 gene:ENSORLG00000026891.1 transcript:ENSORLT00000033630.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 127.872 bits (320), Expect = 1.091e-31
Identity = 81/204 (39.71%), Postives = 120/204 (58.82%), Query Frame = 2
Query: 5972 PPTKTLTQKEHPTKAQIIPGVETVIELTKDR-GLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNI 6580
            PP      +    +   + G    +EL KDR GLGLS+ G  D    ++    V+E+ AAA DGRLWAGD+IL VNG DLR A+H++AI  LR    +V+L I RD+    ++      +V+L K+S +GLG++IV KS  GV IS++   ++   DGRLK+GD +L +N  +++  T +Q  T+LK+  G V L    L++ I
Sbjct:   18 PPPVVSAAERWCERYGDLHGELLCVELDKDRHGLGLSLAGNRDRSCLSIF---VYEEGAAAKDGRLWAGDQILEVNGVDLRGASHEEAIAALRQTPAKVRLTILRDEAQDRDEENLDVFEVELQKRSGRGLGLSIVGKS--GVFISEVGAAAV---DGRLKRGDQILSVNGESLQGVTHEQAVTILKKQRGTVNLTDAGLKAFI 213          

HSP 2 Score: 76.2554 bits (186), Expect = 4.104e-14
Identity = 66/222 (29.73%), Postives = 106/222 (47.75%), Query Frame = 2
Query: 4985 DESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEK-SVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDEL---VVNEDYDSVLKRLRGCKN 5638
            D  G+++ +E+DK  + G+GL L GN+D S ++ ++    +   AA DG+L  GD++L++N +D+ G SH      I   +    K+ LTI R                                 DE Q     NL    D+F V L+K S +G G  I+      ++G+++ +V   G AA +G L+ GD+IL +N E    V +E   ++LK+ RG  N
Sbjct:   34 DLHGELLCVELDKD-RHGLGLSLAGNRDRSCLSIFV---YEEGAAAKDGRLWAGDQILEVNGVDLRGASHEEA---IAALRQTPAKVRLTILR---------------------------------DEAQDRDEENL----DVFEVELQKRSGRGLGLSIV-----GKSGVFISEV---GAAAVDGRLKRGDQILSVNGESLQGVTHEQAVTILKKQRGTVN 203          

HSP 3 Score: 58.151 bits (139), Expect = 3.755e-8
Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 2
Query:  608 AELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIAR 856
             EL  VEL  DR GLG SL G++    +   ++    A ++G L  GD ++ ++ +++RG + E+  A LRQ+   +RL I R
Sbjct:   37 GELLCVELDKDRHGLGLSLAGNRDRSCLSIFVYEEGAAAKDGRLWAGDQILEVNGVDLRGASHEEAIAALRQTPAKVRLTILR 119          

HSP 4 Score: 57.3806 bits (137), Expect = 7.316e-8
Identity = 43/100 (43.00%), Postives = 57/100 (57.00%), Query Frame = 2
Query: 6044 IELTK--DRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDL 6337
            +EL K   RGLGLSI+G S      V I EV    AAA+DGRL  GD+IL+VNG+ L+  TH+QA+  L+     V L     K  + +    F LK++L
Sbjct:  135 VELQKRSGRGLGLSIVGKS-----GVFISEV---GAAAVDGRLKRGDQILSVNGESLQGVTHEQAVTILKKQRGTVNLTDAGLKAFIKQSHNIFGLKMNL 226          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Match: lnx2a (ligand of numb-protein X 2 [Source:NCBI gene;Acc:101160604])

HSP 1 Score: 107.071 bits (266), Expect = 1.105e-22
Identity = 81/252 (32.14%), Postives = 131/252 (51.98%), Query Frame = 2
Query: 5900 IQKVLNNQSITKKVSVNEQVI-QEVPPTKTLTQKEHPTKAQIIP-GVETVIELTKDRG---LGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ------------------PLCE-----DSLYFKLKVDLLKK-SRKGLGITIVSKSD-VGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            +++ L+N  I    SV+      + P +  L+ +E   K   +P G  T IE+ +      LG+S++GG++T L  V+I EV+     A DGRL AGD+IL VN  D+ N  H  A  TL      ++L + R+++                  P C       S   KL++ L K+ S + LGI +V ++D  GV + DL++G +A +DGRL+  D LL +ND ++R  T +Q A +++     V+L++GR
Sbjct:  225 VKRPLSNPCIHLLRSVSSTSSGWDCPESPPLSAEEGCVKLPSLPEGEITTIEVHRANPYVELGISVVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHSFARSTLSRPCTTLQLTVLRERRCASRAPPSSSSSTPAVPHPPCSTPDGTPSSPTKLRITLHKRDSTEQLGIKLVRRTDESGVFVLDLLEGGLAAKDGRLRSNDRLLAVNDQDLRHGTPEQAAQIIQASGERVYLLIGR 476          

HSP 2 Score: 59.3066 bits (142), Expect = 5.100e-8
Identity = 52/226 (23.01%), Postives = 104/226 (46.02%), Query Frame = 2
Query: 4994 GKVMNIEIDKQGKK-GMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSV--APCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGR 5662
            G++  IE+ +      +G+ +VG  +   +N  I     + V A DG+L+ GD++L++N++D+  + HS     + +       + LT+ R      +     +S   +V   PC         ST +   SS   L+       +H   S +  G  ++     DE+G++V  +   G+AA +G LR  DR+L +ND+ + +   +   + ++     + +++GR
Sbjct:  270 GEITTIEVHRANPYVELGISVVGGNETPLINVVIQEVYRDGVIARDGRLLAGDQILQVNNVDISNVPHSFARSTLSR---PCTTLQLTVLRERRCASRAPPSSSSSTPAVPHPPC---------STPDGTPSSPTKLR-----ITLHKRDSTEQLGIKLV--RRTDESGVFVLDLLEGGLAAKDGRLRSNDRLLAVNDQDLRHGTPEQAAQIIQASGERVYLLIGR 476          

HSP 3 Score: 55.8398 bits (133), Expect = 5.488e-7
Identity = 53/202 (26.24%), Postives = 90/202 (44.55%), Query Frame = 2
Query: 6068 LGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP----------------------------------LCEDSLYFKL---------KVDLLKKSRKGLGITIV----SKS-DVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLK 6529
            LG+ ++  +D     V + ++ E   AA DGRL + DR+LAVN +DLR+ T +QA Q +++ G RV L I R  +P                                  L   S +  L          + + K+  + LG+T+     SKS ++ + ++ +       +DGR+K+GD+LL IN  ++   +  +    LK
Sbjct:  407 LGIKLVRRTDE--SGVFVLDLLEGGLAAKDGRLRSNDRLLAVNDQDLRHGTPEQAAQIIQASGERVYLLIGRPSKPTPPPPPKSSSTRDLYCLEHFLPNHSSTPSPVPIHLSRTSTHRDLSQCVSCKEKHITVKKEPHESLGMTVAGGRGSKSGELPIFVTSVQPHGCLSRDGRIKRGDVLLSINSQDLTYLSHSEAVGTLK 606          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000053393.1 (SMESG000053393.1)

