Subcommissural organ spondin

Overview
NameSubcommissural organ spondin
Smed IDSMED30025808
Length (bp)3290
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Subcommissural organ spondin (SMED30025808) t-SNE clustered cells

Violin plots show distribution of expression levels for Subcommissural organ spondin (SMED30025808) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Subcommissural organ spondin (SMED30025808) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Subcommissural organ spondin (SMED30025808) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025808

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025808h1SMcG0015651 Contig6471newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025808h1SMcG0015651 Contig6471uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
prepharyngeal regionSMED30025808h1SMcG0015651 SmedASXL_014234SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30025808h1SMcG0015651 SmedASXL_012943SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30025808h1SMcG0015651 dd_Smed_v4_447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025808h1SMcG0015651 dd_Smed_v4_447_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025808h1SMcG0015651 dd_628dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30025808h1SMcG0015650 dd_Smed_v4_9342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025808h1SMcG0015650 dd_Smed_v4_9342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025808h1SMcG0015651 dd_Smed_v4_9342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025808h1SMcG0015651 dd_Smed_v4_9342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025808h1SMcG0015651 dd_Smed_v4_628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30025808h1SMcG0015651 dd_Smed_v4_628_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
prepharyngeal regionSMED30025808h1SMcG0015651 dd_Smed_v6_628_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30025808h1SMcG0015650 dd_Smed_v6_9342_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
prepharyngeal regionSMED30025808h1SMcG0015651 dd_Smed_v6_9342_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015651 OX_Smed_1.0.03686ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015651 OX_Smed_1.0.10839ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015650 OX_Smed_1.0.14308ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015651 OX_Smed_1.0.14308ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015651 OX_Smed_1.0.01620ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015652 OX_Smed_1.0.03004ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015651 OX_Smed_1.0.03004ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30025808h1SMcG0015651 OX_Smed_1.0.03267ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30025808h1SMcG0015651 dd_Smed_v4_628_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Subcommissural organ spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 62.3882 bits (150), Expect = 5.721e-9
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 1
Query: 1864 QSCVAPKQLLSCVN--------PCEQRCGDLSKKCTNTDCIESCACPDNMLEQD-GQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            QSC APK  + C N        P    C  L+    +T+C+  C CPD +++   G CV + EC C  N++L  +                 DCN CTC++G+W+CT  +C   C
Sbjct:  757 QSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSS-----------GAKIKVDCNTCTCKRGRWVCTQAVCHGTC 860          
BLAST of Subcommissural organ spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:NCBI gene;Acc:4583])

HSP 1 Score: 62.3882 bits (150), Expect = 6.181e-9
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 1
Query: 1864 QSCVAPKQLLSCVN--------PCEQRCGDLSKKCTNTDCIESCACPDNMLEQD-GQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            QSC APK  + C N        P    C  L+    +T+C+  C CPD +++   G CV + EC C  N++L  +                 DCN CTC++G+W+CT  +C   C
Sbjct:  757 QSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSS-----------GAKIKVDCNTCTCKRGRWVCTQAVCHGTC 860          
BLAST of Subcommissural organ spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:NCBI gene;Acc:4583])

HSP 1 Score: 62.3882 bits (150), Expect = 6.181e-9
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 1
Query: 1864 QSCVAPKQLLSCVN--------PCEQRCGDLSKKCTNTDCIESCACPDNMLEQD-GQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            QSC APK  + C N        P    C  L+    +T+C+  C CPD +++   G CV + EC C  N++L  +                 DCN CTC++G+W+CT  +C   C
Sbjct:  757 QSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSS-----------GAKIKVDCNTCTCKRGRWVCTQAVCHGTC 860          
BLAST of Subcommissural organ spondin vs. Ensembl Human
Match: MUC2 (mucin 2, oligomeric mucus/gel-forming [Source:HGNC Symbol;Acc:HGNC:7512])

HSP 1 Score: 62.3882 bits (150), Expect = 6.330e-9
Identity = 37/115 (32.17%), Postives = 54/115 (46.96%), Query Frame = 1
Query: 1864 QSCVAPKQLLSCVN--------PCEQRCGDLSKKCTNTDCIESCACPDNMLEQD-GQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            QSC APK  + C N        P    C  L+    +T+C+  C CPD +++   G CV + EC C  N++L  +                 DCN CTC++G+W+CT  +C   C
Sbjct:  757 QSCTAPKIHMDCSNLTALATSKPRALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSS-----------GAKIKVDCNTCTCKRGRWVCTQAVCHGTC 860          
BLAST of Subcommissural organ spondin vs. Ensembl Human
Match: OTOG (otogelin [Source:HGNC Symbol;Acc:HGNC:8516])

HSP 1 Score: 59.6918 bits (143), Expect = 4.203e-8
Identity = 28/75 (37.33%), Postives = 44/75 (58.67%), Query Frame = 1
Query: 1957 CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            C++ C CP+ ++ +DG CV+ +EC C ++  L    PPG        ++  +DCN CTC  GKW C+T +C  +C
Sbjct:  451 CVDGCYCPNGLIFEDGGCVAPAECPCEFHGTLY---PPG--------SVVKEDCNTCTCTSGKWECSTAVCPAEC 514          
BLAST of Subcommissural organ spondin vs. Ensembl Celegans
Match: T21B6.3 (pep chromosome:WBcel235:X:10945160:10948970:-1 gene:WBGene00011880.1 transcript:T21B6.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T21B6.3)

HSP 1 Score: 60.077 bits (144), Expect = 8.288e-9
Identity = 57/183 (31.15%), Postives = 83/183 (45.36%), Query Frame = 1
Query: 1042 WNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCID-DETSQIYPS-GSPMPSNVACQECFCNFTAQKECQPSSDDNK-----PDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCI-MTCKVDCVMGQWTNETACNAQCCGGNSV 1566
            W+QW+DW  C+  CG       + T          C G  T+ + C+  PC +     E S    S GS M      ++  C F    +CQ  +++++     P A W EW  WS CS  C  G R+R R C+ P    +T C GP IET  C   +C   C   +W + + C+ +C GG S+
Sbjct:  554 WSQWEDWGQCSVTCG-QGVAVRQRTCLGGVFGDHLCQGPKTEQRACDGGPCSLWSPWQEWSTCSASCGSGMKR----RQRVCQFGT--DCQGPNEESQFCYGPPCAEWTEWCEWSGCSSKCGPGQRTRTRGCLGPNGQEATTCQGPSIETTLCEGQSC---CNWSEWCHWSMCDKECGGGQSI 726          
BLAST of Subcommissural organ spondin vs. Ensembl Celegans
Match: adt-1 (A disintegrin and metalloproteinase with thrombospondin motifs adt-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECS8])

HSP 1 Score: 53.9138 bits (128), Expect = 8.526e-7
Identity = 126/504 (25.00%), Postives = 172/504 (34.13%), Query Frame = 1
Query:   49 PIIFTQSTSTELVVCTEWSDWSLCNASCGYGSSVRSRNCSTTENEHDSCYSSDCH---CDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFE-------------DENCKKDCXXXXXXXXXXCSGGCDNASKNRSRV-IIKQPNYGGKFCEPNGNEEIDDCPNTC---ICEWSPWSHWTECSQNCGG-GTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICID-PCEDLSTRCVGPRIETEPC 1479
            P++  +S  +E     +WS+W  C+ +CG G  VR+R C           + +C+   C  LF          I   W       G        +DG      + +F N A+C   + S  C +              EN      WS WS WS CS  C + +  R R   +  P   G FC     E+I   P +C      WS WS W+ CS++CG  G   + R      P N G   S        + ++  C  +    +CS  KV     + T    C D       C       T    NP   +            C  S     PC         A C   D     W+ W DW+PC+  CG                      G  T  + C             S   P G    S +A Q   C+  A   C     D++ D  W+ W+ WS C GNC  GTR+R R C+  P  D    C G   E   C
Sbjct: 1029 PLLPIESIHSE-----KWSEWGPCSVTCGSGRRVRTRGCQEASCPEQHIQTEECNLNSCLELF----------IWSDWSSCSKSCG--------QDGIQTRQKLCLF-NNAECSSYAESRRCKDLPSCSSISSGRTISENGFDAPRWSEWSSWSACS--CFSLTSTRRRFCQVVDPTVQG-FCAGAILEQIPCAPGSCSPSAGGWSLWSEWSSCSKDCGDTGHQIRNRMCSEPIPSNRGAYCSG------YSFDQRPCVMDN---VCSDEKVDGGWTDWTAWSECTDY------CRNGHRSRTRFCANPKPSQ--------GGAQCTGSDFELNPC------FDPARCHLRDG---GWSTWSDWTPCSASCG---------------------FGVQTRDRSC-------------SSPEPKGGQSCSGLAHQTSLCDLPA---C-----DHESDGEWSAWNEWSGCMGNCGIGTRTRVRACVSPPVSDGGQPCFGRSSEITEC 1431          
BLAST of Subcommissural organ spondin vs. Ensembl Zebrafish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 74.3294 bits (181), Expect = 9.277e-13
Identity = 140/601 (23.29%), Postives = 220/601 (36.61%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTR---TPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN----GTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-------------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCS-QSCVAPKQLLSCVNPCEQRCGDLSKKC---TNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQD---CQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
            W  WS W+ C+ +CGGG+ +++R   TP   G    S T    V C E  C          G   +   H   CP +C  V   G+    S  C  GC C P   +   G+CV    C   S +        +  +  ++C+         + W  WS C+  CG                     +G  +  + C                     P P++   ++C         CQ + D    DA +++WSAWS CS +C +    G + R R C+         C G   +   C +               + +C    W++ + C+  C        G   ++R  + P +N +          P  L    + +      +E     S+  ++CD  CG G   +T         G KN     +PC    C  + C A ++ +SC N C QRC DL +     TNT+C   C CP   L QDG CV   +C C      +              +   +DCN C+C   +  C+ + C ++   C WS W   + C+ +CG G +   R++   A   G+ CQ      + C
Sbjct: 3352 WLQWSRWSACTVSCGGGSQSRSRSCSTPPCLGKRRQSKTCNTQV-CLEVGCPP--------GRLYRECEHGEGCPFSCSQV--SGLEGCYSEGCDEGCHCPPNTFQHN-GSCVSECPCVVDSDLLTS--LQSITTHFLSLCL---------SAWGPWSSCSLSCGG--------------------LGQRSRSRSCE-------------------EPRPAHGG-RDCEGPLLDTAYCQ-TPDCPHEDAGFSQWSAWSSCSRSCADPGSPGVKFRQRECV------VELCSGETGQERVCNLPQCPDAGVCQGLDCAQRNCSWMAWSDWSVCSRSC------GVGQQQRIRTFIAPGLNGS--------WCPDILSGNTETRFCNIRWTEGWSRWSSW-SRCDKGCGGGRSIRTRSCSSSKCAGEKN---QVKPCNTKPCGDRGCPAGQEFVSCSNECPQRCSDLQQGIQCHTNTECQPGCRCPHGQLLQDGVCVQTWQCDCVDASGQVWAS----------GSSHQQDCNTCSCTDAQITCSNHTCAEEKSSCTWSSWSTWASCSSSCGPGQRTRFRSLVPEAE--GSSCQFEEVQHKPC 3852          

HSP 2 Score: 73.559 bits (179), Expect = 1.717e-12
Identity = 149/540 (27.59%), Postives = 216/540 (40.00%), Query Frame = 1
Query:   52 IIFTQSTSTELVVC--TEWSDWSLCNASCG-YGSSVRSRNCSTTENEHDS------------CYSSDC-HCDVLFSDVKF--KIHRDIIDAWVELDDIIGFSSLMELI--EDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT----CCDKS-QV------NCKPCETGVCENGQAVCI----PNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICID-PCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGG 1557
            +   QS +T  +    + W  WS C+ SCG  G   RSR+C      H              C + DC H D  FS         R   D             ++EL   E GQ    N+    +   C      LDC +     ++C W  WS+WS CS  C    + R R  I  P   G +C    +GN E   C       WS WS W+ C + CGGG + +TR+  +S C    +       CN   C        C   +  ++C N  CP+ C D L  GI C  +++C  GC C  G    +L + V   T    C D S QV      + + C T  C + Q  C       +   C+W+ W  W+ C+  CGP  +TR R+   +  G+  SC       KPC+  PC      +  ++  S     ++  C++C C     + CQ    D + D  W  WS WS C  +C    + R R CI+ P  +  + C GP  +T  C     +D  +  W+  + C+  C  G
Sbjct: 3464 LTSLQSITTHFLSLCLSAWGPWSSCSLSCGGLGQRSRSRSCEEPRPAHGGRDCEGPLLDTAYCQTPDCPHEDAGFSQWSAWSSCSRSCADPGSPGVKFRQRECVVELCSGETGQERVCNLPQCPDAGVCQ----GLDCAQ-----RNCSWMAWSDWSVCSRSCGVGQQQRIRTFIA-PGLNGSWCPDILSGNTETRFCNIRWTEGWSRWSSWSRCDKGCGGGRSIRTRSCSSSKCAGEKNQ---VKPCNTKPCGDRG----CPAGQEFVSCSN-ECPQRCSD-LQQGIQCHTNTECQPGCRCPHG---QLLQDGVCVQTWQCDCVDASGQVWASGSSHQQDCNTCSCTDAQITCSNHTCAEEKSSCTWSSWSTWASCSSSCGPGQRTRFRSLVPEAEGS--SCQFEEVQHKPCDPGPCPPLCVHKNREL--SVGDTWTDGECKQCTC-IPEGEYCQ--DIDCQVDGGWTPWSVWSSCPVSCGKSKQIRTRACINPPPRNNGSHCTGPERDTRDCHSGPCLD-DLCPWSTWSRCSVSCGAG 3973          

HSP 3 Score: 73.1738 bits (178), Expect = 1.982e-12
Identity = 77/325 (23.69%), Postives = 127/325 (39.08%), Query Frame = 1
Query: 1294 QKECQPSSDDNK-PDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM-TCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL-SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTV 2259
              +C   SD+N   D   + W++WS CS +C  G+  R +  +       + C G + ++ PC +  C V     +WT  + C+  C GG      ++ + R    P      ++CE                 ++ +T  C      ++T     C  GM+     +                          C+A K      +PC   C DL S++    +C   C CP  +  Q G+CV+ SEC C WN +L+  +P   +  S   +   KD        G+ +C  + C   C WS W   + C+ +CG GVQ   R++
Sbjct: 2295 HSDCADGSDENDCYDCILSSWASWSQCSVSCGLGSIFRQKNILRDARPGGS-CGGAQFDSRPCFLQACPVSGQWSEWTQWSGCDVPCAGG------LMVRNRTCSNPPPKNGGRDCEG----------------MSRQTHTCNTQSCGSDTDTQSGCTGGMILMDESD--------------------------CLAGK-----FSPCPLTCSDLHSERNCTLNCTAGCHCPPGLFLQSGRCVNVSECECFWNGSLI--QPGQDVSNSSCSSCVCKD--------GRVLCDESSCVARCDWSAWSSWTSCDSSCGTGVQHRYRSL 2555          

HSP 4 Score: 72.0182 bits (175), Expect = 4.763e-12
Identity = 105/369 (28.46%), Postives = 146/369 (39.57%), Query Frame = 1
Query:  364 NCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIK-QPNYGGKFCEPNGNEEIDDCPNT-CICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC-CDKSQVNCKP----------CETGVCENGQA-VCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDP 1425
            +C  C C +G + C E E C   C WS W+ WS CS  CD   + R R      P +GG+ CE      +D C  T C     PWS W+ECS +CGGG  ++TR P+      S  T     ACN   C   +    CSG +    C  V     C D+   G   ++ + C  GC C  G  ++D  G CV    C C  +    KP           ET +  +    VC+  D     W+ W  W  C+  CG                     VG  +  +         C D E     P+G+ +P         C    + +   +S     D  W++WS+W+ CS +C  G +SR R C  P
Sbjct: 2768 SCNNCTCVNGEMQCGE-EPCPVHCGWSEWTSWSACSRTCDVGIRRRYRSGTNPAPAFGGRVCE-GERIGLDTCSVTPCFGVKGPWSRWSECSVSCGGGYRSRTRGPIR-----SHGTQQQFSACNLQPCGNRSG---CSGGQQWSVC--VREQLLCSDL---GTEAQKDAHCHPGCQCPEGSALQD--GECVPVSLCHCHVNGEQHKPRATVNKDLCTVETSLQHHYWVCVCVSVDG---GWSSWTPWGVCSVSCG---------------------VGLQSRYR--------FCSDPE-----PAGAGLP---------CTGAHRDDRVCASTPCSRDGGWSDWSSWTDCSKSCGGGVKSRRRDCDRP 3073          

HSP 5 Score: 68.1662 bits (165), Expect = 6.338e-11
Identity = 61/178 (34.27%), Postives = 80/178 (44.94%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTR--TPLNSG---CDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC-CDKSQVNCKP-------CETGVCENGQAV-CIPNDNC--DCSWNQWQDWSPCNRVCG 1086
            WSPWS W+ CS++CGG    +     P N G    DL  +T++ T   +   C  + S   C    V  TC   +CP TC  V  G  +C+  S C  GC+C  G V +    CV  + C C+ S V   P       C+  VCE G+   C PN  C   C W+ W  W  C   CG
Sbjct: 1679 WSPWSTWSNCSKSCGGVEIRQRECFPPQNGGRSCADLPGETNMTT---DIRPCAQDCSDVSCPAGLVSHTC--ASCPLTCAHV-SGTATCDPDSKCFAGCWCPEGKVMNADHQCVPPEECVCEVSGVRYWPGQQVKVGCDICVCERGRTQHCQPNPECSVHCGWSSWSLWGECLGPCG 1850          

HSP 6 Score: 67.3958 bits (163), Expect = 1.213e-10
Identity = 66/226 (29.20%), Postives = 91/226 (40.27%), Query Frame = 1
Query: 1894 SCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVI--NRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGT-IWQNGQTKK 2556
            SC N C + C DL    +C    C   C CP   L QDG CV   ECRC       G        E  P       CN C C  G  +CT ++C     W  W +   C+V+CG G +   R+    +V       G + T  I   +  CC     +S     C  +C+D+   N+  P   C  GCRC  G V    + C P  E +RC      +W +  +++
Sbjct: 4234 SCANQCPRSCADLWDHVQCLQGVCHPGCRCPPGQLLQDGSCVPVDECRC-------GLPMQNGTLEIRPGENITLSCNTCVCVNGSLVCTDHVCPLYGSWGSWSV---CSVSCGTGQRTRVRSCTHTSV-------GLSCTHTI--QSQNCCPAGQIFSSCAGSCPFSCEDLWPENQCVPLD-CSAGCRCPSGEVS--GHVCAP--EYWRCPAGERWLWADSGSER 4435          

HSP 7 Score: 66.2402 bits (160), Expect = 3.015e-10
Identity = 85/364 (23.35%), Postives = 139/364 (38.19%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDR-ICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACN--AQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQ-LDCPVDCKVLTYETSECIKLCSANNTQCD-------PSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQL-LSCVNPCEQRCGDLSKKCTN--------TDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKD-CNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVA-VYGGNDCQGSNTTDEICYAATQCCEINVAYS 2364
            +W+ WS+W+ C  +C  G + R R + ++PCE  ST               C V C   QW++ T  +  ++ C  +  A G+  + R       +T+    + +   PC  L CPV+    ++ +         +  Q         P    G+V   P    +  N         +PC       + V P  +     + CE + G   + C +        ++C + C C       +  CV    C C     LL           +P    P+D CNNCTC  G+  C    C   C WS+W   S C+ TC  G+++  R+    A  +GG  C+G     + C + T C  +   +S
Sbjct: 2530 DWSAWSSWTSCDSSCGTGVQHRYRSLHVEPCEGDSTE-----------ARRCSVPCTDAQWSDWTHWSECSKTCFHHVDAVGMRKRFRSC----NHTHTCAGDADEQEPCNTLHCPVNGGWSSWSSWSDCSSDCDSGVQTSERFCSFPPPLYGGLVCPGPHMQTRDCN--------VQPC-------TGVCPDGMTFLWKHQCEAQGGACPRVCLDAMADVQCASECYDGCYCSPGFYLFNKSCVHLQFCPCVHQGALL-----------MPGDSVPRDSCNNCTCVNGEMQCGEEPCPVHCGWSEWTSWSACSRTCDVGIRRRYRSGTNPAPAFGGRVCEGERIGLDTC-SVTPCFGVKGPWS 2851          

HSP 8 Score: 59.6918 bits (143), Expect = 2.715e-8
Identity = 62/193 (32.12%), Postives = 85/193 (44.04%), Query Frame = 1
Query:  562 EEIDDCPNTCIC----EWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLS-SDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC-----CDKSQVNCKP-------CETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCG 1086
            EE  DCP+  +C    +WS WS W+ C + C GG  ++ R PL S      +D    + +CN   C  E       G     +C N  CPR+C D+ D  + C +   C  GC C PG  ++D  G+CV  D C          +  +P       C T VC NG  VC   D+    +  W  WS C+  CG
Sbjct: 4154 EEERDCPHADVCRDVCDWSSWSRWSVCKEPCSGGFRHRERRPLTSDPKPHCADLQSQSQSCNTALCPGEHCED--RGRVFDGSCAN-QCPRSCADLWD-HVQCLQGV-CHPGCRCPPGQLLQD--GSCVPVDECRCGLPMQNGTLEIRPGENITLSCNTCVCVNGSLVC--TDHVCPLYGSWGSWSVCSVSCG 4337          

HSP 9 Score: 58.5362 bits (140), Expect = 5.995e-8
Identity = 83/305 (27.21%), Postives = 112/305 (36.72%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDP-CEDLSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVD-CKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEP-CYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTR-PPGIMEESLPDTI-FPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCG 2229
            D  W+ W+ W +CS +C  G +SR R C DP        C G   +   C  T C  D     W++ T C+  C G      G+ ++ RD   P    +  +CE        LD  V  C       S C  +  +  + C PSC             ++ +    CE   EP CY       C   K L S                  T+C+E  +CP         C+          D   G R  PG       DT+  P  CNNCTC  G+  CT + C  D  W  W   +PC+ TCG
Sbjct: 2986 DGGWSSWTPWGVCSVSCGVGLQSRYRFCSDPEPAGAGLPCTGAHRDDRVCASTPCSRDGGWSDWSSWTDCSKSCGG------GVKSRRRDCDRPIRTADGDQCEG-------LDTEVTLCNTQHCAVSSCSHVSGSVFSACGPSC------------PRSCDDLTFCEWRCEPGCY-------CTDGKVLTS----------------NGTECVEQDSCP---------CL----------DLNTGERVQPG-------DTVPTPDACNNCTCEGGRLSCTDHPCPVDGDWCQWSAWTPCSKTCG 3216          

HSP 10 Score: 54.299 bits (129), Expect = 1.173e-6
Identity = 105/396 (26.52%), Postives = 151/396 (38.13%), Query Frame = 1
Query:  412 DENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCP---NTCIC--EWSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPI-CSGNKVQ------ITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC-CDKSQVNCKPCE--------TGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN-----GTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVD 1500
            DEN   DC  S W+ WS+CS  C   S  R + I++    GG      G  + D  P     C    +WS W+ W+ C   C GG   + RT     P N G D     S  T  CN  SC ++T T   C+G  +       +      CP TC D L    +C  + +C  GC C PG      G CV    C C  +    +P +        + VC++G+ +C  +     C W+ W  W+ C+  CG      T   +  +  + + C G +T+ + C+ VPC                                              DA W++W+ WS CS  C +     G R R R C     + +  C G   E EPC  + C V+
Sbjct: 2303 DENDCYDCILSSWASWSQCSVSCGLGSIFRQKNILRDARPGGSC----GGAQFDSRPCFLQACPVSGQWSEWTQWSGCDVPCAGGLMVRNRTCSNPPPKNGGRDCEG-MSRQTHTCNTQSCGSDTDTQSGCTGGMILMDESDCLAGKFSPCPLTCSD-LHSERNC--TLNCTAGCHCPPGLFLQS-GRCVNVSECECFWNGSLIQPGQDVSNSSCSSCVCKDGRVLCDESSCVARCDWSAWSSWTSCDSSCG------TGVQHRYRSLHVEPCEGDSTEARRCS-VPCT---------------------------------------------DAQWSDWTHWSECSKTCFHHVDAVGMRKRFRSC-----NHTHTCAGDADEQEPCNTLHCPVN 2632          

HSP 11 Score: 52.373 bits (124), Expect = 4.632e-6
Identity = 106/461 (22.99%), Postives = 178/461 (38.61%), Query Frame = 1
Query: 1318 DDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC--IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYE---TSECIKLCSAN---NTQCDPSCGHGMVTKTPQ---EIVKAVNGGKNCE---VTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSK---KCTNTDC-IESCA-------------CPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQ------WSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYA---ATQCCEINVAYSLKNSYCEQTCDDVINRL--HPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQT-KKDTNSC 2571
            DD+ P   W +WS WS C+ +C  G++SR R C  P       C+G R +++ C   +  +V C  G+   E      C    S   G+     +      +      + N +   +  C VD  +LT     T+  + LC +     + C  SCG G+  ++     E  +  +GG++CE   +    C   +C        Q  S  + C + C D      K    +C +E C+             CPD  + Q   C  ++     W+D  + +R  G+ ++    T      N   C     I + N   + C       WS W   S C+  CG G     R+ +       + C G     + C       + C     +   ++ C Q C D+   +  H    C+ GCRC  G +   +  CV T +C   + +G +W +G + ++D N+C
Sbjct: 3347 DDSGP---WLQWSRWSACTVSCGGGSQSRSRSCSTP------PCLGKRRQSKTCNTQVCLEVGCPPGRLYRECEHGEGCPFSCSQVSGLEGCYSEGCDEGCHCPPNTFQHNGSCVSECPCVVDSDLLTSLQSITTHFLSLCLSAWGPWSSCSLSCG-GLGQRSRSRSCEEPRPAHGGRDCEGPLLDTAYCQTPDCPHEDAGFSQ-WSAWSSCSRSCADPGSPGVKFRQRECVVELCSGETGQERVCNLPQCPDAGVCQGLDCAQRNCSWMAWSDWSVCSRSCGVGQQQRIRTFIAPGLNGSWCPD---ILSGNTETRFCNIRWTEGWSRWSSWSRCDKGCGGGRSIRTRSCSS------SKCAGEKNQVKPCNTKPCGDRGCPAGQEFVSCSNECPQRCSDLQQGIQCHTNTECQPGCRCPHGQLLQ-DGVCVQTWQCDCVDASGQVWASGSSHQQDCNTC 3786          
BLAST of Subcommissural organ spondin vs. Ensembl Zebrafish
Match: adgrb1a (adhesion G protein-coupled receptor B1a [Source:ZFIN;Acc:ZDB-GENE-060607-12])

HSP 1 Score: 57.7658 bits (138), Expect = 7.828e-8
Identity = 64/244 (26.23%), Postives = 104/244 (42.62%), Query Frame = 1
Query: 1042 WNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPS--NVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQL-DCPVDCKVLTYET-SECIKLCSANNTQCDPSC 1758
            W+ W +W+ C+  CG     +              C G   + +PCN  PCI        ++      + S  +   ++     + Q+  Q ++   +  A W EW+ WS+CS  C  G R R+R C  P +     C GP  +T+ C I  C VD V  +W+  ++C++ C  G       + ++R+   PS      + E + T  C L +CPVD +   + T S C K C   + Q    C
Sbjct:  242 WSGWGNWAECSSECG-GGVQKRTRNCQSPPDEAYLCEGVLEEGRPCNAQPCI-----GKGRLGSRSQSLRSVDSRKREDSDKTRSGQQSSQTAALITEHGA-WGEWTPWSLCSSTCGRGYRERNRSC-KPPQFGGNPCDGPEKQTKFCNIAVCPVDGVWNEWSGWSSCSSTCSNGT------MQRIRECNGPSYGGLECQGEWHETRDCFLRECPVDGQWQLWSTWSGCTKTCGGGSQQRQRLC 471          
BLAST of Subcommissural organ spondin vs. Ensembl Zebrafish
Match: muc5.1 (mucin 5.1, oligomeric mucus/gel-forming [Source:ZFIN;Acc:ZDB-GENE-120822-1])

HSP 1 Score: 53.5286 bits (127), Expect = 1.798e-6
Identity = 66/247 (26.72%), Postives = 90/247 (36.44%), Query Frame = 1
Query: 1582 TQVRDLLIPSINTNAKECETNRTV--------PCQLDCPVDCKVLTYETSECIKLCSA-----NNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGN--------------------------CSQSCVAPKQLLSCVNPCE-----QRCGDLS--KKCTNTDCIESCACPDNML-EQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            + +R  +  +++T A  C     +        PC+ +CP + K  +YE + C   C +     N  Q   +  HG V     E       GK       PCY GN                            + CVAP     C +P E     QR  D      C +T C+  C CP+ +L +  G CV +  C CT N         G+   S P     +DCN CTC  G WICT   C   C
Sbjct:  647 SDIRKCICAAVSTYAHACAARGIILHDWMDTEPCESECPENMK-HSYEVTSCGSTCRSLSGQENTCQGSFTPVHGCVCS---EGTYLNEEGKCVHAGMCPCYYGNQVIQPSAEFNKEGAKCTCNNGKLDCSSHEDCVAPMTFFKCSHPGEKGTECQRTCDKQDPNNCVSTGCVSGCMCPEGLLADGKGGCVMRENCPCTHN---------GVT--SSPGDQVQQDCNTCTCTNGMWICTQKACYGTC 878          
BLAST of Subcommissural organ spondin vs. Ensembl Zebrafish
Match: adgrb1b (adhesion G protein-coupled receptor B1b [Source:ZFIN;Acc:ZDB-GENE-081031-45])