HSP 1 Score: 3825.4 bits (9919), Expect = 0.000e+0
Identity = 2013/2046 (98.39%), Postives = 2021/2046 (98.78%), Query Frame = 2
Query:  446 MIGDQVPDASLHLNIDFNESLVSISNILNFCGNPLSGLSETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPVSDLKAMQLYQQISVTDADQEAANIYQEHNLLQLVQTQLPPAIFQSTINTHYQTEIPMRRVAGEPETQKSEKSLGEKSLENGSSLNNINVSENIHCSNAADINFTLSVKHNDSRNARSTSLDNDTEEANLRENELHPSRLXXXXXXXXXXXXXKVRTKHRIRINEQNEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTAKXXXXXXXXXXXXXXXLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVPPSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLSRSSSTMLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYHSLDQMQEIFTHHPGFRSGSFLCHTDTAAKYHPKADNKIIYEDSYRYPIMSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSGPILVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNSLQRVINTDVRLYQITTCIVQQTLHNAAIYLRDHCNTIVLLPCSSSELSEKEIAFQSVSSTRENFIDAESTVLQXXXXXXXXXXXXXXXXNSNKSDPNINLINYHNLTSSDFNHFKGELEKSCSTIRSDDEYGLKMKIISEQTXXXXXXXXXXXXXXIDCLDELEVTKISESDTDAMIHYWXXXXXXXXXXXXXTGIIDINAMKKWVYXXXXXXXXXXXXXXFCEVGYPLLYTPETKLNFQDICSPGDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPPNSPDKATSNKINQNETDEKXXXXXXXXXXXXXXTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 6583
            MIGDQVPDASLHLNIDFNESLVSISNILNFCGNPLSGLSETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPVSDLKAMQLYQQISVTDADQEAANIYQEHNLLQLVQTQLPPAIFQSTINTHYQTEIPMRRVAGEPETQKSEKSLGEKSLENGSSLNNINVSENIHCSNAADINFTLSVKHNDSRNARSTSLDNDTEEANLRENELHPSRLATSASTISSPNSSKVRTKHRIRINEQNEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSG VKLKFNRYTKGPVYEILTQTAKSSHTVSSISQSSSNSLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVPPSAQLANSSSEDEAEISILDFPLNQR AKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLSRSSSTMLYDDFIDDDESDEYYDENDVDNDNISIDVDYHSLDQMQEIFTHHPGFRSGSFLCHTDTAAKYHPKADNKIIYEDSYRYPIMSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSGPILVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNSLQRVINTDVRLYQITTCIVQQTLHNAAIYLRDHCNTIVLLPCSSSELSEKEIAFQS+SSTRENFIDAESTVLQSSISSESSTPR                     ++ ++FNHFKGELEKSCSTIRSDDEYGLKMKIISEQTSSKTPSSDINSSSSIDCLDELEVTKISESDTDAMIHYWKKSEKVESGEVKSTGIID+NAMKKWVYLTLDKTSLDLDTTKFCEVGYPLLYTPETKLNFQDICSPGDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIY+KSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTP NSPDKATSNKINQNETDEKENSFSVSSLSNESVTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIIND+RKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY
Sbjct:    1 MIGDQVPDASLHLNIDFNESLVSISNILNFCGNPLSGLSETTVDHSTDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLPVSDLKAMQLYQQISVTDADQEAANIYQEHNLLQLVQTQLPPAIFQSTINTHYQTEIPMRRVAGEPETQKSEKSLGEKSLENGSSLNNINVSENIHCSNAADINFTLSVKHNDSRNARSTSLDNDTEEANLRENELHPSRLATSASTISSPNSSKVRTKHRIRINEQNEFHEYTTYLTKGEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEINDQSVIGLDNPAVVEILKLTSGTVKLKFNRYTKGPVYEILTQTAKSSHTVSSISQSSSNSLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNNCPENIDVSVVPPSAQLANSSSEDEAEISILDFPLNQRPAKENTTKTDVLIANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINKTNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLSRSSSTMLYDDFIDDDESDEYYDENDVDNDNISIDVDYHSLDQMQEIFTHHPGFRSGSFLCHTDTAAKYHPKADNKIIYEDSYRYPIMSKAKSDNSIFVKSNSFSEMLPIKTLTANRSLQYLKDVAMWSGPILVELTKESQGLGFSIEYYQDASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIGSTYNSLQRVINTDVRLYQITTCIVQQTLHNAAIYLRDHCNTIVLLPCSSSELSEKEIAFQSISSTRENFIDAESTVLQSSISSESSTPR-------------------REISPNNFNHFKGELEKSCSTIRSDDEYGLKMKIISEQTSSKTPSSDINSSSSIDCLDELEVTKISESDTDAMIHYWKKSEKVESGEVKSTGIIDLNAMKKWVYLTLDKTSLDLDTTKFCEVGYPLLYTPETKLNFQDICSPGDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYKKSSDWLPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKKSIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAEDTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISYIKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSKSDMLKKKLTTPLNSPDKATSNKINQNETDEKENSFSVSSLSNESVTPDLSEIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNLQGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDDRKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIY 2027          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000056186.1 (SMESG000056186.1)

HSP 1 Score: 241.121 bits (614), Expect = 1.773e-67
Identity = 181/549 (32.97%), Postives = 283/549 (51.55%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDEN------QISSNNNLQ-----GYGDIFH-----------VHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSV-NEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLK-VDLLKKSRKGLGITIVSKSDV-GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            ++NI   +     +GL L GNKD + MN +IC    NS+A +DG+L +GDE+L+++   + G SH N  P+I+ C    + I   I R  +   KMA +P ++      C     +V +S  E+       +S  NN +       G I +           V+L K+ QG GF IM+ +  +E GIY+K + V G A  EG+LR GD+++ IN + V +  YD VL+ L+  KN + +VV R+  S   + ++ +   PI     + +    I + P    P   SP I +E+  S+  P I     P   S        ++ K +++ +  ++ SV N Q +  V     L   E   K + I      I+  +D  LG+SIIGGSDT +G V++H++    A A DGR+  GDRIL +N   L N T+++ I  L   G  + LKI  +  P+ +  +Y  +  V++ KK  KGLGI+++ +    GV I D+VKG +A+ DGRLK GD +LEIN  + R+ TQ+  AT LK   G +   +GR++
Sbjct:   28 LLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCS--GKLIKFVIHRSNEWQSKMA-VPITIR-----CADEIQSVVSSRRESVVDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGS---PIHNHYPKRLSAPHITALPYYNRPK--SPTIQEEKSESS-SPGILIKLSPESES-----GLATLAKSMSDGNSRRRSSVTNTQSLDIV--NLLLNNLEDDEKTENI-----YIKRNED-ALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 549          

HSP 2 Score: 56.9954 bits (136), Expect = 1.473e-7
Identity = 38/104 (36.54%), Postives = 59/104 (56.73%), Query Frame = 2
Query: 5987 LTQKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ 6292
            +  ++ P   Q I  V + +E+TK   +GLG+S+IG        V I +V +   A +DGRL  GD+IL +NG+D RN T + A   L+S+  ++  KI R +Q
Sbjct:  449 IRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGA--KGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQ 550          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000056186.1 (SMESG000056186.1)

HSP 1 Score: 242.662 bits (618), Expect = 2.831e-66
Identity = 181/549 (32.97%), Postives = 284/549 (51.73%), Query Frame = 2
Query: 5000 VMNIEIDKQGKKGMGLLLVGNKDCSSMNCYICGFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKIMLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDEN------QISSNNNLQ-----GYGDIFH-----------VHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTLREGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNIETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSISHDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSV-NEQVIQEVPPTKTLTQKEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQPLCEDSLYFKLK-VDLLKKSRKGLGITIVSKSDV-GVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLR 6571
            ++NI   +     +GL L GNKD + MN +IC    NS+A +DG+L +GDE+L+++   + G SH N  P+I+ C    + I   I R  +   KMA +P ++      C     +V +S  E+       +S  NN +       G I +           V+L K+ QG GF IM+ +  +E GIY+K + V G A  EG+LR GD+++ IN + V +  YD VL+ L+  KN + +VV R+  S   + ++ +   PI     + +    I + P    P   SP I +E+  S+  P I      I  S   +    ++ K +++ +  ++ SV N Q +  V     L   E   K + I      I+  +D  LG+SIIGGSDT +G V++H++    A A DGR+  GDRIL +N   L N T+++ I  L   G  + LKI  +  P+ +  +Y  +  V++ KK  KGLGI+++ +    GV I D+VKG +A+ DGRLK GD +LEIN  + R+ TQ+  AT LK   G +   +GR++
Sbjct:  229 LLNIPNPRLSNCSLGLKLTGNKDLNHMNIFICQIVPNSIADIDGRLQVGDEILEVDDHILFGRSHLNATPVIRSCS--GKLIKFVIHRSNEWQSKMA-VPITIR-----CADEIQSVVSSRRESVVDCLSAVSDQNNSRKASSVSLGQIPYIPSISTEETHIVYLTKNAQGLGFAIMEGSFTNETGIYIKHLAVQGPAIQEGSLRPGDKLISINHQDVSSASYDMVLELLKNVKNQVRLVVARVRCSNSPSHSVGS---PIHNHYPKRLSAPHITALPYYNRPK--SPTIQEEKSESS-SPGIL-----IKLSPESESGLATLAKSMSDGNSRRRSSVTNTQSLDIV--NLLLNNLEDDEKTENI-----YIKRNED-ALGISIIGGSDTFIGDVIVHDIFPNGAVAKDGRIKVGDRILVINEIQLINKTNEEIITMLHEAGAELHLKIRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGAKGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQ 750          

HSP 2 Score: 58.151 bits (139), Expect = 8.726e-8
Identity = 38/104 (36.54%), Postives = 59/104 (56.73%), Query Frame = 2
Query: 5987 LTQKEHPTKAQIIPGVETVIELTK--DRGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQ 6292
            +  ++ P   Q I  V + +E+TK   +GLG+S+IG        V I +V +   A +DGRL  GD+IL +NG+D RN T + A   L+S+  ++  KI R +Q
Sbjct:  650 IRHEDTPIPDQDIYEVVSTVEITKKPSKGLGISVIGREGA--KGVYICDVVKGGVADVDGRLKPGDQILEINGEDFRNETQEIAATRLKSLMGQIVFKIGRIQQ 751          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000056195.1 (SMESG000056195.1)

HSP 1 Score: 110.538 bits (275), Expect = 9.544e-24
Identity = 59/110 (53.64%), Postives = 76/110 (69.09%), Query Frame = 2
Query: 2186 STWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVD 2509
            + W K I GN +I+I+  +K  E  GLGISLEGTVDV+D  GLE  PHHYIR+IT +GP G +G  K  DELLEAN K+++G+ + E +  LK+LP  V+IV AR   VD
Sbjct:  532 TKWKKRIDGNREIIIAEFSKFTEDGGLGISLEGTVDVED-NGLEVHPHHYIRSITPNGPAGRNGFLKVKDELLEANDKRIYGLNHLEAVNVLKNLPLSVRIVVARAVPVD 640          

HSP 2 Score: 105.916 bits (263), Expect = 2.537e-22
Identity = 49/126 (38.89%), Postives = 79/126 (62.70%), Query Frame = 2
Query:  584 TDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLP 961
            T  L+TEW + EI++L +     GF +MG  ++ V++R+I +G  A+ +G ++I DH+MYI+DI VR ++S QVA IL+     ++LI+ARP    SS    G + ++ T  +D  L+ +VN L P
Sbjct:  233 TRELSTEWTQYEIIDLKSYNGSFGFGIMGGLTSEVMVRNILNGGAADMDGRIQIDDHIMYINDIPVRHLSSNQVAEILKNQVSEVKLIVARPFDQTSSSTNTGKVQMVETVNLDSRLEMIVNQLYP 358          

HSP 3 Score: 85.8853 bits (211), Expect = 3.204e-16
Identity = 49/109 (44.95%), Postives = 67/109 (61.47%), Query Frame = 2
Query: 2861 TANRSLQYLKDVAMWSGPI-LVELTKESQGLGFSIEYYQD-ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            + +RSL  +  +A+W   +  V+L K S GLGFS+  YQD       VIVI SLVPNG A  DGRI PGDRL+ +N ++V + ++  E +EAL+    G V LGI K +
Sbjct:  699 SRSRSLDQVHGLAIWDRQVTYVDLEKRSNGLGFSVLDYQDPVDPQQSVIVIRSLVPNGAASRDGRIFPGDRLMSVNNIDV-SRANMTEAVEALKKTEPGIVRLGIVKAL 806          

HSP 4 Score: 52.7582 bits (125), Expect = 4.191e-6
Identity = 61/238 (25.63%), Postives = 103/238 (43.28%), Query Frame = 2
Query: 5936 KVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETV--IELTKD---RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRN--ATHDQAIQTLRSVGNRVKLKIFRDKQ----PLCEDSLYFKLKVDL-----------------LKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            K  +++ +I   P    L+ +E   + Q + G   +  I+L+KD   + LG SI          + I +V         G L   D+I+A+NG  L +     D A+Q L+S   R+ L + RD       L ++  + + + D+                 LK      G  I+      V + +++ G  A+ DGR++  D ++ IND  VR  + +QVA +LK     V L+V R
Sbjct:   87 KECLDKPIISPKPKKLVLSGEELKIRLQKLCGNRELLHIQLSKDSVSQTLGFSIKCSGSLHANGIFIEDVAVGTIGEQSG-LKRYDQIIAINGVPLDDPDTNRDIALQALKSNHLRIDLYLARDVSKNTLALAKEHGHTRNRSDIGLTRELSTEWTQYEIIDLKSYNGSFGFGIMGGLTSEVMVRNILNGGAADMDGRIQIDDHIMYINDIPVRHLSSNQVAEILKNQVSEVKLIVAR 323          
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Match: SMESG000056195.1 (SMESG000056195.1)