HSP 1 Score: 53.1434 bits (126), Expect = 1.989e-6
Identity = 31/79 (39.24%), Postives = 42/79 (53.16%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSV 1566
            D  WN+WSAW+ CS +C NGT  R R C  P     + C G  +ET+ C +  C VD     W++  AC+  C GG  +
Sbjct:  153 DGFWNDWSAWTPCSSSCSNGTTQRTRECNGPSYG-GSECRGEWLETKNCFLRDCPVDGRWLLWSSWGACSKSCGGGQQL 230          

HSP 2 Score: 52.373 bits (124), Expect = 3.753e-6
Identity = 41/123 (33.33%), Postives = 58/123 (47.15%), Query Frame = 1
Query: 1342 WNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQL-DCPVDCKVLTYET 1704
            W+EW+ WS+CS  C  G R R R C  P ++    C GP  +T+ C I  C VD     W+  T C++ C  G +       + R+   PS   +    E   T  C L DCPVD + L + +
Sbjct:  101 WDEWAPWSLCSSTCGRGYRDRVRTCKQP-KNGGEPCRGPFKQTKFCNIAVCPVDGFWNDWSAWTPCSSSCSNGTT------QRTRECNGPSYGGSECRGEWLETKNCFLRDCPVDGRWLLWSS 216          
BLAST of Subcommissural organ spondin vs. Ensembl Zebrafish
Match: otog (otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1])

HSP 1 Score: 51.6026 bits (122), Expect = 8.171e-6
Identity = 33/90 (36.67%), Postives = 45/90 (50.00%), Query Frame = 1
Query: 1912 EQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            EQ C D     +   C++ C CPD+++ +DG CV  S+C C  +  L    P G         I  +DCNNCTC  G W CT + C  +C
Sbjct:  424 EQMCID-----SKLQCLDGCYCPDDLIFEDGVCVKASDCPCEHHGMLY---PSG--------HIIQEDCNNCTCFGGIWNCTEHNCPGEC 497          
BLAST of Subcommissural organ spondin vs. Ensembl Xenopus
Match: ENSXETT00000006505.1 (SCO-spondin [Source:NCBI gene;Acc:100497129])

HSP 1 Score: 139.043 bits (349), Expect = 2.327e-32
Identity = 111/367 (30.25%), Postives = 156/367 (42.51%), Query Frame = 1
Query: 1507 MGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCE---VTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCT--------WNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAY---SLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKD 2559
             G WT  + C+  C GG+     + +Q     +P   +  KE E   T+PC    P DC++  +          +  ++C  SCG G+  +    +V     G  C    + +  C   NC+  C   +    C N C Q C DL    +C N  C   C+CP   +  +G C+S   C C+        W  NL        M+E    T     CN+C C  G + CT + C  DCQWSDW   SPC VTCG GVQ   R   Q  +Y G +C G +T    C  A   C    ++   SL    CE+TC ++            GC C+PG  R+I+  CV  + C  CE  G I+  G   +D
Sbjct: 4499 YGTWTEWSTCSVSCGGGHRHRSRMCSQEEPDGVP-CGSETKEVEECNTLPC----PADCELSEW----------SEWSECSASCGGGISERKRMVLVLGDLSGNPCPAPLLLHRSCNSHNCTPECPGDQVYSDCANVCPQTCADLRPGTECVNETCEPGCSCPVGQVLLNGTCISPENCTCSLQPTASMPWAANLTLEE---TMKEYKAGTAIYHQCNSCVCHMGAFSCTQDNCNVDCQWSDWSEWSPCTVTCGTGVQISLRHQVQQRLYEGLECSGPSTRQRPCVQADCDCPEGESWRRPSLGTELCERTCQEMYGDPQRNCSGSGGCVCEPGRYRSISGPCVTAAHC-ECEHQGQIYLPGTEWQD 4846          

HSP 2 Score: 109.383 bits (272), Expect = 3.020e-23
Identity = 184/729 (25.24%), Postives = 271/729 (37.17%), Query Frame = 1
Query:  352 TVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVI-IKQPNYGGKFCEPNGNEEIDDCPNTCICE--WSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNV-TCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVED----MLGNCVLSDTCCDKSQVN---------------------CKPCETGV----CENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGP--SXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN----GTRSRDRICIDPCEDLSTRCVGPRI--------------------ETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQ-EIVKAVNGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKK--CTNTD-CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQ-DCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAA 2331
            TV   C  C C +G L C  D +C+ D +W  WS WS CS  C   ++ R R      P  GG+ C  +G +  D     C  +  W PWS W+ CS +CGGG   + R      C+     +I + +CN   C      P     ++   C N   CP +C   L   + C  S  C  GC C  G Y+ +        CV+++    + + +                      K C + +    CENG   C  +      ++  W  WSPC+  CG   +       TN      G++C G + DIK C     I           P+  P P          + T   E          +  +  WS+W+ CS +C +      ++R R C+    +   + +                        E E C    + +C    W+  + C+  C        G  T++R    P  N +  E      +  +      CKV      +      +  + CD +CG G   ++         NGGK C   +     C    C + C+   + + C N C + C D  +   C N + C   C CP+ +LEQDG CV  S C CT       T          P +   +DCNNCTC  G  +CT N C + DCQWS W   S C+VTCG G Q   R+    +     +CQ        CY  
Sbjct: 3375 TVSGPCQNCTCTAGRLLCTPDPSCRLDGKWGPWSSWSPCSQRCGKGTQTRVRQCDSPAPQNGGRECLGDGQQHRDCQSLECQEQESWGPWSSWSPCSVSCGGGEQIRVRECQQDECE---GKAIQSKSCNGQVCLDVGCPP----GRLYRECENGDGCPYSCAH-LTQQVECF-SDGCEEGCHCPVGTYIHNSSCVTECPCVMTEEIVQRFRNHSSNPNVTPIPLTDRGIQILFLLKHCSSSLLCSTCENGWMNCTFSACPVHGAFTPWSPWSPCSVSCGGLGNMTRTRHCTNPAPANGGRNCEGPSMDIKYCQTPEYI---------TSPTVEPFP----------DITGSPE----------EGGYGPWSSWTPCSKSCSDNEYPAMKTRSRFCLGG-RNFHFKMIIFEFQLYYHLLSLSLSSTSDSPLCEGEDCR---QRNCSWNPWSEWSECSWTC------GVGQQTRLRTYNPPGANGSWCENIMTGNMERRFCNLQACKV------DGSWSKWSPWSWCDRTCGGGRSIRSRTCTSPPPKNGGKECPGEKYHVRICNPKPCDEGCLPGMEHVECANKCPRHCSDYQQGIVCQNGELCEAGCRCPEGLLEQDGVCVPVSHCECTDTQGQSWT----------PGSSLQEDCNNCTCLNGHLVCTNNTCPRLDCQWSQWSKWSQCSVTCGSGTQSRFRSSTSGSPK--RECQVPEKQSRPCYPG 4037          

HSP 3 Score: 100.908 bits (250), Expect = 9.375e-21
Identity = 159/638 (24.92%), Postives = 228/638 (35.74%), Query Frame = 1
Query:  595 CEWSPWSHWTECSQNCGGGTTNKTRTPLN-----SGCD---LSSDTSIVTVACNEF--------SCTTETSTPICSGNKVQITCHNV------------------------------TCPRTCDDVLDGGISCEE--SSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCE-----TGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNI-VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN-----GTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC 2322
            C  SPW+ W++CS+ CG G T + R  +        CD     S +  V     ++        SC+ E    ICS +  + T   +                               CP+TC      G++ E   +S C+ GC C  G      G C     C   +    +P       T  C++G+  C  +D   +C W+ W  W+PC+R CG                  Q    S T+    N   PC    D +T ++             +ECF           SS DN+ D  W EW+ WS CS  C       G R R R C +     ++ CVG  ++ E C    C V     QW+  + C A C        GI T+ R    P  +                    DC+    +T EC      N   C   C   M+ +T ++     +GG            G C + C+    L+ C                 + C E C CP+ +  Q+  C+ +SEC C     +     PG  E +  D      CNNCTC  G+ +C    C  DC WS W   S C+ TC  G ++  R+        GG  C+GSN   E C
Sbjct: 2362 CILSPWTFWSDCSRTCGLGVTFRRRDVIRERQPGGHCDEAQFDSKSCFVQACPGKYRREGVGWVSCSDER---ICSVSLRRKTLPALEPKRYTSLITDCGPEMIYVNASDCEPLRLDACPQTCR-----GLNAETLCNSSCMAGCRCPQGLFLQN-GTCENISRCLCHTDHGSQPYTFLSSITSHCKDGKINCDESDCPVNCGWSAWSHWTPCDRTCG---------------SGVQERFRSPTNPPSANGGAPC----DGDTREV-------------RECF-----------SSCDNETDRMWGEWTPWSACSKTCVYDVEHLGVRRRFRHCNNSLASSTSPCVGESVQEEACDTPLCPVTGGWSQWSPWSECTATC------DSGIQTRNRTCSKPHPSYGGS----------------DCRGPQIQTREC------NTHPCQELCPENMIYQTAEQ---CRSGG------------GACPRLCLDQAALVECT----------------SACYEGCYCPEGLFLQNNSCLPQSECPCYHQGAIY---QPG--ENATLD-----GCNNCTCAAGEMLCGQEPCPVDCGWSTWTTWSSCSRTCNVGTRRRYRSGTNPPPANGGRGCEGSNVDIEFC 2878          

HSP 4 Score: 81.6481 bits (200), Expect = 8.287e-15
Identity = 83/272 (30.51%), Postives = 117/272 (43.01%), Query Frame = 1
Query:  466 CSGGCDNASKNRSRVIIKQPNYGGKFCEPNG------NEEIDDC---PNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC-CDKSQVNCKP-----------------------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPC 1179
            CS  C    ++RSR+  ++        EP+G       +E+++C   P    CE S WS W+ECS +CGGG + + R  L  G DLS +     +  +  SC +   TP C G++V   C NV CP+TC D+  G     E+  C  GC C  G V  + G C+  + C C        P                       C + VC  G   C  ++ N DC W+ W +WSPC   CG   Q   R     +   G  C G +T  +PC
Sbjct: 4508 CSVSCGGGHRHRSRMCSQE--------EPDGVPCGSETKEVEECNTLPCPADCELSEWSEWSECSASCGGGISERKRMVLVLG-DLSGNPCPAPLLLHR-SCNSHNCTPECPGDQVYSDCANV-CPQTCADLRPGTECVNET--CEPGCSCPVGQVL-LNGTCISPENCTCSLQPTASMPWAANLTLEETMKEYKAGTAIYHQCNSCVCHMGAFSCTQDNCNVDCQWSDWSEWSPCTVTCGTGVQISLRHQVQQRLYEGLECSGPSTRQRPC 4765          

HSP 5 Score: 78.1814 bits (191), Expect = 9.094e-14
Identity = 156/623 (25.04%), Postives = 209/623 (33.55%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGV--------CENGQAVCIPND-NCDCSWNQWQDWSPCNRVCG-PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIE-----TEPCIMTCKVDCVMGQWTNE-------------TACNAQCCGGNSVAYGIITQVRDLLIPSI----NTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNT------QCDPSCGHGMVTKT-------PQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVA--PKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDN-MLEQDG-QCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPK--DCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA-QVAVYGGNDCQG 2298
            WS WS W+EC+  C  G   + RT     P   G D      I T  CN   C       +      Q       CPR C   LD     E +S C  GC+C  G           S+  C       +P E           C  G+ +C       DC W+ W  WS C+R C   + +     TN      G+ C GSN DI+ C++  C                                                   EWS WS CS  C  G R+R R  +          V  RIE       PC       C  G+   E                N  C  G    +G +  + +L +P+       +    E   TVP         K + +++   I     N +      +C  +CG G  T+        P        G    E   +PC +  CS +C A       SC  PC + C D++       C   C CP+  +L ++G  CV   EC C   D + G R        LP  + P    CNNCTC  G   CT   C     W DW   +PC+ TCG  +    R+ A      GG+ CQG
Sbjct: 2675 WSQWSPWSECTATCDSGIQTRNRTCSKPHPSYGGSDCRG-PQIQTRECNTHPCQELCPENMIYQTAEQCRSGGGACPRLC---LDQAALVECTSACYEGCYCPEGLFLQNNSCLPQSECPCYHQGAIYQPGENATLDGCNNCTCAAGEMLCGQEPCPVDCGWSTWTTWSSCSRTCNVGTRRRYRSGTNPPPANGGRGCEGSNVDIEFCSLQSCSA------------------------------------------------GEWSPWSECSVPCGGGYRNRSRSGV----------VLRRIEFSTCNLRPCSGEAPGVCPDGKVWKECGDGPSSCADLSSETTNGSCQPGCYCHHGEVL-LNNLCVPTAACPCTEDGALYEAGETVP---GWKWLYKYIIWDSLFVILSVDGNWSDWTPWSECSSTCGGGFQTRYRFCDDPPPSGTGLPCQGPDREE---QPCSVEPCSANCSAILGSVFSSCGPPCPRTCDDITH--CMWRCQPGCYCPNGQVLSENGTACVDVEECTCL--DIISGRR-------YLPGEMVPHRDGCNNCTCLNGTLSCTKEPCVVAGGWCDWSSWTPCSKTCGTEMVTRYRSCACPKPKQGGDQCQG 3217          

HSP 6 Score: 74.3294 bits (181), Expect = 1.161e-12
Identity = 54/149 (36.24%), Postives = 67/149 (44.97%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDLSKKCTNTD---CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNI-CQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVY-GGNDCQGSNTTDEIC 2322
              C   C + C DL +     D   C  +C CPD  L Q+G CV  SECRC  N +  G  P    E +LP       C NCTC  G+ +CT +  C+ D +W  W   SPC+  CGKG Q   R     A   GG +C G       C
Sbjct: 3307 FPCGRRCPRSCEDLQEDTMCMDSPGCQATCGCPDGQLMQNGTCVEPSECRC--NSSWSGPIP---WEYALPGETVSGPCQNCTCTAGRLLCTPDPSCRLDGKWGPWSSWSPCSQRCGKGTQTRVRQCDSPAPQNGGRECLGDGQQHRDC 3450          

HSP 7 Score: 68.5514 bits (166), Expect = 7.996e-11
Identity = 114/476 (23.95%), Postives = 173/476 (36.34%), Query Frame = 1
Query: 1327 KPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNA-------QCCGGNSVAYGIITQVRDLLI---PSINTNAKECETN-RTVPCQLDCPV-DCKVLTYETSECIKLCSANNTQCDPSCG------------HGMVTKTPQEIVKAVNGGKNCE---VTYEPCYLGNCSQS-CVAPKQLLSCVNPCEQRCGDLSKKCTNTD---CIESCACPDNMLEQDGQCVSKSECRCTW---NDNLLGTRPPGIMEES-----------LPDTIFPKDCNNCT-----CRQGKWICTTN---------------------------ICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT----QCCEINVAYSLK-NSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRNINNTCVPTSEC 2505
            + D  W++WS WS CS  C +GT+SR R            C  P  ++ PC      +      TN    +A       QC       Y    + R   +      +  +K C T  R+   + DCPV +   +   T+E ++  +     C  SC             H ++    ++       G  CE        C L +CS+S C+ P +   C +PCE  C    +     D   C   C CP  MLEQ+G CV +SEC C +    D+ +     G  E++           LP   F     + T      +Q   +C ++                           +C+  C WS W   SPC   C  G +   R V      GG  CQG     + C  A     +C +   A+ +   + C + C D+   +      C  GCRC  G++   +  CVP S+C
Sbjct: 3986 RLDCQWSQWSKWSQCSVTCGSGTQSRFRSSTS--GSPKRECQVPEKQSRPCYPGMCPELCPHNGTNRRIGDAWLAGECQQCICTPEGNYCQDVECRGSGLCDWSDWSPCSKPCGTGLRSRTWRCDCPVPESPDVPCNTTEIVETAACYIQPCQGSCLWGPWSEWTNCSCHSLLQHRFRDQKGLTFRGDGCEELGTESRLCNLSDCSESSCLPPFEFNPCGSPCEGLCSSRHQPEICRDAPRCQAGCYCPRGMLEQNGHCVPRSECGCVYVPPTDSDVSETSSGTREQTWWSEWSPCSPCLPSAPFSLQNASVTPAMFSVQQRHRLCLSSHTGFPWSGPSAACIGELTQERDCPDKGVCEDLCVWSPWGEWSPCREPCSGGFRVRWRHVYHPV--GGKLCQGPRFQSQSCNTAACPGEECEDRGKAFKMSCANQCPRACTDLWEHVECLQGQCRTGCRCPDGWLLQ-DKRCVPISDC 4456          

HSP 8 Score: 67.0106 bits (162), Expect = 2.144e-10
Identity = 72/262 (27.48%), Postives = 93/262 (35.50%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICT----------------------------------------------------TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC--YAATQCCEINVAYSLKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRNINNTCVPTSEC 2505
            +SC N C + C DL +  +C    C   C CPD  L QD +CV  S+CRC       G        E  P      DCNNCTC  G + CT                                                    T  C  DC+ S+W   S C+ +CG G+ + +R V  +    GN C         C  +  T  C  +  YS   + C QTC D+          CE GC C  G V  +N TC+    C
Sbjct: 4409 MSCANQCPRACTDLWEHVECLQGQCRTGCRCPDGWLLQDKRCVPISDCRC-------GMPTADATIEYEPGDEVRVDCNNCTCLNGTFTCTNLSCPSYGTWTEWSTCSVSCGGGHRHRSRMCSQEEPDGVPCGSETKEVEECNTLPCPADCELSEWSEWSECSASCGGGISERKRMVLVLGDLSGNPCPAPLLLHRSCNSHNCTPECPGDQVYSDCANVCPQTCADLRPGTECVNETCEPGCSCPVGQVL-LNGTCISPENC 4662          

HSP 9 Score: 61.6178 bits (148), Expect = 1.061e-8
Identity = 50/159 (31.45%), Postives = 68/159 (42.77%), Query Frame = 1
Query: 2152 CTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQV-AVYGGNDCQGSNTTDEIC--YAATQCCEINVAYSLK------NSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKM 2601
            C T +C     WS W   S C  TC  G+Q   RT ++    YGG+DC+G       C  +   + C  N+ Y            C + C D    +  T  C EGC C  G     NN+C+P SEC  C   G I+Q G+     + C    C+ G+M
Sbjct: 2664 CDTPLCPVTGGWSQWSPWSECTATCDSGIQTRNRTCSKPHPSYGGSDCRGPQIQTRECNTHPCQELCPENMIYQTAEQCRSGGGACPRLCLDQAALVECTSACYEGCYCPEGLFLQ-NNSCLPQSEC-PCYHQGAIYQPGENAT-LDGCNNCTCAAGEM 2819          

HSP 10 Score: 53.9138 bits (128), Expect = 2.234e-6
Identity = 41/146 (28.08%), Postives = 64/146 (43.84%), Query Frame = 1
Query: 1900 VNPCEQRCGDLSKKCT-NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEICYAA 2331
            ++ C Q C  L+ +   N+ C+  C CP  +  Q+G C + S C C  +              S P T      ++  C+ GK  C  + C  +C WS W   +PC+ TCG GVQ+  R+     +  GG  C G       C+++
Sbjct: 2474 LDACPQTCRGLNAETLCNSSCMAGCRCPQGLFLQNGTCENISRCLCHTDHG------------SQPYTFLSSITSH--CKDGKINCDESDCPVNCGWSAWSHWTPCDRTCGSGVQERFRSPTNPPSANGGAPCDGDTREVRECFSS 2605          
BLAST of Subcommissural organ spondin vs. Ensembl Xenopus
Match: THBS1 (thrombospondin 1 [Source:NCBI gene;Acc:100170153])

HSP 1 Score: 62.003 bits (149), Expect = 6.087e-9
Identity = 67/259 (25.87%), Postives = 95/259 (36.68%), Query Frame = 1
Query:  925 CVLSDTCCDKSQVNCKPCETGVCENGQ--AVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIM-TCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC---ETNRTVPCQLDCPVD 1680
            C  S T C K      PC      +G+    C P+D+ D  W+ W DW+PC+  CG       +            C GS+   + C+I                           QEC   F             K D  W+ WS WS CS  C +G  +R R+C  P   L+ + C G   E +PC    C ++   G W+    C   C G      G++ + R    P      KEC    T+  +  + DCP+D
Sbjct:  351 CQNSATICRKVSCPLMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCG----HGIQQRGRSCDSLNNRCEGSSVQTRSCHI---------------------------QECDKRF-------------KQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPCEGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCGG------GMMKRERLCNNPKPQYGGKECIGDPTDSQICNKQDCPID 559          
BLAST of Subcommissural organ spondin vs. Ensembl Xenopus
Match: THBS1 (thrombospondin 1 [Source:NCBI gene;Acc:100170153])

HSP 1 Score: 61.6178 bits (148), Expect = 7.258e-9
Identity = 67/259 (25.87%), Postives = 95/259 (36.68%), Query Frame = 1
Query:  925 CVLSDTCCDKSQVNCKPCETGVCENGQ--AVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC---ETNRTVPCQLDCPVD 1680
            C  S T C K      PC      +G+    C P+D+ D  W+ W DW+PC+  CG       +            C GS+   + C+I                           QEC   F             K D  W+ WS WS CS  C +G  +R R+C  P   L+ + C G   E +PC    C ++   G W+    C   C G      G++ + R    P      KEC    T+  +  + DCP+D
Sbjct:  342 CQNSATICRKVSCPLMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCG----HGIQQRGRSCDSLNNRCEGSSVQTRSCHI---------------------------QECDKRF-------------KQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPCEGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCGG------GMMKRERLCNNPKPQYGGKECIGDPTDSQICNKQDCPID 550          
BLAST of Subcommissural organ spondin vs. Ensembl Xenopus
Match: THBS1 (thrombospondin 1 [Source:NCBI gene;Acc:100170153])

HSP 1 Score: 61.6178 bits (148), Expect = 7.619e-9
Identity = 67/259 (25.87%), Postives = 95/259 (36.68%), Query Frame = 1
Query:  925 CVLSDTCCDKSQVNCKPCETGVCENGQ--AVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC---ETNRTVPCQLDCPVD 1680
            C  S T C K      PC      +G+    C P+D+ D  W+ W DW+PC+  CG       +            C GS+   + C+I                           QEC   F             K D  W+ WS WS CS  C +G  +R R+C  P   L+ + C G   E +PC    C ++   G W+    C   C G      G++ + R    P      KEC    T+  +  + DCP+D
Sbjct:  335 CQNSATICRKVSCPLMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCG----HGIQQRGRSCDSLNNRCEGSSVQTRSCHI---------------------------QECDKRF-------------KQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPCEGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCGG------GMMKRERLCNNPKPQYGGKECIGDPTDSQICNKQDCPID 543          
BLAST of Subcommissural organ spondin vs. Ensembl Xenopus
Match: THBS1 (thrombospondin 1 [Source:NCBI gene;Acc:100170153])

HSP 1 Score: 61.6178 bits (148), Expect = 7.851e-9
Identity = 67/259 (25.87%), Postives = 95/259 (36.68%), Query Frame = 1
Query:  925 CVLSDTCCDKSQVNCKPCETGVCENGQ--AVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIM-TCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC---ETNRTVPCQLDCPVD 1680
            C  S T C K      PC      +G+    C P+D+ D  W+ W DW+PC+  CG       +            C GS+   + C+I                           QEC   F             K D  W+ WS WS CS  C +G  +R R+C  P   L+ + C G   E +PC    C ++   G W+    C   C G      G++ + R    P      KEC    T+  +  + DCP+D
Sbjct:  352 CQNSATICRKVSCPLMPCTNATIPDGECCPRCWPSDSADDDWSPWSDWTPCSVTCG----HGIQQRGRSCDSLNNRCEGSSVQTRSCHI---------------------------QECDKRF-------------KQDGGWSHWSPWSSCSVTCGSGQITRIRLCNSPVPQLNGKPCEGEGRENKPCQKDPCPINGQWGPWSLWDTCTVTCGG------GMMKRERLCNNPKPQYGGKECIGDPTDSQICNKQDCPID 560          
BLAST of Subcommissural organ spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 112.849 bits (281), Expect = 1.975e-24
Identity = 194/769 (25.23%), Postives = 288/769 (37.45%), Query Frame = 1
Query:  100 WSDWSLCNASCG-YGSSVRSRNC--STTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENC-----------------KKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT--CCDKSQVNCKP-------CETGVCENGQAVCIP---NDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYG----IITQV----RDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT-----YEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCGDL--SKKCTNT-DCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            W  WSLC+ SCG  G+  R+R C   T      SC       +  FS          ++    L    G  S         T  ++         CL N    D  ++  C                   +C W+ W+ W  CS  C    + R R     P  GG +C       +E   C N   C     WS WS W+ C ++CGGG + ++R+     P N G     +   V   CN   C        C      ++C N  CP +C D+ +GG+ C+E   C  GC C+ G++E   G CV      C D    +  P       C    C+ GQ  C     +    C+W+ W  WS C+  CGP  Q     ++T      + C    +  +PC  VPC  +C+ +  + ++  G     +  CQ+C C  T +      +D   P   W  WS+WS CS +C  G++ R R C +      S  C GP  +T  C    C        W     C+  C  G +   G    ++T+      D     +  + + C +    PCQ DC       T+        C         SC   +  +   ++      G+    T     + PC +GNCS+ SC  P +  SC +PC   C      + C +   C   C CP  +LEQ G C+   +C C W+ +  G R         P       C  C CR+G+  C++  C+     + W   SPC 
Sbjct: 3797 WGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRLRAY-HPPGPGGHWCPDILTAYQERRFC-NLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVR-PCNPMPCEEG-----CPAGMEMVSCAN-HCPYSCSDLQEGGM-CQEDQACQLGCRCSEGFLEQD-GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALE-CQKEQSQSQPCPEVPCPPLCLHE--AHLHELGDNW-LHGECQQCSC--TPEGAICKDTDCAVPR-GWTLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTF---LGLDTQACYSG---PCQDDC-------TWGDWSSWTRC---------SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC-WHISGEGAR-----VTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSEWSPCG 4519          

HSP 2 Score: 90.5077 bits (223), Expect = 1.307e-17
Identity = 89/346 (25.72%), Postives = 140/346 (40.46%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLS-TRCVGPRIETEPCIMTCKVDCVMG--QWTNETACNAQCC--GGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKL-CSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC---EVTYEPCYLGNCSQSCV------APKQLLSCVNPCEQRC--GDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEIC 2322
             W+ WS W+ C  +C +G R+R R   +P      + C G R E + C   C  + + G   WT+ ++C+  C   GG+               P     ++ C ++R   C  +   +                 A+ + C  SC  G+ T+  +    +  G   C         C +  C+  C       + +Q L    PC Q C   D   +CT + C  SC CP  +   +  C+ +S+C C  +  L             P  +   DCNNCTC  G+ +CT+  C   C WS W   SPC+ +C  G+++  R   +  A +GG +CQG N   E C
Sbjct: 2687 GWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTE-IPGWTPWTSWSSCSQSCLVPGGD---------------PGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRG-RSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEEGGPCPQLCLAQDPGVECTGS-CAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYA-----------PGAVAHLDCNNCTCISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFGGAECQGPNLDAEFC 3003          

HSP 3 Score: 83.1889 bits (204), Expect = 2.031e-15
Identity = 90/350 (25.71%), Postives = 135/350 (38.57%), Query Frame = 1
Query: 1294 QKECQPSSD-DNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECE--TNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAV-YGGNDCQGSNTTDEICY 2325
            Q  CQ  SD DN  D     WS WS CS +C  G   + R  +         C+  +  ++ C +  C V     +W   TAC+  C GG+       ++ R  + P        C   ++   PC L  CP D                   T C+P    G+V                  V  E C  G      + P    SC++P      + ++ C+   C+E C CP  +L QD  C+  SEC C     L+  R   +++          +C+ C C +G  +C    C Q C WS W   + C+ +CG GV+   R+     V +GG+ C+G     + CY
Sbjct: 2456 QVNCQDGSDEDNCVDCVLAPWSGWSDCSRSCGLGLIFQHRELLR-LPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPWTACSVSCGGGHQ------SRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGD-------------------TDCEP----GLV-----------------HVNAELCQKG------LVPPCPPSCLDP------EANRSCSG-HCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLD----------NCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACY 2735          

HSP 4 Score: 82.4185 bits (202), Expect = 3.096e-15
Identity = 159/662 (24.02%), Postives = 227/662 (34.29%), Query Frame = 1
Query:  562 EEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGC-DLSSDTSIVTV-ACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLG-----NCVLSDTCCDKSQVNC--------------KPCETGV-CENGQAVCIPNDNCDC-----------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSG----SPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICIDPCEDLSTRCVGPRIETEPC-------IMTC------KVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVP-----CQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAV-NGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQ--QDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
             E+  CP   I  WS W  W +CS +CGGG   ++R      C  L+  + I  +  C E  C         +G   +    +  CP +C  V  G ++C  S  C  GC C  G  +  +       CVL+     +  +                KP   GV    GQ +     NC C                 S+  W  WS C+R CG                     +G+ T  + C ++P           + P G     P+     C    C  TA    +P +        W  WS WS CS +C +      RSR R+C+  C       VG   +  PC       ++ C        +C    W     C+  C        G+  Q R             C    T       C L  CPV      +          +  + CD SCG G   ++         NGG +C        PC    C + C A  +++SC N C   C DL +      +  C   C C +  LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT  +C     C WS W   S C+ +CG   Q+  R  +  +     +CQ   +  + C
Sbjct: 3607 HEVPSCPGPGI--WSSWGPWEKCSVSCGGGEQLRSRQCARPPCPGLAQQSRICHIHVCRETGCP--------AGRLYRECQPSDGCPFSCAHV-TGQVACF-SERCKEGCHCPEGTFQHHVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCGNCSCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCGG--------------------LGTRTRTRQC-VLP----------TLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLA---GGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCT------VGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSC--------GVGQQRRLRAYHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHW----------SPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECT--DAQGRSWAPGSQHQDA--------CNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQ-SRFRSSTSGSWALECQKEQSQSQPC 4187          