HSP 1 Score: 110.153 bits (274), Expect = 1.102e-23
Identity = 59/110 (53.64%), Postives = 76/110 (69.09%), Query Frame = 2
Query: 2186 STWNKIIGGNYDILISYINKTNE--GLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDELLEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVD 2509
            + W K I GN +I+I+  +K  E  GLGISLEGTVDV+D  GLE  PHHYIR+IT +GP G +G  K  DELLEAN K+++G+ + E +  LK+LP  V+IV AR   VD
Sbjct:  548 TKWKKRIDGNREIIIAEFSKFTEDGGLGISLEGTVDVED-NGLEVHPHHYIRSITPNGPAGRNGFLKVKDELLEANDKRIYGLNHLEAVNVLKNLPLSVRIVVARAVPVD 656          

HSP 2 Score: 105.531 bits (262), Expect = 2.620e-22
Identity = 49/126 (38.89%), Postives = 79/126 (62.70%), Query Frame = 2
Query:  584 TDMLNTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRIGDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGSMSIIPTDQIDQHLDFLVNTLLP 961
            T  L+TEW + EI++L +     GF +MG  ++ V++R+I +G  A+ +G ++I DH+MYI+DI VR ++S QVA IL+     ++LI+ARP    SS    G + ++ T  +D  L+ +VN L P
Sbjct:  233 TRELSTEWTQYEIIDLKSYNGSFGFGIMGGLTSEVMVRNILNGGAADMDGRIQIDDHIMYINDIPVRHLSSNQVAEILKNQVSEVKLIVARPFDQTSSSTNTGKVQMVETVNLDSRLEMIVNQLYP 358          

HSP 3 Score: 85.8853 bits (211), Expect = 3.320e-16
Identity = 49/106 (46.23%), Postives = 65/106 (61.32%), Query Frame = 2
Query: 2870 RSLQYLKDVAMWSGPI-LVELTKESQGLGFSIEYYQD-ASSNVPVIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLSKGQVLLGIAKPM 3181
            RSL  +  +A+W   +  V+L K S GLGFS+  YQD       VIVI SLVPNG A  DGRI PGDRL+ +N ++V + ++  E +EAL+    G V LGI K +
Sbjct:  718 RSLDQVHGLAIWDRQVTYVDLEKRSNGLGFSVLDYQDPVDPQQSVIVIRSLVPNGAASRDGRIFPGDRLMSVNNIDV-SRANMTEAVEALKKTEPGIVRLGIVKAL 822          