HSP 5 Score: 68.5514 bits (166), Expect = 4.997e-11
Identity = 104/399 (26.07%), Postives = 153/399 (38.35%), Query Frame = 1
Query:  400 DCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQI---TCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPC---------NIVPCIMCIDDETSQIYPSGSPM--------PSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM 1485
            D  +++NC  DC  + WS WS+CS  C      + R +++ P  GG         +   +  CP      W+ W  WT CS +CGGG  ++ R+    P  +G       S     CN   C  +T    C    V +    C     P      LD   +   S  C+ GC C PG +        LS+  C   Q   +P        C   +CE G  +C P   +  C W+ W  W+ C+R CG   + R R+        G S C G   +++ C            P         S + P G P         PS+   ++ FC   A +E   S       + W  W++WS CS +C  G ++R R C       +  C+GP  +T  C M
Sbjct: 2461 DGSDEDNCV-DCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGA--WAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTD---CEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSWSSCSQSCLVPGGDPGWRQRSRLCPSS---RDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRGRSCSGSAPG-NPVCLGPHTQTRDCNM 2849          

HSP 6 Score: 67.3958 bits (163), Expect = 1.171e-10
Identity = 141/613 (23.00%), Postives = 212/613 (34.58%), Query Frame = 1
Query:  595 CEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC----------------CDKSQVNCKPCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCI-------MCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM-------------TCKVDCV-------MGQWTNETACNAQCCGGNSVAYGIITQVRDLL--------IPSINTNAKECETNRTVPCQLDCPVDCK----VLTYETSECIKLCSANN-TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT----YEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-TRPPGIMEESLPD-TIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKI--VSPCNVTC 2226
            C W  WS WT CS  C      + R  + +       T    +  +   CT    +        +       C   C   L+  + C++   C  GC+C  G +E   G+C+L + C                 D+ Q+ CK C   VC  G+  C  +  C+       W +WSPC    GP          +     G   + + +D+ P ++           +C+D ET + + +G P         C    + Q+ C P          W  W  WS C   C  G + R R+  D     +  C GP  +TE C M                +DC           W         C  G     G + Q    +        +PS N + +   T      QLDC  +C      L     EC  L   +  ++C   CG G + +      +     + C+      ++ C L  C +    P Q+LS C   C   C  L     C    C   C CP   L  +G C+    C CT      G T P       LP  T+  ++C +CTC+ G +IC+   CQ+      W+   + PC  TC
Sbjct: 4350 CTWGDWSSWTRCS--CKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRL-CQDLPPCQPGCYCPKGLLEQA-GSCILPEQCNCWHISGEGARVTLAPGDRLQLGCKEC---VCRRGELQCS-SQGCEGLLPLTGWSEWSPC----GPCLPQSALAPASRTALEGHWPL-NTSDLPPPSVTLLASEQYRHRLCLDPETRRPW-AGDPA-------LCTVPLSQQRLC-PDPGACNDTCQWGPWGPWSPCQMPCSGGFKLRWRVARD---TSAGECPGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPTQVV---QLDC-HNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGKGTMVR--HRSCEEHPDREPCQALDLQQWQECNLQACPE--CPPGQVLSTCATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQECAPGEIWQHGKLGPCEKTC 4929          

HSP 7 Score: 66.2402 bits (160), Expect = 3.112e-10
Identity = 65/212 (30.66%), Postives = 79/212 (37.26%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            L C N C + C DL    +C    C   C CP   L QDG CV  S CRC       G        E  P  +   DC+NCTC  G  +C    C     WS W   S C+  CGKG     R+  +        CQ  +           C E      L  S C   C  + + L P  +     C+ GC C PG     N TC+P   C
Sbjct: 4663 LDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRC-------GLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLGPWSAW---SECSAVCGKGTMVRHRSCEEHPDR--EPCQALDLQQWQECNLQACPECPPGQVL--STCATMCPSLCSHLWPGTICVREPCQLGCGC-PGGQLLYNGTCIPPEAC 4859          

HSP 8 Score: 60.8474 bits (146), Expect = 1.368e-8
Identity = 105/445 (23.60%), Postives = 154/445 (34.61%), Query Frame = 1
Query: 1186 VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSS-DDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDL-------------STRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTV--PCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACP-DNMLEQDGQ-CVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQ------GSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEE 2439
            VP   C      ++Y  GS +  ++ C+ C C       C     ++ +P   W+ W+ WS+CS +C    R R R C  P                 +T C GP  E EPC++  C        W+  + C+  C G      G+ ++ R    PS       CE  +     CQ   CPV         + C  +  A  + C P                                   C +SC     L+ CV  C+                  C CP   +L  DG  CV  S C C   D L G R       +    + P  CN+CTC +G+  CT   CQ    W  W   + C+  C    +   R  V     +GG+ C       G     E C  AT  C ++ A+S    +   +CD  + + + + VC  
Sbjct: 3107 VPVQDCPCAHRGRLYSPGSAV--HLPCENCSCISGLITNCSSWPCEEGQP--AWSSWTPWSVCSASCNPARRHRHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPWSGCSRSCGG------GLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPV---------TNCSAMEGAEYSPCGPP----------------------------------CPRSC---DDLVHCVWRCQ----------------PGCYCPLGKVLSADGAICVKPSYCSCL--DLLTGKR-----HHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATA-CPVDGAWSPWGPW--SSCDACLGQSYRSRVCSH 3469          

HSP 9 Score: 60.077 bits (144), Expect = 1.917e-8
Identity = 109/453 (24.06%), Postives = 156/453 (34.44%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFT----AQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICI--------DPC-EDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPGIMEESL----PDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT---QCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRN 2472
            C+D  T + + +G+ +     C  C C           CQ S D       W  WS W+ CS  C   TR+R R C+         PC E+     V  ++E  P    C VD     W   ++C+A  C G S    + +       P I+   K C                 +  Y+ S   + C  ++T C   CG G      Q+++                    C Q C    Q LS  + C+           +  C   C CP   L QDG CV   +C C +    +G     +R  G    S     P  +    C+NCTC  G   C     C     WS W     C+V+CG G Q   R  A+        C G      IC+        C     Y     +  C  +C  V  ++   +  C+EGC C  G  ++
Sbjct: 3337 CLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGD-------WCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDA--CLGQSYRSRVCSH------PPISDGGKPC-----------------LGGYQQS---RPCRNSSTLCT-DCGGG------QDLLP-------------------CGQPCPHSCQDLSLGSTCQP---------GSAGCQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCAR------PPCPGLAQQSRICHIHVCRETGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTFQH 3713          

HSP 10 Score: 53.9138 bits (128), Expect = 1.431e-6
Identity = 97/418 (23.21%), Postives = 152/418 (36.36%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC------------STTENEHDSCYSSDC---HCDVLFS---------------DVKFKIHRDIIDAWVELDDIIG----------FSSLMELIEDGQTVA-SNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVII-KQPNYGGKFC-EPNGN----EEIDDCPNTCIC----EWSPWSHWTECSQNCGGGTTNK--TRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCEN-----------------GQAVCIPNDNCDCS-----------------WNQWQDWSPCNRVCG 1086
            + WS WS C+ SCG G   R+R C               + + ++C +  C   +C  +                 D+   + R     +  L  ++           + S ++L+   +  A + +     C  C C  G L+C  D  C+   +W  WS+W+ CS  C   ++ RSR  +   P +GG  C E +G      +++ CPN   C     WSPW  W+ C    G    ++  +  P++ G          +  C   S    T    C G +  + C    CP +C D+  G      S+ C +GC C PG +    G CV    C      + +P   G+ EN                 G+ V  P DNC C                  W+ W  W  C+  CG
Sbjct: 3226 SPWSPWSGCSRSCGGGLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEYSPCGPPCPRSCDDLVHCVWRCQPGCYCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNC-TDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSHPPISDGGKPCLGGYQQSRPCRNSS----TLCTDCGGGQDLLPC-GQPCPHSCQDLSLGSTCQPGSAGCQSGCGCPPGQLSQD-GLCVFPVDC----HCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCG 3632          

HSP 11 Score: 51.6026 bits (122), Expect = 9.131e-6
Identity = 28/87 (32.18%), Postives = 38/87 (43.68%), Query Frame = 1
Query: 1894 SCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWIC 2154
            +C   C     +L   C    C+E C CP+  L   G C+  + C C W  +     PPG        T+  KDC NCTC+  +W C
Sbjct: 1290 TCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFF---PPG--------TVLQKDCGNCTCQGSQWHC 1365          
BLAST of Subcommissural organ spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 112.464 bits (280), Expect = 2.724e-24
Identity = 194/769 (25.23%), Postives = 288/769 (37.45%), Query Frame = 1
Query:  100 WSDWSLCNASCG-YGSSVRSRNC--STTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENC-----------------KKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT--CCDKSQVNCKP-------CETGVCENGQAVCIP---NDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYG----IITQV----RDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT-----YEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCGDL--SKKCTNT-DCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            W  WSLC+ SCG  G+  R+R C   T      SC       +  FS          ++    L    G  S         T  ++         CL N    D  ++  C                   +C W+ W+ W  CS  C    + R R     P  GG +C       +E   C N   C     WS WS W+ C ++CGGG + ++R+     P N G     +   V   CN   C        C      ++C N  CP +C D+ +GG+ C+E   C  GC C+ G++E   G CV      C D    +  P       C    C+ GQ  C     +    C+W+ W  WS C+  CGP  Q     ++T      + C    +  +PC  VPC  +C+ +  + ++  G     +  CQ+C C  T +      +D   P   W  WS+WS CS +C  G++ R R C +      S  C GP  +T  C    C        W     C+  C  G +   G    ++T+      D     +  + + C +    PCQ DC       T+        C         SC   +  +   ++      G+    T     + PC +GNCS+ SC  P +  SC +PC   C      + C +   C   C CP  +LEQ G C+   +C C W+ +  G R         P       C  C CR+G+  C++  C+     + W   SPC 
Sbjct: 3806 WGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRLRAY-HPPGPGGHWCPDILTAYQERRFC-NLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVR-PCNPMPCEEG-----CPAGMEMVSCAN-HCPYSCSDLQEGGM-CQEDQACQLGCRCSEGFLEQD-GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALE-CQKEQSQSQPCPEVPCPPLCLHE--AHLHELGDNW-LHGECQQCSC--TPEGAICKDTDCAVPR-GWTLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTF---LGLDTQACYSG---PCQDDC-------TWGDWSSWTRC---------SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC-WHISGEGAR-----VTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSEWSPCG 4528          

HSP 2 Score: 90.1225 bits (222), Expect = 1.508e-17
Identity = 89/346 (25.72%), Postives = 140/346 (40.46%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLS-TRCVGPRIETEPCIMTCKVDCVMG--QWTNETACNAQCC--GGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKL-CSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC---EVTYEPCYLGNCSQSCV------APKQLLSCVNPCEQRC--GDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEIC 2322
             W+ WS W+ C  +C +G R+R R   +P      + C G R E + C   C  + + G   WT+ ++C+  C   GG+               P     ++ C ++R   C  +   +                 A+ + C  SC  G+ T+  +    +  G   C         C +  C+  C       + +Q L    PC Q C   D   +CT + C  SC CP  +   +  C+ +S+C C  +  L             P  +   DCNNCTC  G+ +CT+  C   C WS W   SPC+ +C  G+++  R   +  A +GG +CQG N   E C
Sbjct: 2698 GWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTE-IPGWTPWTSWSSCSQSCLVPGGD---------------PGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRG-RSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEEGGPCPQLCLAQDPGVECTGS-CAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYA-----------PGAVAHLDCNNCTCISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFGGAECQGPNLDAEFC 3014          

HSP 3 Score: 83.1889 bits (204), Expect = 2.228e-15
Identity = 90/350 (25.71%), Postives = 135/350 (38.57%), Query Frame = 1
Query: 1294 QKECQPSSD-DNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECE--TNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAV-YGGNDCQGSNTTDEICY 2325
            Q  CQ  SD DN  D     WS WS CS +C  G   + R  +         C+  +  ++ C +  C V     +W   TAC+  C GG+       ++ R  + P        C   ++   PC L  CP D                   T C+P    G+V                  V  E C  G      + P    SC++P      + ++ C+   C+E C CP  +L QD  C+  SEC C     L+  R   +++          +C+ C C +G  +C    C Q C WS W   + C+ +CG GV+   R+     V +GG+ C+G     + CY
Sbjct: 2467 QVNCQDGSDEDNCVDCVLAPWSGWSDCSRSCGLGLIFQHRELLR-LPLPGGSCLLDQFRSQSCFVQACPVAGAWAEWGPWTACSVSCGGGHQ------SRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGD-------------------TDCEP----GLV-----------------HVNAELCQKG------LVPPCPPSCLDP------EANRSCSG-HCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLD----------NCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACY 2746          

HSP 4 Score: 81.6481 bits (200), Expect = 6.030e-15
Identity = 158/661 (23.90%), Postives = 226/661 (34.19%), Query Frame = 1
Query:  562 EEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCH-NVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLG-----NCVLSDTCCDKSQVNC--------------KPCETGV-CENGQAVCIPNDNCDC-----------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSG----SPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICIDPCEDLSTRCVGPRIETEPC-------IMTC------KVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVP-----CQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAV-NGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQ--QDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
             E+  CP   I  WS W  W +CS +CGGG   ++R      C   +  S +   C+   C        C   ++   C  +  CP +C  V  G ++C  S  C  GC C  G  +  +       CVL+     +  +                KP   GV    GQ +     NC C                 S+  W  WS C+R CG                     +G+ T  + C ++P           + P G     P+     C    C  TA    +P +        W  WS WS CS +C +      RSR R+C+  C       VG   +  PC       ++ C        +C    W     C+  C        G+  Q R             C    T       C L  CPV      +          +  + CD SCG G   ++         NGG +C        PC    C + C A  +++SC N C   C DL +      +  C   C C +  LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT  +C     C WS W   S C+ +CG   Q+  R  +  +     +CQ   +  + C
Sbjct: 3618 HEVPSCPGPGI--WSSWGPWEKCSVSCGGGEQLRSRQCARPPCPGLAQQSRI---CHIHVCRG------CPAGRLYRECQPSDGCPFSCAHV-TGQVACF-SERCKEGCHCPEGTFQHHVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCGNCSCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCG--------------------GLGTRTRTRQC-VLP----------TLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLA---GGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCT------VGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSC--------GVGQQRRLRAYHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHW----------SPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECT--DAQGRSWAPGSQHQDA--------CNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQ-SRFRSSTSGSWALECQKEQSQSQPC 4196          