HSP 4 Score: 52.7582 bits (125), Expect = 4.002e-6
Identity = 61/238 (25.63%), Postives = 103/238 (43.28%), Query Frame = 2
Query: 5936 KVSVNEQVIQEVPPTKTLTQKEHPTKAQIIPGVETV--IELTKD---RGLGLSIIGGSDTILGTVMIHEVHEKEAAALDGRLWAGDRILAVNGKDLRN--ATHDQAIQTLRSVGNRVKLKIFRDKQ----PLCEDSLYFKLKVDL-----------------LKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGRLKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGR 6565
            K  +++ +I   P    L+ +E   + Q + G   +  I+L+KD   + LG SI          + I +V         G L   D+I+A+NG  L +     D A+Q L+S   R+ L + RD       L ++  + + + D+                 LK      G  I+      V + +++ G  A+ DGR++  D ++ IND  VR  + +QVA +LK     V L+V R
Sbjct:   87 KECLDKPIISPKPKKLVLSGEELKIRLQKLCGNRELLHIQLSKDSVSQTLGFSIKCSGSLHANGIFIEDVAVGTIGEQSG-LKRYDQIIAINGVPLDDPDTNRDIALQALKSNHLRIDLYLARDVSKNTLALAKEHGHTRNRSDIGLTRELSTEWTQYEIIDLKSYNGSFGFGIMGGLTSEVMVRNILNGGAADMDGRIQIDDHIMYINDIPVRHLSSNQVAEILKNQVSEVKLIVAR 323          
The following BLAST results are available for this feature:
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPDZ1.864e-10133.88multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ7.679e-9831.96multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ7.679e-9831.96multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ2.657e-9733.82multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ3.132e-9731.82multiple PDZ domain crumbs cell polarity complex c... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mpz-18.577e-4650.27Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-13.043e-4450.27Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-17.856e-4450.27Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-18.187e-4450.27Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
mpz-18.385e-4450.27Multiple PDZ domain protein [Source:UniProtKB/TrE... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Patj3.279e-4333.33gene:FBgn0067864 transcript:FBtr0072781[more]
Patj3.279e-4333.33gene:FBgn0067864 transcript:FBtr0301625[more]
Patj3.279e-4333.33gene:FBgn0067864 transcript:FBtr0072779[more]
CG158035.969e-2753.85gene:FBgn0038606 transcript:FBtr0302308[more]
CG158036.306e-2753.85gene:FBgn0038606 transcript:FBtr0345256[more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
patj1.643e-4931.52PATJ crumbs cell polarity complex component [Sourc... [more]
patj1.022e-4531.44PATJ crumbs cell polarity complex component [Sourc... [more]
patj1.022e-4531.44PATJ crumbs cell polarity complex component [Sourc... [more]
si:dkey-92j12.58.971e-4142.44si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
si:dkey-92j12.59.734e-4142.44si:dkey-92j12.5 [Source:ZFIN;Acc:ZDB-GENE-090313-3... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
iffo24.961e-5427.05intermediate filament family orphan 2 [Source:Xenb... [more]
iffo26.256e-5426.75intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.764e-5354.36intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.790e-5354.36intermediate filament family orphan 2 [Source:Xenb... [more]
iffo21.877e-5354.36intermediate filament family orphan 2 [Source:Xenb... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mpdz7.835e-9632.98multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz8.221e-9632.85multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz8.395e-9632.85multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Mpdz8.525e-9632.85multiple PDZ domain protein [Source:MGI Symbol;Acc... [more]
Patj5.796e-4849.23PATJ, crumbs cell polarity complex component [Sour... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O55164|MPDZ_RAT2.349e-9834.56Multiple PDZ domain protein OS=Rattus norvegicus O... [more]
sp|O75970|MPDZ_HUMAN1.504e-9631.82Multiple PDZ domain protein OS=Homo sapiens OX=960... [more]
sp|Q8VBX6|MPDZ_MOUSE5.963e-9532.85Multiple PDZ domain protein OS=Mus musculus OX=100... [more]
sp|F1MAD2|INADL_RAT2.677e-5228.93InaD-like protein OS=Rattus norvegicus OX=10116 GN... [more]
sp|Q8NI35|INADL_HUMAN1.561e-4831.54InaD-like protein OS=Homo sapiens OX=9606 GN=PATJ ... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2J8XHZ67.711e-9933.88MPDZ isoform 9 OS=Pongo abelii OX=9601 GN=CR201_G0... [more]
A0A1S3KGP99.518e-9934.96multiple PDZ domain protein isoform X5 OS=Lingula ... [more]
A0A1S3KHV89.657e-9934.96multiple PDZ domain protein isoform X4 OS=Lingula ... [more]
A0A1S3KGN91.180e-9834.86multiple PDZ domain protein isoform X3 OS=Lingula ... [more]
A0A1S3KGP41.254e-9834.86multiple PDZ domain protein isoform X1 OS=Lingula ... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000041966.15.931e-5249.30pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000037958.16.122e-5249.30pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
ENSAMXT00000021866.26.562e-5249.30pep primary_assembly:Astyanax_mexicanus-2.0:21:128... [more]
patj1.429e-5034.45PATJ crumbs cell polarity complex component [Sourc... [more]
lnx2a9.498e-1933.52ligand of numb-protein X 2a [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000004677.11.133e-3749.37pep scaffold:Pmarinus_7.0:GL479538:28591:32639:-1 ... [more]
ENSPMAT00000005746.13.733e-1533.33pep scaffold:Pmarinus_7.0:GL479493:17594:33348:1 g... [more]
ENSPMAT00000002205.11.429e-1126.76pep scaffold:Pmarinus_7.0:GL477144:51012:68257:1 g... [more]
ENSPMAT00000009934.15.725e-1128.96pep scaffold:Pmarinus_7.0:GL479331:74:24469:1 gene... [more]
ENSPMAT00000005799.12.457e-1033.33pep scaffold:Pmarinus_7.0:GL476764:271684:300503:1... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO337062.428e-2046.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460593.638e-1833.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456241.204e-1736.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334323.102e-1631.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458872.731e-1324.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MPDZ8.691e-5351.28multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ4.361e-5051.28multiple PDZ domain crumbs cell polarity complex c... [more]
MPDZ3.454e-4146.39multiple PDZ domain protein-like [Source:NCBI gene... [more]
ENSORLT00000033630.11.091e-3139.71pep primary_assembly:ASM223467v1:4:6346408:6376678... [more]
lnx2a1.105e-2232.14ligand of numb-protein X 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Multiple PDZ domain crumbs cell polarity complex component vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000053393.10.000e+098.39SMESG000053393.1[more]
SMESG000056186.11.773e-6732.97SMESG000056186.1[more]
SMESG000056186.12.831e-6632.97SMESG000056186.1[more]
SMESG000056195.19.544e-2453.64SMESG000056195.1[more]
SMESG000056195.11.102e-2353.64SMESG000056195.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025821 ID=SMED30025821|Name=Multiple PDZ domain crumbs cell polarity complex component|organism=Schmidtea mediterranea sexual|type=transcript|length=6749bp
CGATCTATGGAAAGAAAGCTATGCCAACCAAAAATCAACTGAAGTTCACA
TTCGCCGTTAAATAGGATATACAAACATAGACATTAGTCGAAATAGAAAA
TCTCTTCTGCTGTATAATCGCTGTCTACTTTAGGAGAGAGAAATATTGTT
ACACACACATGCACACAATTGAAATCACTTTGCATTAGGATGTGTGCAAA
TCGGTAGGCTCCCAATGATTCTCTTGTACAAATCTGATTGTGTGTATTTG
TGTGTCTGTGTATGAGTGTGTGTATCATTTGGAAATTTATTGGACATTTT
CTCAATATTATTTGTCAATAATTTTATAATAACCTTGAACTATTTATTAG
TCAATATCATTAATGTATTACTTGTCAACGCAAGATTGTGAATTTGTCAA
AATCAGGATTTATAATGAAATTAATTGACAAATTAATTTTATCTTATGAT
CGGTGATCAAGTACCAGACGCTTCACTGCACTTAAATATCGATTTTAATG
AAAGTTTGGTATCAATTTCAAATATTTTAAATTTCTGTGGAAACCCATTG
AGTGGACTCAGTGAAACAACAGTAGACCATTCAACTGACATGCTCAATAC
CGAATGGGCAGAACTGGAAATTGTTGAATTACTCAATGACCGCTGTGGAC
TCGGGTTCAGTTTGATGGGGAGCAAAAGCACTGGAGTAGTTATACGTTCA
ATTTTCTCTGGCAGTGTAGCTGAACGGAATGGTCATTTGAGAATTGGCGA
CCATTTGATGTACATTGATGATATCAATGTGCGAGGAATGACGAGTGAAC
AGGTTGCTGCGATTCTTCGACAATCGTCTGATCACATTCGTCTAATAATC
GCCAGACCCATTCCAAATTGCTCCAGTCCTGAATACTGTGGATCAATGAG
TATCATCCCCACTGATCAAATTGACCAGCATTTGGATTTCCTTGTGAACA
CTTTACTCCCGGTCAGTGACCTAAAGGCCATGCAGCTTTATCAGCAGATC
TCAGTCACTGACGCCGATCAAGAGGCAGCTAATATTTATCAGGAACACAA
TTTATTGCAGCTTGTTCAAACACAACTCCCTCCTGCCATTTTTCAAAGTA
CTATAAATACTCATTACCAAACAGAAATTCCGATGAGAAGGGTTGCAGGT
GAACCGGAAACACAAAAGTCAGAGAAGTCTCTCGGTGAGAAATCGTTGGA
AAATGGATCAAGTCTGAACAACATAAATGTCAGCGAAAATATTCACTGTA
GTAATGCAGCAGACATCAATTTCACATTGTCTGTTAAGCATAATGACTCC
CGAAACGCCAGAAGTACCAGTTTGGACAATGATACTGAAGAAGCAAATTT
ACGAGAGAACGAGTTACATCCGAGCCGATTGGCAACTAGTGCAAGCACGA
TTTCCTCGCCTAACAGTAGTAAAGTTCGAACGAAGCATCGGATTAGAATC
AATGAGCAGAATGAATTCCATGAATATACAACATATTTAACCAAAGGTGA
ACAAGGTCTGGGTCTAACTATTGCTGGTTACATAACATGCAGACCAGAAG
TGAATATTCACGGAATTTTCGTCAAATCCATATCAAAGAACAGCGTAGCA
GATTTGAATGGCCAGATCGTCATCAATGATCAAATCATCGAAATAAATGA
TCAGTCAGTTATTGGCTTAGATAATCCTGCTGTCGTTGAAATTTTGAAGC
TGACTTCTGGGATTGTGAAATTGAAATTTAATCGGTACACAAAAGGTCCA
GTTTACGAAATTCTAACACAAACCGCCAAATCATCTCATACTGTCAGTTC
AATTTCCCAATCTTCCTCGAATTCCTTGATACATACGAAGTCAAACTCCT
CAATTAACAACAGCATGAAAACCACAAATGAAACTTTGACTCTGCAGCCG
ATGATATACACGATCCTTTCAAATGATGAGAGCCCAGTAAACAATTGCCC
CGAAAATATCGACGTTAGTGTAGTTCCCCCCTCAGCTCAATTGGCCAACT
CATCAAGTGAGGATGAAGCTGAAATTTCCATTTTGGATTTTCCATTAAAT
CAAAGACTGGCTAAGGAAAACACGACAAAAACCGACGTGCTTATAGCCAA
TATCTTGCCCAACAGTGGATTCAACGTCCAGAAAATGAATTTGAAATACG
CTTCTATTGACAAGACGATTGAAGACACAATTAAGTCGACATGGAATAAA
ATTATTGGCGGCAATTACGATATTTTGATATCTTACATAAATAAAACTAA
TGAAGGTCTTGGGATAAGCTTAGAAGGAACTGTTGATGTTGACGATGTAA