HSP 5 Score: 68.5514 bits (166), Expect = 5.915e-11
Identity = 104/399 (26.07%), Postives = 153/399 (38.35%), Query Frame = 1
Query:  400 DCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQI---TCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPC---------NIVPCIMCIDDETSQIYPSGSPM--------PSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM 1485
            D  +++NC  DC  + WS WS+CS  C      + R +++ P  GG         +   +  CP      W+ W  WT CS +CGGG  ++ R+    P  +G       S     CN   C  +T    C    V +    C     P      LD   +   S  C+ GC C PG +        LS+  C   Q   +P        C   +CE G  +C P   +  C W+ W  W+ C+R CG   + R R+        G S C G   +++ C            P         S + P G P         PS+   ++ FC   A +E   S       + W  W++WS CS +C  G ++R R C       +  C+GP  +T  C M
Sbjct: 2472 DGSDEDNCV-DCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGA--WAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTD---CEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSWSSCSQSCLVPGGDPGWRQRSRLCPSS---RDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRGRSCSGSAPG-NPVCLGPHTQTRDCNM 2860          

HSP 6 Score: 67.3958 bits (163), Expect = 1.351e-10
Identity = 141/613 (23.00%), Postives = 212/613 (34.58%), Query Frame = 1
Query:  595 CEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC----------------CDKSQVNCKPCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCI-------MCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM-------------TCKVDCV-------MGQWTNETACNAQCCGGNSVAYGIITQVRDLL--------IPSINTNAKECETNRTVPCQLDCPVDCK----VLTYETSECIKLCSANN-TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT----YEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-TRPPGIMEESLPD-TIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKI--VSPCNVTC 2226
            C W  WS WT CS  C      + R  + +       T    +  +   CT    +        +       C   C   L+  + C++   C  GC+C  G +E   G+C+L + C                 D+ Q+ CK C   VC  G+  C  +  C+       W +WSPC    GP          +     G   + + +D+ P ++           +C+D ET + + +G P         C    + Q+ C P          W  W  WS C   C  G + R R+  D     +  C GP  +TE C M                +DC           W         C  G     G + Q    +        +PS N + +   T      QLDC  +C      L     EC  L   +  ++C   CG G + +      +     + C+      ++ C L  C +    P Q+LS C   C   C  L     C    C   C CP   L  +G C+    C CT      G T P       LP  T+  ++C +CTC+ G +IC+   CQ+      W+   + PC  TC
Sbjct: 4359 CTWGDWSSWTRCS--CKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRL-CQDLPPCQPGCYCPKGLLEQA-GSCILPEQCNCWHISGEGARVTLAPGDRLQLGCKEC---VCRRGELQCS-SQGCEGLLPLTGWSEWSPC----GPCLPQSALAPASRTALEGHWPL-NTSDLPPPSVTLLASEQYRHRLCLDPETRRPW-AGDPA-------LCTVPLSQQRLC-PDPGACNDTCQWGPWGPWSPCQMPCSGGFKLRWRVARD---TSAGECPGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPTQVV---QLDC-HNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGKGTMVR--HRSCEEHPDREPCQALDLQQWQECNLQACPE--CPPGQVLSTCATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQECAPGEIWQHGKLGPCEKTC 4938          

HSP 7 Score: 65.855 bits (159), Expect = 3.357e-10
Identity = 65/212 (30.66%), Postives = 79/212 (37.26%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            L C N C + C DL    +C    C   C CP   L QDG CV  S CRC       G        E  P  +   DC+NCTC  G  +C    C     WS W   S C+  CGKG     R+  +        CQ  +           C E      L  S C   C  + + L P  +     C+ GC C PG     N TC+P   C
Sbjct: 4672 LDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRC-------GLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLGPWSAW---SECSAVCGKGTMVRHRSCEEHPDR--EPCQALDLQQWQECNLQACPECPPGQVL--STCATMCPSLCSHLWPGTICVREPCQLGCGC-PGGQLLYNGTCIPPEAC 4868          

HSP 8 Score: 62.003 bits (149), Expect = 6.304e-9
Identity = 109/451 (24.17%), Postives = 157/451 (34.81%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFT----AQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICI--------DPC-EDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPGIMEESL----PDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT-QCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRN 2472
            C+D  T + + +G+ +     C  C C           CQ S D       W  WS W+ CS  C   TR+R R C+         PC E+     V  ++E  P    C VD     W   ++C+A  C G S    + +       P I+   K C                 +  Y+ S   + C  ++T C   CG G      Q+++                    C Q C    Q LS  + C+           +  C   C CP   L QDG CV   +C C +    +G     +R  G    S     P  +    C+NCTC  G   C     C     WS W     C+V+CG G Q   R  A+        C G      IC+    + C     Y     +  C  +C  V  ++   +  C+EGC C  G  ++
Sbjct: 3348 CLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGD-------WCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDA--CLGQSYRSRVCSH------PPISDGGKPC-----------------LGGYQQS---RPCRNSSTLCT-DCGGG------QDLLP-------------------CGQPCPHSCQDLSLGSTCQP---------GSAGCQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCAR------PPCPGLAQQSRICHIHVCRGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTFQH 3722          

HSP 9 Score: 60.4622 bits (145), Expect = 1.593e-8
Identity = 105/445 (23.60%), Postives = 154/445 (34.61%), Query Frame = 1
Query: 1186 VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSS-DDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDL-------------STRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTV--PCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACP-DNMLEQDGQ-CVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQ------GSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEE 2439
            VP   C      ++Y  GS +  ++ C+ C C       C     ++ +P   W+ W+ WS+CS +C    R R R C  P                 +T C GP  E EPC++  C        W+  + C+  C G      G+ ++ R    PS       CE  +     CQ   CPV         + C  +  A  + C P                                   C +SC     L+ CV  C+                  C CP   +L  DG  CV  S C C   D L G R       +    + P  CN+CTC +G+  CT   CQ    W  W   + C+  C    +   R  V     +GG+ C       G     E C  AT  C ++ A+S    +   +CD  + + + + VC  
Sbjct: 3118 VPVQDCPCAHRGRLYSPGSAV--HLPCENCSCISGLITNCSSWPCEEGQP--AWSSWTPWSVCSASCNPARRHRHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPWSGCSRSCGG------GLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPV---------TNCSAMEGAEYSPCGPP----------------------------------CPRSC---DDLVHCVWRCQ----------------PGCYCPLGKVLSADGAICVKPSYCSCL--DLLTGKR-----HHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATA-CPVDGAWSPWGPW--SSCDACLGQSYRSRVCSH 3480          

HSP 10 Score: 53.9138 bits (128), Expect = 1.797e-6
Identity = 97/418 (23.21%), Postives = 152/418 (36.36%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC------------STTENEHDSCYSSDC---HCDVLFS---------------DVKFKIHRDIIDAWVELDDIIG----------FSSLMELIEDGQTVA-SNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVII-KQPNYGGKFC-EPNGN----EEIDDCPNTCIC----EWSPWSHWTECSQNCGGGTTNK--TRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCEN-----------------GQAVCIPNDNCDCS-----------------WNQWQDWSPCNRVCG 1086
            + WS WS C+ SCG G   R+R C               + + ++C +  C   +C  +                 D+   + R     +  L  ++           + S ++L+   +  A + +     C  C C  G L+C  D  C+   +W  WS+W+ CS  C   ++ RSR  +   P +GG  C E +G      +++ CPN   C     WSPW  W+ C    G    ++  +  P++ G          +  C   S    T    C G +  + C    CP +C D+  G      S+ C +GC C PG +    G CV    C      + +P   G+ EN                 G+ V  P DNC C                  W+ W  W  C+  CG
Sbjct: 3237 SPWSPWSGCSRSCGGGLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEYSPCGPPCPRSCDDLVHCVWRCQPGCYCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNC-TDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSHPPISDGGKPCLGGYQQSRPCRNSS----TLCTDCGGGQDLLPC-GQPCPHSCQDLSLGSTCQPGSAGCQSGCGCPPGQLSQD-GLCVFPVDC----HCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCG 3643          

HSP 11 Score: 51.2174 bits (121), Expect = 9.524e-6
Identity = 28/87 (32.18%), Postives = 38/87 (43.68%), Query Frame = 1
Query: 1894 SCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWIC 2154
            +C   C     +L   C    C+E C CP+  L   G C+  + C C W  +     PPG        T+  KDC NCTC+  +W C
Sbjct: 1290 TCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFF---PPG--------TVLQKDCGNCTCQGSQWHC 1365          
BLAST of Subcommissural organ spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 112.079 bits (279), Expect = 3.006e-24
Identity = 193/763 (25.29%), Postives = 283/763 (37.09%), Query Frame = 1
Query:  100 WSDWSLCNASCG-YGSSVRSRNC--STTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENC-----------------KKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT--CCDKSQVNCKP-------CETGVCENGQAVCIP---NDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETN--RTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT-----YEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCGDL--SKKCTNT-DCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            W  WSLC+ SCG  G+  R+R C   T      SC       +  FS          ++    L    G  S         T  ++         CL N    D  ++  C                   +C W+ W+ W  CS  C    + R R     P  GG +C       +E   C N   C     WS WS W+ C ++CGGG + ++R+     P N G     +   V   CN   C        C      ++C N  CP +C D+ +GG+ C+E   C  GC C+ G++E   G CV      C D    +  P       C    C+ GQ  C     +    C+W+ W  WS C+  CGP  Q     ++T      + C    +  +PC  VPC  +C+ +  + ++  G     +  CQ+C C  T +      +D   P   W  WS+WS CS +C  G++ R R C +      S  C GP  +T  C    C        W     C+  C  G +   G    +        N      +T    + PCQ DC       T+        C         SC   +  +   ++      G+    T     + PC +GNCS+ SC  P +  SC +PC   C      + C +   C   C CP  +LEQ G C+   +C C W+ +  G R         P       C  C CR+G+  C++  C+     + W   SPC 
Sbjct: 3663 WGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRLRAY-HPPGPGGHWCPDILTAYQERRFC-NLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVR-PCNPMPCEEG-----CPAGMEMVSCAN-HCPYSCSDLQEGGM-CQEDQACQLGCRCSEGFLEQD-GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALE-CQKEQSQSQPCPEVPCPPLCLHE--AHLHELGDNW-LHGECQQCSC--TPEGAICKDTDCAVPR-GWTLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTFLGLDTQACYSGPCQDDC-------TWGDWSSWTRC---------SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC-WHISGEGAR-----VTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSEWSPCG 4385          

HSP 2 Score: 90.1225 bits (222), Expect = 1.505e-17
Identity = 89/346 (25.72%), Postives = 140/346 (40.46%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLS-TRCVGPRIETEPCIMTCKVDCVMG--QWTNETACNAQCC--GGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKL-CSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC---EVTYEPCYLGNCSQSCV------APKQLLSCVNPCEQRC--GDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEIC 2322
             W+ WS W+ C  +C +G R+R R   +P      + C G R E + C   C  + + G   WT+ ++C+  C   GG+               P     ++ C ++R   C  +   +                 A+ + C  SC  G+ T+  +    +  G   C         C +  C+  C       + +Q L    PC Q C   D   +CT + C  SC CP  +   +  C+ +S+C C  +  L             P  +   DCNNCTC  G+ +CT+  C   C WS W   SPC+ +C  G+++  R   +  A +GG +CQG N   E C
Sbjct: 2553 GWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTE-IPGWTPWTSWSSCSQSCLVPGGD---------------PGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRG-RSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEEGGPCPQLCLAQDPGVECTGS-CAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYA-----------PGAVAHLDCNNCTCISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFGGAECQGPNLDAEFC 2869          

HSP 3 Score: 83.1889 bits (204), Expect = 1.959e-15
Identity = 77/293 (26.28%), Postives = 116/293 (39.59%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEI-VKAVNGGKNCEVTYE---PCYLGNCSQSCVAPKQLL---------SCVNPCEQRCGDL-SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAV-YGGNDCQGSNTTDEICY 2325
            VDCV+  W+  + C+  C        G+I Q R+LL   +   +   +  R+  C +  CPV      +             T C  SCG G  ++    +     NGG  C        PC L  C         L+           V PC   C D  + +  +  C+E C CP  +L QD  C+  SEC C     L+  R   +++          +C+ C C +G  +C    C Q C WS W   + C+ +CG GV+   R+     V +GG+ C+G     + CY
Sbjct: 2335 VDCVLAPWSGWSDCSRSC------GLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGAWAEW----------GPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLD----------NCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACY 2601          

HSP 4 Score: 82.0333 bits (201), Expect = 4.330e-15
Identity = 159/662 (24.02%), Postives = 227/662 (34.29%), Query Frame = 1
Query:  562 EEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGC-DLSSDTSIVTV-ACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLG-----NCVLSDTCCDKSQVNC--------------KPCETGV-CENGQAVCIPNDNCDC-----------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSG----SPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICIDPCEDLSTRCVGPRIETEPC-------IMTC------KVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVP-----CQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAV-NGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQ--QDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
             E+  CP   I  WS W  W +CS +CGGG   ++R      C  L+  + I  +  C E  C         +G   +    +  CP +C  V  G ++C  S  C  GC C  G  +  +       CVL+     +  +                KP   GV    GQ +     NC C                 S+  W  WS C+R CG                     +G+ T  + C ++P           + P G     P+     C    C  TA    +P +        W  WS WS CS +C +      RSR R+C+  C       VG   +  PC       ++ C        +C    W     C+  C        G+  Q R             C    T       C L  CPV      +          +  + CD SCG G   ++         NGG +C        PC    C + C A  +++SC N C   C DL +      +  C   C C +  LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT  +C     C WS W   S C+ +CG   Q+  R  +  +     +CQ   +  + C
Sbjct: 3473 HEVPSCPGPGI--WSSWGPWEKCSVSCGGGEQLRSRQCARPPCPGLAQQSRICHIHVCRETGCP--------AGRLYRECQPSDGCPFSCAHV-TGQVACF-SERCKEGCHCPEGTFQHHVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCGNCSCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCGG--------------------LGTRTRTRQC-VLP----------TLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLA---GGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCT------VGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSC--------GVGQQRRLRAYHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHW----------SPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECT--DAQGRSWAPGSQHQDA--------CNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQ-SRFRSSTSGSWALECQKEQSQSQPC 4053          