CTGGATTGGAAGATAAACCGCACCATTATATTCGGACAATCACAGCTGAT
GGCCCAATCGGATTAGATGGCACATTTAAATCTGGAGATGAATTACTTGA
GGCCAATGGGAAAAAATTACACGGAGTTCCTTATCAAGAAGTTCTTACTA
GTTTGAAATCTCTTCCAAATCGAGTTCAAATTGTTGCTGCCAGGCGAAAA
GAAGTGGATGTAAGTCAACTCTCTCGGTCATCCTCTACTATGCTATACGA
TGATTTCATTGATGACGATGAATCTGATGAATATTACGATGAAAATGACG
TTGACAACGATAACATTAGCATTGATGTTGATTATCATTCACTGGATCAA
ATGCAAGAAATTTTTACTCATCATCCCGGATTTCGAAGTGGCAGTTTTCT
TTGTCATACCGATACCGCAGCAAAGTATCACCCCAAAGCAGATAACAAAA
TCATTTATGAAGACTCCTATCGATACCCAATTATGTCAAAAGCTAAATCT
GATAATTCTATTTTCGTAAAATCGAATTCATTTTCAGAAATGTTGCCCAT
AAAAACACTCACGGCAAACAGATCTCTGCAATATTTGAAAGATGTTGCCA
TGTGGTCTGGCCCAATACTCGTTGAATTGACTAAAGAATCTCAAGGACTT
GGATTTAGCATAGAATACTATCAAGACGCAAGCTCAAACGTTCCAGTTAT
TGTAATTTCCAGTTTAGTCCCGAATGGAGTGGCTCATTTAGATGGACGTA
TTATTCCAGGTGATAGACTCATCTTCATAAATGAAGTTGAAGTTGATGCT
TTATCATCAAAACAAGAAGTAATAGAAGCTCTCCAATCTCTTTCTAAAGG
TCAGGTATTACTCGGAATTGCTAAACCTATGTTTCCTTCCAGTTACATGT
ATCGAAGTTATTCAAAAGAAACCGTTGAAGAACTATCAACGAGTCAGTCA
TTAGAATACGAACCATTTACACTAGCTGAAGACGCAGCTATTGGTAGCAC
ATACAACTCCCTTCAGAGAGTCATCAATACAGACGTCCGACTCTACCAAA
TCACAACTTGCATAGTTCAACAAACGTTACATAACGCAGCGATCTATCTA
AGAGATCATTGTAATACGATAGTCTTACTTCCATGCTCCTCTTCAGAACT
CTCTGAAAAAGAAATCGCATTTCAGAGTGTCAGTAGCACGAGAGAAAACT
TCATCGATGCAGAAAGTACAGTATTGCAAAGTAGTATAAGCTCAGAATCA
AGTACGCCCAGAAGAGAAATATCACCAAACAGTAATAAATCAGATCCAAA
TATAAATCTTATCAATTATCACAATCTTACTTCATCAGATTTCAATCATT
TCAAAGGAGAATTAGAAAAGTCTTGTAGCACTATTCGATCGGATGATGAA
TATGGATTAAAAATGAAAATTATCAGTGAACAAACATCGTCAAAGACCCC
TTCATCAGACATCAACAGCTCCAGTTCTATTGATTGTCTTGATGAGCTGG
AAGTGACAAAAATTAGCGAAAGTGACACTGATGCCATGATCCATTACTGG
AAGAAATCTGAAAAGGTCGAATCTGGTGAAGTCAAATCAACTGGAATAAT
TGACATAAACGCAATGAAGAAATGGGTCTATCTTACTCTAGACAAAACAT
CTTTGGATCTCGACACGACAAAATTCTGCGAGGTTGGTTACCCTCTTCTG
TATACACCGGAAACAAAATTAAATTTTCAAGATATCTGTTCTCCTGGAGA
CATAATCACAGACATCAACGGACAGAAACTCTCAGAAATCAGACCGGACA
CCATAAGTCTTCTTTTGTCCAGTTATAAGAAAACTGGTGAAAGAATAAAA
ATCGGATATATTTCCGCAGATATATATGAAAAATCTTCAGATTGGTTGCC
GCTTTTGAATTCAACCGAGTTTACGGTTCCCGTCACTCAAAGGATTTATA
AATGCGCATCTAATTCAAATATGGAGAATCAGATAAATGGGCAAAACGAA
AACCGAAACTCTTTCATTAATCTAACTGTTCTTCAAGCCAAAAAAAGTAT
TCAAATGTCAGATAGTTCAATTCATATAAATGGATGGTCGTCTCCAAGAG
TAGTTACTGTAGAAAGAGAACAAAATCAAAGCTTAGGAATAAGTATTTTA
GGAGGGAAAGTTGCAAATGTCAAGGAAAAAGAAGAATTCGCCGAGGATAC
AAATCTCGTCAGTGGAATTTTCATCACTCACATCAATCCGGATTCTCCTG
CCGAAAAGTGTGGCCAGTTGAATATTGGAGACCGTCTTCTCTCAGTCAAC
GGAATAGATCTTATCAAAACATCATACGATGATGCAATTAGCTACATTAA
AAATGCAACTTCACCAATTGTTTTTACCATTCAAAGTTTAGTTGATGTTT
CCATGATGAAAGATAGCGACGCAACGAAACTATCAAATTGCCAATTGTCC
GACTACGAATCCCATGAGCAAGAACCACTTAGCTTAAATTCAAAGAGCGA
TATGTTGAAGAAAAAACTGACGACCCCACCGAATTCTCCGGATAAAGCTA
CAAGTAATAAAATTAATCAAAATGAAACAGATGAAAAAGAAAATAGTTTC
TCAGTTTCTTCTTTATCTAATGAAAGTGTCACCCCGGATTTGTCAGAAAT
TGAAGCCATCAGGAATGGTCATAAATCTTCGACAGATGAATCTGGGAAAG
TAATGAATATAGAAATTGACAAACAGGGGAAAAAAGGTATGGGGTTACTG
CTAGTGGGAAATAAAGACTGCAGCTCAATGAACTGCTATATCTGCGGGTT
TAAGGATAACTCAGTGGCTGCCCTAGATGGCCAGTTAATGATCGGTGATG
AATTACTAAAAATTAACAGCATTGACGTACTCGGAATGAGCCATTCAAAT
GTTGCTCCAATCATCAAAAAATGTCAAATGGAATCAGAAAAGATTATGTT
GACAATTAAAAGACATCCAGACAATCTTGTCAAAATGGCATGCATTCCAG
CTTCGGTTAATACTTCGGTAGCACCATGTGAAAAGTCAGAGAATGCAGTA
GAAACTTCAACTGACGAAAATCAGATCTCCTCCAATAATAACTTACAGGG
ATACGGAGATATTTTCCACGTACATCTTGAAAAAAGTGTACAAGGATTTG
GGTTTTTTATAATGGATTGTAATGCAAATGATGAAGCTGGAATCTATGTC
AAGAAAGTTACAGTAGATGGTATTGCAGCTAATGAAGGAACATTGAGAGA
AGGCGACAGAATTCTGTTAATCAACGATGAATTAGTGGTGAATGAAGATT
ATGATTCTGTACTTAAGAGGTTGCGTGGTTGTAAGAATGCATTGGAAATG
GTAGTGGGTAGGATAACGATTTCTCAAGATCATGCTAAGAATATCGAAAC
AGAGCCTCAGCCAATTAGCAAAGATAGAAGAGAAAGTATTGAATATCATA
TGATAAATAGTCCCCCACCGTTGCAGATGCCTACCGTTATTTCTCCAATA
ATAAATGATGAAAGGAAAATGAGTGCTGTAAGACCTAGCATTAGTCATGA
CAAAGAGCCGATCTACTCAAGCATTCCTCCAGATAGAAAAAGAAACTCTA
TTCAAAAAGTTCTAAATAATCAATCAATCACGAAAAAGGTTTCAGTAAAT
GAACAGGTCATTCAGGAAGTGCCACCAACCAAAACATTAACACAAAAAGA
ACATCCAACAAAAGCTCAAATAATACCAGGAGTTGAAACAGTAATTGAGT
TGACTAAAGACAGAGGTTTAGGCCTATCGATAATTGGCGGTAGCGATACA
ATTCTGGGAACTGTTATGATTCACGAAGTTCACGAAAAGGAGGCCGCTGC
ACTTGACGGCAGACTATGGGCTGGAGATAGAATTCTTGCCGTTAATGGGA
AAGATTTACGCAACGCAACCCATGATCAAGCTATACAAACATTAAGATCA
GTCGGAAACCGAGTGAAACTAAAGATTTTCCGTGACAAACAACCTTTATG
TGAAGACTCTTTATATTTCAAGTTGAAAGTAGACTTGTTGAAAAAAAGTC
GAAAAGGCCTCGGTATTACGATCGTATCAAAAAGCGATGTTGGGGTGTGC
ATATCAGATTTGGTGAAAGGTTCTATCGCAGAGCAAGACGGCCGATTGAA
GAAAGGTGATCTCCTCCTGGAAATAAATGACACTAATGTACGCTCGTTCA
CTCAAGATCAAGTTGCCACACTGTTAAAAAGATGTTCTGGAAATGTCTTT
CTCATGGTTGGCAGACTGCGATCGAATATTTATTCTTCTCAATCGTCTTC
ATCAGATAAGCAATCTAAAAGAAAGAAATAAAATTGTTGATTTCCTATTT
TGTAAAAATCTCAAAATTAATCAAAGAGCAACTTTGGAATTTATGTTTTT
AATTATTACTGTTATTTTTATTGTTAATATTCCATTCTGACTCGTTGAC
back to top

protein sequence of SMED30025821-orf-1

>SMED30025821-orf-1 ID=SMED30025821-orf-1|Name=SMED30025821-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2062bp
MIGDQVPDASLHLNIDFNESLVSISNILNFCGNPLSGLSETTVDHSTDML
NTEWAELEIVELLNDRCGLGFSLMGSKSTGVVIRSIFSGSVAERNGHLRI
GDHLMYIDDINVRGMTSEQVAAILRQSSDHIRLIIARPIPNCSSPEYCGS
MSIIPTDQIDQHLDFLVNTLLPVSDLKAMQLYQQISVTDADQEAANIYQE
HNLLQLVQTQLPPAIFQSTINTHYQTEIPMRRVAGEPETQKSEKSLGEKS
LENGSSLNNINVSENIHCSNAADINFTLSVKHNDSRNARSTSLDNDTEEA
NLRENELHPSRLATSASTISSPNSSKVRTKHRIRINEQNEFHEYTTYLTK
GEQGLGLTIAGYITCRPEVNIHGIFVKSISKNSVADLNGQIVINDQIIEI
NDQSVIGLDNPAVVEILKLTSGIVKLKFNRYTKGPVYEILTQTAKSSHTV
SSISQSSSNSLIHTKSNSSINNSMKTTNETLTLQPMIYTILSNDESPVNN
CPENIDVSVVPPSAQLANSSSEDEAEISILDFPLNQRLAKENTTKTDVLI
ANILPNSGFNVQKMNLKYASIDKTIEDTIKSTWNKIIGGNYDILISYINK
TNEGLGISLEGTVDVDDVTGLEDKPHHYIRTITADGPIGLDGTFKSGDEL
LEANGKKLHGVPYQEVLTSLKSLPNRVQIVAARRKEVDVSQLSRSSSTML
YDDFIDDDESDEYYDENDVDNDNISIDVDYHSLDQMQEIFTHHPGFRSGS
FLCHTDTAAKYHPKADNKIIYEDSYRYPIMSKAKSDNSIFVKSNSFSEML
PIKTLTANRSLQYLKDVAMWSGPILVELTKESQGLGFSIEYYQDASSNVP
VIVISSLVPNGVAHLDGRIIPGDRLIFINEVEVDALSSKQEVIEALQSLS
KGQVLLGIAKPMFPSSYMYRSYSKETVEELSTSQSLEYEPFTLAEDAAIG
STYNSLQRVINTDVRLYQITTCIVQQTLHNAAIYLRDHCNTIVLLPCSSS
ELSEKEIAFQSVSSTRENFIDAESTVLQSSISSESSTPRREISPNSNKSD
PNINLINYHNLTSSDFNHFKGELEKSCSTIRSDDEYGLKMKIISEQTSSK
TPSSDINSSSSIDCLDELEVTKISESDTDAMIHYWKKSEKVESGEVKSTG
IIDINAMKKWVYLTLDKTSLDLDTTKFCEVGYPLLYTPETKLNFQDICSP
GDIITDINGQKLSEIRPDTISLLLSSYKKTGERIKIGYISADIYEKSSDW
LPLLNSTEFTVPVTQRIYKCASNSNMENQINGQNENRNSFINLTVLQAKK
SIQMSDSSIHINGWSSPRVVTVEREQNQSLGISILGGKVANVKEKEEFAE
DTNLVSGIFITHINPDSPAEKCGQLNIGDRLLSVNGIDLIKTSYDDAISY
IKNATSPIVFTIQSLVDVSMMKDSDATKLSNCQLSDYESHEQEPLSLNSK
SDMLKKKLTTPPNSPDKATSNKINQNETDEKENSFSVSSLSNESVTPDLS
EIEAIRNGHKSSTDESGKVMNIEIDKQGKKGMGLLLVGNKDCSSMNCYIC
GFKDNSVAALDGQLMIGDELLKINSIDVLGMSHSNVAPIIKKCQMESEKI
MLTIKRHPDNLVKMACIPASVNTSVAPCEKSENAVETSTDENQISSNNNL
QGYGDIFHVHLEKSVQGFGFFIMDCNANDEAGIYVKKVTVDGIAANEGTL
REGDRILLINDELVVNEDYDSVLKRLRGCKNALEMVVGRITISQDHAKNI
ETEPQPISKDRRESIEYHMINSPPPLQMPTVISPIINDERKMSAVRPSIS
HDKEPIYSSIPPDRKRNSIQKVLNNQSITKKVSVNEQVIQEVPPTKTLTQ
KEHPTKAQIIPGVETVIELTKDRGLGLSIIGGSDTILGTVMIHEVHEKEA
AALDGRLWAGDRILAVNGKDLRNATHDQAIQTLRSVGNRVKLKIFRDKQP
LCEDSLYFKLKVDLLKKSRKGLGITIVSKSDVGVCISDLVKGSIAEQDGR
LKKGDLLLEINDTNVRSFTQDQVATLLKRCSGNVFLMVGRLRSNIYSSQS
SSSDKQSKRKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0016327apicolateral plasma membrane
GO:0031410cytoplasmic vesicle
GO:0043220Schmidt-Lanterman incisure
GO:0030425dendrite
GO:0042995cell projection
GO:0043005neuron projection
GO:0045202synapse
GO:0045211postsynaptic membrane
GO:0005622intracellular
GO:0005886plasma membrane
GO:0005923bicellular tight junction
GO:0012505endomembrane system
GO:0014069postsynaptic density
GO:0016020membrane
GO:0016324apical plasma membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
GO:0035556intracellular signal transduction
GO:0042552myelination
Vocabulary: molecular function
TermDefinition
GO:0008022protein C-terminus binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036034PDZ_sf
IPR011528NERD
IPR001478PDZ
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001478PDZ domainSMARTSM00228pdz_newcoord: 1970..2042
e-value: 3.4E-18
score: 76.4
coord: 1873..1948
e-value: 1.3E-18
score: 77.8
coord: 353..432
e-value: 1.2E-15
score: 68.0
coord: 603..685
e-value: 6.8E-11
score: 52.2
coord: 1328..1416
e-value: 6.4E-18
score: 75.5
coord: 67..139
e-value: 1.4E-19
score: 81.1
coord: 1666..1741
e-value: 3.2E-13
score: 59.9
coord: 1530..1608
e-value: 3.7E-12
score: 56.4
coord: 833..912
e-value: 5.7E-11
score: 52.5
IPR001478PDZ domainPFAMPF00595PDZcoord: 1320..1413
e-value: 6.9E-13
score: 48.8
coord: 1867..1944
e-value: 1.1E-14
score: 54.5
coord: 827..908
e-value: 7.4E-10
score: 39.1
coord: 350..427
e-value: 3.9E-11
score: 43.2
coord: 1522..1604
e-value: 4.6E-8
score: 33.3
coord: 65..135
e-value: 4.6E-10
score: 39.7
coord: 1659..1737
e-value: 9.8E-9
score: 35.5
coord: 1963..2037
e-value: 3.0E-15
score: 56.3
IPR001478PDZ domainPROSITEPS50106PDZcoord: 345..432
score: 15.421
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1319..1416
score: 19.521
IPR001478PDZ domainPROSITEPS50106PDZcoord: 594..685
score: 14.556
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1658..1741
score: 15.159
IPR001478PDZ domainPROSITEPS50106PDZcoord: 59..139
score: 18.717
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1864..1948
score: 20.164
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1521..1592
score: 13.451
IPR001478PDZ domainPROSITEPS50106PDZcoord: 1961..2042
score: 19.923
IPR001478PDZ domainPROSITEPS50106PDZcoord: 825..890
score: 13.933
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 812..913
e-value: 4.4E-23
score: 83.0
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1631..1748
e-value: 1.4E-17
score: 65.6
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 324..430
e-value: 5.7E-19
score: 70.0
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1849..1954
e-value: 5.6E-26
score: 92.6
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 44..144
e-value: 2.6E-24
score: 87.1
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1504..1615
e-value: 3.5E-19
score: 70.8
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 576..687
e-value: 1.0E-16
score: 62.9
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1304..1418
e-value: 2.0E-25
score: 91.1
IPR036034PDZ superfamilyGENE3DG3DSA:2.30.42.10coord: 1958..2060
e-value: 7.0E-26
score: 92.2
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 36..140
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1862..1949
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 574..687
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1316..1415
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1516..1609
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 331..436
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1957..2043
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 812..917
IPR036034PDZ superfamilySUPERFAMILYSSF50156PDZ domain-likecoord: 1649..1739
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1458..1472
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 283..330
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 287..306
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1480..1498
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1458..1498
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 308..326
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 230..252
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1030..1049
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 234..248
NoneNo IPR availablePANTHERPTHR19964:SF10MULTIPLE PDZ DOMAIN PROTEINcoord: 51..163
NoneNo IPR availablePANTHERPTHR19964MULTIPLE PDZ DOMAIN PROTEINcoord: 325..2054
coord: 51..163
NoneNo IPR availablePANTHERPTHR19964:SF10MULTIPLE PDZ DOMAIN PROTEINcoord: 325..2054
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 600..680
e-value: 1.18191E-8
score: 51.7987
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1522..1605
e-value: 2.02734E-13
score: 65.2806
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 823..909
e-value: 4.01592E-11
score: 58.7322
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 348..427
e-value: 4.51125E-13
score: 64.5102
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1656..1737
e-value: 4.38487E-14
score: 67.2066
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1317..1413
e-value: 3.82601E-20
score: 84.5406
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 64..136
e-value: 1.28125E-17
score: 77.2218
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1962..2038
e-value: 2.14033E-16
score: 73.755
NoneNo IPR availableCDDcd00992PDZ_signalingcoord: 1864..1944
e-value: 4.72692E-17
score: 75.681