HSP 5 Score: 68.5514 bits (166), Expect = 6.479e-11
Identity = 104/399 (26.07%), Postives = 153/399 (38.35%), Query Frame = 1
Query:  400 DCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQI---TCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPC---------NIVPCIMCIDDETSQIYPSGSPM--------PSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM 1485
            D  +++NC  DC  + WS WS+CS  C      + R +++ P  GG         +   +  CP      W+ W  WT CS +CGGG  ++ R+    P  +G       S     CN   C  +T    C    V +    C     P      LD   +   S  C+ GC C PG +        LS+  C   Q   +P        C   +CE G  +C P   +  C W+ W  W+ C+R CG   + R R+        G S C G   +++ C            P         S + P G P         PS+   ++ FC   A +E   S       + W  W++WS CS +C  G ++R R C       +  C+GP  +T  C M
Sbjct: 2327 DGSDEDNCV-DCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGA--WAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTD---CEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSWSSCSQSCLVPGGDPGWRQRSRLCPSS---RDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRGRSCSGSAPG-NPVCLGPHTQTRDCNM 2715          

HSP 6 Score: 67.3958 bits (163), Expect = 1.261e-10
Identity = 141/613 (23.00%), Postives = 212/613 (34.58%), Query Frame = 1
Query:  595 CEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC----------------CDKSQVNCKPCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCI-------MCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM-------------TCKVDCV-------MGQWTNETACNAQCCGGNSVAYGIITQVRDLL--------IPSINTNAKECETNRTVPCQLDCPVDCK----VLTYETSECIKLCSANN-TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT----YEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-TRPPGIMEESLPD-TIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKI--VSPCNVTC 2226
            C W  WS WT CS  C      + R  + +       T    +  +   CT    +        +       C   C   L+  + C++   C  GC+C  G +E   G+C+L + C                 D+ Q+ CK C   VC  G+  C  +  C+       W +WSPC    GP          +     G   + + +D+ P ++           +C+D ET + + +G P         C    + Q+ C P          W  W  WS C   C  G + R R+  D     +  C GP  +TE C M                +DC           W         C  G     G + Q    +        +PS N + +   T      QLDC  +C      L     EC  L   +  ++C   CG G + +      +     + C+      ++ C L  C +    P Q+LS C   C   C  L     C    C   C CP   L  +G C+    C CT      G T P       LP  T+  ++C +CTC+ G +IC+   CQ+      W+   + PC  TC
Sbjct: 4216 CTWGDWSSWTRCS--CKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRL-CQDLPPCQPGCYCPKGLLEQA-GSCILPEQCNCWHISGEGARVTLAPGDRLQLGCKEC---VCRRGELQCS-SQGCEGLLPLTGWSEWSPC----GPCLPQSALAPASRTALEGHWPL-NTSDLPPPSVTLLASEQYRHRLCLDPETRRPW-AGDPA-------LCTVPLSQQRLC-PDPGACNDTCQWGPWGPWSPCQMPCSGGFKLRWRVARD---TSAGECPGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPTQVV---QLDC-HNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGKGTMVR--HRSCEEHPDREPCQALDLQQWQECNLQACPE--CPPGQVLSTCATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQECAPGEIWQHGKLGPCEKTC 4795          

HSP 7 Score: 66.2402 bits (160), Expect = 3.214e-10
Identity = 65/212 (30.66%), Postives = 79/212 (37.26%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            L C N C + C DL    +C    C   C CP   L QDG CV  S CRC       G        E  P  +   DC+NCTC  G  +C    C     WS W   S C+  CGKG     R+  +        CQ  +           C E      L  S C   C  + + L P  +     C+ GC C PG     N TC+P   C
Sbjct: 4529 LDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRC-------GLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLGPWSAW---SECSAVCGKGTMVRHRSCEEHPDR--EPCQALDLQQWQECNLQACPECPPGQVL--STCATMCPSLCSHLWPGTICVREPCQLGCGC-PGGQLLYNGTCIPPEAC 4725          

HSP 8 Score: 60.4622 bits (145), Expect = 1.551e-8
Identity = 105/445 (23.60%), Postives = 154/445 (34.61%), Query Frame = 1
Query: 1186 VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSS-DDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDL-------------STRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTV--PCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACP-DNMLEQDGQ-CVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQ------GSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEE 2439
            VP   C      ++Y  GS +  ++ C+ C C       C     ++ +P   W+ W+ WS+CS +C    R R R C  P                 +T C GP  E EPC++  C        W+  + C+  C G      G+ ++ R    PS       CE  +     CQ   CPV         + C  +  A  + C P                                   C +SC     L+ CV  C+                  C CP   +L  DG  CV  S C C   D L G R       +    + P  CN+CTC +G+  CT   CQ    W  W   + C+  C    +   R  V     +GG+ C       G     E C  AT  C ++ A+S    +   +CD  + + + + VC  
Sbjct: 2973 VPVQDCPCAHRGRLYSPGSAV--HLPCENCSCISGLITNCSSWPCEEGQP--AWSSWTPWSVCSASCNPARRHRHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPWSGCSRSCGG------GLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPV---------TNCSAMEGAEYSPCGPP----------------------------------CPRSC---DDLVHCVWRCQ----------------PGCYCPLGKVLSADGAICVKPSYCSCL--DLLTGKR-----HHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATA-CPVDGAWSPWGPW--SSCDACLGQSYRSRVCSH 3335          

HSP 9 Score: 60.077 bits (144), Expect = 1.947e-8
Identity = 109/453 (24.06%), Postives = 156/453 (34.44%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFT----AQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICI--------DPC-EDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPGIMEESL----PDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT---QCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRN 2472
            C+D  T + + +G+ +     C  C C           CQ S D       W  WS W+ CS  C   TR+R R C+         PC E+     V  ++E  P    C VD     W   ++C+A  C G S    + +       P I+   K C                 +  Y+ S   + C  ++T C   CG G      Q+++                    C Q C    Q LS  + C+           +  C   C CP   L QDG CV   +C C +    +G     +R  G    S     P  +    C+NCTC  G   C     C     WS W     C+V+CG G Q   R  A+        C G      IC+        C     Y     +  C  +C  V  ++   +  C+EGC C  G  ++
Sbjct: 3203 CLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGD-------WCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDA--CLGQSYRSRVCSH------PPISDGGKPC-----------------LGGYQQS---RPCRNSSTLCT-DCGGG------QDLLP-------------------CGQPCPHSCQDLSLGSTCQP---------GSAGCQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCAR------PPCPGLAQQSRICHIHVCRETGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTFQH 3579          

HSP 10 Score: 53.5286 bits (127), Expect = 1.920e-6
Identity = 97/418 (23.21%), Postives = 150/418 (35.89%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC------------STTENEHDSCYSSDCH------------------CDVLFSDVKFKIHRDIIDAWVELDDIIG----------FSSLMELIEDGQTVA-SNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVII-KQPNYGGKFC-EPNGN----EEIDDCPNTCIC----EWSPWSHWTECSQNCGGGTTNK--TRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCEN-----------------GQAVCIPNDNCDCS-----------------WNQWQDWSPCNRVCG 1086
            + WS WS C+ SCG G   R+R C               + + ++C +  C                   C     D+   + R     +  L  ++           + S ++L+   +  A + +     C  C C  G L+C  D  C+   +W  WS+W+ CS  C   ++ RSR  +   P +GG  C E +G      +++ CPN   C     WSPW  W+ C    G    ++  +  P++ G          +  C   S    T    C G +  + C    CP +C D+  G      S+ C +GC C PG +    G CV    C      + +P   G+ EN                 G+ V  P DNC C                  W+ W  W  C+  CG
Sbjct: 3092 SPWSPWSGCSRSCGGGLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPVTNCSAMEGAEYSPCGPPCPRSCDDLVHCVWRCQPGCYCPLGKVLSADGAICVKPSYCSCLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNC-TDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDACLGQSYRSRVCSHPPISDGGKPCLGGYQQSRPCRNSS----TLCTDCGGGQDLLPC-GQPCPHSCQDLSLGSTCQPGSAGCQSGCGCPPGQLSQD-GLCVFPVDC----HCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCG 3498          

HSP 11 Score: 51.2174 bits (121), Expect = 9.839e-6
Identity = 28/87 (32.18%), Postives = 38/87 (43.68%), Query Frame = 1
Query: 1894 SCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWIC 2154
            +C   C     +L   C    C+E C CP+  L   G C+  + C C W  +     PPG        T+  KDC NCTC+  +W C
Sbjct: 1165 TCPPTCHDHHSELRWHCQVITCVEGCFCPEGTLLHGGACMKLAACPCEWQGSFF---PPG--------TVLQKDCGNCTCQGSQWHC 1240          
BLAST of Subcommissural organ spondin vs. Ensembl Mouse
Match: Sspo (SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311])

HSP 1 Score: 107.842 bits (268), Expect = 3.866e-23
Identity = 150/570 (26.32%), Postives = 224/570 (39.30%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT--CCDKSQVNCKP-------CETGVCENGQAVCIP---NDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETN--RTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT-----YEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCGDL--SKKCTNT-DCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            WS WS W+ C ++CGGG + ++R+     P N G     +   V   CN   C        C      ++C N  CP +C D+ +GG+ C+E   C  GC C+ G++E   G CV      C D    +  P       C    C+ GQ  C     +    C+W+ W  WS C+  CGP  Q     ++T      + C    +  +PC  VPC  +C+ +  + ++  G     +  CQ+C C  T +      +D   P   W  WS+WS CS +C  G++ R R C +      S  C GP  +T  C    C        W     C+  C  G +   G    +        N      +T    + PCQ DC       T+        C         SC   +  +   ++      G+    T     + PC +GNCS+ SC  P +  SC +PC   C      + C +   C   C CP  +LEQ G C+   +C C W+ +  G R         P       C  C CR+G+  C++  C+     + W   SPC 
Sbjct:   28 WSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVR-PCNPMPCEEG-----CPAGMEMVSCAN-HCPYSCSDLQEGGM-CQEDQACQLGCRCSEGFLEQD-GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALE-CQKEQSQSQPCPEVPCPPLCLHE--AHLHELGDNW-LHGECQQCSC--TPEGAICKDTDCAVPRG-WTLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTFLGLDTQACYSGPCQDDC-------TWGDWSSWTRC---------SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC-WHISGEGAR-----VTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSEWSPCG 559          

HSP 2 Score: 67.0106 bits (162), Expect = 1.402e-10
Identity = 60/202 (29.70%), Postives = 84/202 (41.58%), Query Frame = 1
Query: 1744 CDPSCGHGMVTKTPQEIVKAV-NGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQ--QDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
            CD SCG G   ++         NGG +C        PC    C + C A  +++SC N C   C DL +      +  C   C C +  LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT  +C     C WS W   S C+ +CG   Q+  R  +  +     +CQ   +  + C
Sbjct:   37 CDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECT--DAQGRSWAPGSQHQDA--------CNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQ-SRFRSSTSGSWALECQKEQSQSQPC 227          

HSP 3 Score: 65.4698 bits (158), Expect = 3.573e-10
Identity = 65/212 (30.66%), Postives = 79/212 (37.26%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            L C N C + C DL    +C    C   C CP   L QDG CV  S CRC       G        E  P  +   DC+NCTC  G  +C    C     WS W   S C+  CGKG     R+  +        CQ  +           C E      L  S C   C  + + L P  +     C+ GC C PG     N TC+P   C
Sbjct:  703 LDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRC-------GLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLGPWSAW---SECSAVCGKGTMVRHRSCEEHPDR--EPCQALDLQQWQECNLQACPECPPGQVL--STCATMCPSLCSHLWPGTICVREPCQLGCGC-PGGQLLYNGTCIPPEAC 899          

HSP 4 Score: 51.9878 bits (123), Expect = 4.604e-6
Identity = 56/180 (31.11%), Postives = 74/180 (41.11%), Query Frame = 1
Query:  592 ICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQIT--CHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC------------CDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCG 1086
             C+W PW  W+ C   C GG   + R   ++           T +CN  SC  E+    C       T  C N  CPR+C D+ D G+ C +   C  GC C PG  V+D  G+CV   +C               +QV    C    C NG  +C P+  C      W  WS C+ VCG
Sbjct:  639 TCQWGPWGPWSPCQMPCSGGFKLRWRVARDTSAGECPGPWAQTESCNMGSCPGES----CETRDTVFTLDCAN-QCPRSCADLWD-GVQCLQ-GPCSPGCRCPPGQLVQD--GHCVPISSCRCGLPSANASWELAPTQVVQLDCHNCTCINGTLMC-PHLECPVL-GPWSAWSECSAVCG 807          
BLAST of Subcommissural organ spondin vs. Ensembl Mouse
Match: Otog (otogelin [Source:MGI Symbol;Acc:MGI:1202064])

HSP 1 Score: 61.2326 bits (147), Expect = 9.394e-9
Identity = 27/75 (36.00%), Postives = 46/75 (61.33%), Query Frame = 1
Query: 1957 CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDC 2181
            C++ C CP+ ++ +DG C+S +EC C ++  L    PPG        ++  +DCN CTC  GKW+C++++C  +C
Sbjct:  438 CVDGCYCPNGLIFEDGGCMSPAECPCEFHGTL---HPPG--------SVVTEDCNACTCTAGKWVCSSSVCPAEC 501          
BLAST of Subcommissural organ spondin vs. UniProt/SwissProt
Match: sp|Q2PC93|SSPO_CHICK (SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 1.944e-29
Identity = 192/739 (25.98%), Postives = 269/739 (36.40%), Query Frame = 1
Query:  331 QTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVII-KQPNYGGKFCEPNGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCK------------------------------------PCETGVCENGQAVCI-PNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXX--XXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN----GTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-------------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANN--TQCDPSCGHGMVTKTPQ-EIVKAVNGGKNCEVTYEPCYLGN---CSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQ-DCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAA 2331
            Q +    TV  +C  C C SG+L C  +  C+ D  WS W  WS CS GC   ++  SR      P  GG+ C  +   +   CP T  C     W  WS W  CS +CGGG   + R  P   GC      ++ +  CN   C      P   G   +       CP +C   L G I+C     C  GC C  G +    G+C+    C   ++V  K                                     C +  C +G+  C  P    D  ++ W  WS C+R CG       R   TN +    G+ C G  +D K C    C            P+  P P     +E                    +  +  WS WS CS  C +     T++R+R C+      +  C G   + +PC +                ++C    W   T C+  C        G+  Q R      +   +    + R  P  L   V  +  + +  +     SA +  ++CD +CG G   +T         NGG+ C       +L N   C  SC     L++C N C + CGDL +         C   C CP+  LEQDG CV  + C CT                 +P +     CNNCTC +G+  CT  +C    C WS W   SPC+VTCG G Q   RT    A     +CQG    +  C A 
Sbjct: 3611 QELQPGETVQRHCQNCTCKSGTLQCHAEPGCRADGGWSPWGPWSPCSPGCQAGTQLASRQCNNPTPQLGGRGCSGHSQRQ-RPCPATEGCPEEEPWGEWSPWGPCSASCGGGEQLRHRDCPPPGGC---PGLALQSKTCNTHVCREAGCPP---GRLYRECQQGEGCPYSCAH-LAGRIACFPGG-CQEGCHCPTGTLLHH-GHCLQECPCVLTAEVLRKLRNSSADLQAAPHLLGTRGPPLALDQELPPGSTIHSACTSCTCLHGRLNCSEPVCPRDGGFSPWGPWSSCSRSCGGLGVMTRRRGCTNPEPARGGRDCAGPRSDSKYCQSPEC---------PAVPTTEPGPGVAGAEE--------------------EEGFGPWSPWSPCSKTCTHPERPATKTRERPCVG-----TAVCSGDGFQEQPCNLPLCSDVPPCQGEDCAGLNCSWAPWGPWTECSRSC--------GVGRQQR------LRAYSPPGASGRWCPGILSAFVQRRFCSLQACKVDGAWSAWSPWSRCDRTCGGGRAVRTRSCTRPPPKNGGQRCPGERHQLHLCNAQPCDDSCPPGMALVTCANHCPRHCGDLQEGIVCREEEHCEPGCRCPNGTLEQDGGCVPLAHCECTDAQG----------HGWVPGSTHHDGCNNCTCLEGRLRCTDRLCPPLRCPWSRWSRWSPCSVTCGDGQQTRFRT--PTAGSWDEECQGEQMENRGCAAG 4279          

HSP 2 Score: 103.219 bits (256), Expect = 9.939e-21
Identity = 169/672 (25.15%), Postives = 240/672 (35.71%), Query Frame = 1
Query:  394 SLDCFE--DENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCT-TETSTP----ICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC-CDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNI-VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKD-CNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC 2322
            S DC +  DE+   DC  S W  WS+CS  C     +R RV+++    GG    P  +     +  CP      W+ W  W+ C   CGGG  ++TR+    P  +G    +  ++ +  CN   C  T    P    +  G+ VQ       CP+ C D L    SC+  S C  GC C PG      G CV +  C C + Q    P        C   VC +G   C        C+W+ W  W+ C+R CG                  Q    S ++    N   PC    D +T ++                       +EC       +P + W+ W+ WS CS +C +    R R      CE + T C G  ++ EPC    C V  V   W+  + C+A C        G+ T+ R    P+                      +C     +T  C      N   C   C   M   T +E   +                G C   C      ++C                   C   C CP  +L Q+G CV  S C C    +L             P  I   D CNNCTC  G+ +C+T  C   C WS+W   S C+ +C  G+++  R  +      GG  CQG +   E C
Sbjct: 2561 SRDCADGSDESSCADCILSPWGGWSQCSHSCGLGVTSRQRVLLRGALPGGTCHTPRLDTRACFLRACPVPGA--WAAWGVWSSCDAECGGGMRSRTRSCTDPPPKNGGQPCAGEALQSQPCNLQPCGDTRECGPGMVLVQEGDCVQGLV--PPCPQVCGD-LSATSSCQ--SPCQEGCRCPPGLFLQE-GTCVNASQCHCHQGQQRWLPSQVFLRDGCSQCVCRDGVVTCEDTACPIACAWSAWSLWTLCDRSCG---------------VGMQERFRSPSNPAAANGGAPC----DGDTREV-----------------------RECHTPCATAEPSSGWSSWTPWSPCSRSCFHHVDQRGRRHRFRHCEGMGT-CPGLGVQEEPCDTAPCPVAGVWMPWSAWSECSAPC------DAGVQTRSRTCTPPAFGG------------------AECTGPHLQTRNC------NTRPCGAQCPDTMQYLTAEECRHSE---------------GRCPWICQDLGAGVACT----------------AQCQPGCHCPAGLLLQNGTCVPPSHCLCHHRGHLY-----------QPGDINALDTCNNCTCVTGQMVCSTETCPVPCTWSNWTAWSTCSHSCDVGMRRRYRVPIVPPLAGGGPPCQGPSMEVEFC 3109          

HSP 3 Score: 77.7962 bits (190), Expect = 6.889e-13
Identity = 95/403 (23.57%), Postives = 125/403 (31.02%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETE------------PCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSK--KCTNTD-CIESCACPDNMLEQDGQCVSKSECRCTW----NDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNI-CQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEICYAATQCCE 2346
            C+D  + Q +  G  +P    C  C C    Q     +         W EWS W+ CS +C +   +R R+C  P            +E              P +  C  D     W   + C    CGG +V      + R    P        C                +   + TS C            P C  G+V                                        +C  PC   C DL +   C  T  C+ +CACP   L QDG CV    CRC W    N ++        M+E  P     + C NCTC+ G   C     C+ D  WS W   SPC+  C  G Q   R         GG  C G +     C A   C E
Sbjct: 3369 CLDAHSGQRHQPGQSVPRGDGCNNCTCT---QGRLLCTGLPCPVPGAWCEWSPWTPCSRSCGDEAATRHRVCSCPAPQQGGAGCPGGLEGHGDTGMQLQHQECPSVPPCPEDGAWAAWGPWSGCGG--CGGQAV------RTRSCSSPPARFGGLPCAGEAR---------QSRACPWATSSC------------PECAGGLVA--------------------------------------FTCGKPCPHSCEDLREDTACMATPRCLPACACPHGQLLQDGDCVPPELCRCAWAPSKNGSIWEQDGAVPMQELQPGETVQRHCQNCTCKSGTLQCHAEPGCRADGGWSPWGPWSPCSPGCQAGTQLASRQCNNPTPQLGGRGCSGHSQRQRPCPATEGCPE 3701          

HSP 4 Score: 63.929 bits (154), Expect = 1.099e-8
Identity = 79/285 (27.72%), Postives = 106/285 (37.19%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQ--------VNCKPCETGVCENGQAVCIPN--DNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRD 1407
            WS WS W+ C + CGGG   +TR+     P N G     +   + + CN   C        C      +TC N  CPR C D+ +G I C E   C  GC C  G +E   G   L+   C  +Q         +   C    C  G+  C         C W++W  WSPC+  CG  +  +TR          + C G   + + C   PC  +C      +       M     CQ C C      E     D     A    W  WS CS +C  G  SR+
Sbjct: 4079 WSAWSPWSRCDRTCGGGRAVRTRSCTRPPPKNGGQRCPGERHQLHL-CNAQPCDDS-----CPPGMALVTCAN-HCPRHCGDLQEG-IVCREEEHCEPGCRCPNGTLEQDGGCVPLAHCECTDAQGHGWVPGSTHHDGCNNCTCLEGRLRCTDRLCPPLRCPWSRWSRWSPCSVTCG--DGQQTRFRTPTAGSWDEECQGEQMENRGCAAGPCPPLCPQGSWERRL---GDMWLQGECQRCTCT----PEGTVCEDTTCAGAEHCTWGTWSPCSRSCGTGLASRE 4346          

HSP 5 Score: 62.3882 bits (150), Expect = 2.640e-8
Identity = 115/477 (24.11%), Postives = 167/477 (35.01%), Query Frame = 1
Query: 1342 WNEWSAWSICSGNCPNGTRSRDRICID-PCEDLSTRCVGPRIETEPC---------------IMTCKVDCVM----------GQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECE----TNRTVPCQLDCPVDCK-------VLTYETSECIKLCSANN----TQCDPSCGHGM--VTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPC--EQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPP-GIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYA---ATQCCEINVAYSLK-----NSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVS 2610
            W  W  WS C   C  G RSR R C D P ++    C G  ++++PC               ++  + DCV           G  +  ++C + C  G     G+  Q    +      NA +C       R +P Q+     C        V+T E + C   C+ +     T CD SCG GM    ++P     A NGG  C+                  +++  C  PC   +     S     + C  SC    + ++Q G+      C        +GT P  G+ EE                      C T  C     W  W   S C+  C  GVQ   RT    A +GG +C G +     C       QC +     + +        C   C D+   +  T  C+ GC C  G +   N TCVP S C  C   G ++Q G      ++C    C  G+M  S
Sbjct: 2633 WAAWGVWSSCDAECGGGMRSRTRSCTDPPPKNGGQPCAGEALQSQPCNLQPCGDTRECGPGMVLVQEGDCVQGLVPPCPQVCGDLSATSSCQSPCQEGCRCPPGLFLQEGTCV------NASQCHCHQGQQRWLPSQVFLRDGCSQCVCRDGVVTCEDTACPIACAWSAWSLWTLCDRSCGVGMQERFRSPSNPA-AANGGAPCDGDT---------------REVRECHTPCATAEPSSGWSSWTPWSPCSRSCF---HHVDQRGRRHRFRHC------EGMGTCPGLGVQEEP---------------------CDTAPCPVAGVWMPWSAWSECSAPCDAGVQTRSRTCTPPA-FGGAECTGPHLQTRNCNTRPCGAQCPDTMQYLTAEECRHSEGRCPWICQDLGAGVACTAQCQPGCHCPAGLLLQ-NGTCVPPSHCL-CHHRGHLYQPGDINA-LDTCNNCTCVTGQMVCS 3053          

HSP 6 Score: 54.299 bits (129), Expect = 8.686e-6
Identity = 43/154 (27.92%), Postives = 58/154 (37.66%), Query Frame = 1
Query: 1825 EVTYEPCYLGNCSQS-CVAPKQLLSCVNPCEQRCGDLSKK---CTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAV 2274
            +V   PC    CS+S C  P +   C  PC + C  L         + C+  C CP  +LEQ   CV   +C C      L T   G +    P  I    C  C C+ G   C++  CQ     S W   +PC+         L      V+V
Sbjct: 4421 DVELHPCNTSGCSESSCEPPFEFQPCSPPCARLCSTLQHPELCPAQSHCLPGCFCPQGLLEQRSACVPPEQCDC------LHTNESGDLVTLSPGDIILLGCKECVCQDGALQCSSEGCQGLLPLSPWSEWTPCSTCLPLFPSHLGDATPHVSV 4568          
BLAST of Subcommissural organ spondin vs. UniProt/SwissProt
Match: sp|Q700K0|SSPO_RAT (SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 1.693e-23
Identity = 190/758 (25.07%), Postives = 281/758 (37.07%), Query Frame = 1
Query:  100 WSDWSLCNASCG-YGSSVRSRNC--STTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENC-----------------KKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT--CCDKSQVNCKP-------CETGVCENGQAVCIPN---DNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETN--RTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCG-DLSKKCTN--TDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            W  WSLC+ SCG  G+  R+R C   T      SC       +  FS          ++    L    G  S         T  ++         CL N    D  ++  C                  ++C W+ W+ W  CS  C    + R R     P  GG +C       +E   C N   C     WS WS W+ C ++CGGG + ++R+     P N G     +   V  +CN   C  +     C      ++C N  CP +C D L   + C+E   C  GC C+ G++E   G CV      C D    +  P       C    C+ GQ  C          C+W+ W  WS C+  CGP  Q     ++T      + C    +  +PC   PC  +C+ +    +         +  CQ+C C  T +      +D   P   W  WS+WS CS +C  G++ R R C +   +  S  C GP  +T+ C    C     +  W     C+  C  G +   G    +        N      +T      PCQ DC +     ++    C  L         P+ G          +   ++G       + PC +GNCS+ SC+ P +  SC +PC   C   LS +       C   C CP  +LEQDG C+   +C C W+ +  G R         P       C  C C+ G+  C++  C+     + W   SPC 
Sbjct: 3812 WGMWSLCSHSCGGLGTRTRTRQCVLPTLAPAGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDLTHPAWRSRTRLCLANCTVGDSSQERPCNLPSCTTLPLCPGPGCGSENCFWTSWAPWEPCSRSCGVGQQRRLRAY-HPPGPGGHWCPDILTAYQERRFC-NLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGASCVGERHHVR-SCNPMPCEKD-----CPAGMEMVSCAN-RCPYSCSD-LQEAVMCQEDQACQLGCRCSEGFLEQD-GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQPCPPPAHCAWSHWSAWSACSHSCGPHGQQSRFRSSTSGSWALE-CQKEQSQSQPCPEDPCPPLCLHEAHLHVLGDNW---LHGECQQCSC--TPEGVICKDTDCAVP-GGWTLWSSWSYCSVSCGGGSQVRTRSCMVSAPQHGSPSCQGPDTQTQHCGQQLCLQLLEICSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSECNDTFSGLDTQACYPGPCQEDC-MWSDWSSWTRCSCKILVQQRYRHQVPAPGQAGEGT----LCTGLDG------HFRPCAIGNCSEDSCLPPFEFQSCGSPCAGLCATHLSHQLCQDLPPCQPGCYCPMGLLEQDGGCILPEQCNC-WHTSGEGAR-----VTLAPGHRLQLGCKECVCQSGELQCSSQGCEGLLPLTGWSEWSPCG 4534          

HSP 2 Score: 98.5969 bits (244), Expect = 2.542e-19
Identity = 94/346 (27.17%), Postives = 143/346 (41.33%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLS-TRCVGPRIETEPCIMTCKVDCVMG--QWTNETACNAQCC--GGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC---EVTYEPCYLGNCSQSCV------APKQLLSCVNPCEQRC--GDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC 2322
             W+ WS W+ C  +C +G R+R R   +P      + C G R E + C   C  D + G   WT+ ++C+  C   GG+        + R  L PS        E  +  PC    CPV      +          A+ + C  SC  G+ T+  +    +  G   C         C +  C+  C       + ++ L    PC Q C   D   +CT + C   C+CP  +   +  C+ +S+C C  +  L             P  +   DCNNCTC  G+ +CT+  C   C WS W   SPC+ +C  G+++  R   A  A +GG +C+G N   E C
Sbjct: 2702 GWSAWSPWTACDHSCGSGVRARFRSPTNPPAAFGGSPCEGDRQELQACYTDCGTD-IPGWTPWTSWSSCSQSCLVPGGDPG-----RRQRSRLCPSSRDTFCPGEATQEEPCSPSLCPVPSAWGLW----------ASWSACSASCNGGIQTRG-RSCSGSAPGNPVCLGPHTQTRDCNVHPCTAQCPGNMVFRSAEKCLEEGGPCPQLCLAQDPGVECTGS-CAPGCSCPPGLFLHNASCLPRSQCPCQLHGQLYA-----------PGAVARLDCNNCTCSSGEMVCTSERCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTAPPAAFGGAECRGPNLDAEFC 3018          

HSP 3 Score: 83.9593 bits (206), Expect = 8.279e-15
Identity = 79/293 (26.96%), Postives = 117/293 (39.93%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEI-VKAVNGGKNCEVTYEPCYLGN---------CSQSCVAPKQLL---SCVNPCEQRCGDL-SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEICY 2325
            VDCV+  W+  + C+  C        G+I Q R+LL P +   +   +  R+ PC +  CPV      +   E           C  SCG G  ++    +     NGG  C        L N         C    V     L     + PC   C D  + +  +  C+E C CP  +  QD  C+  SEC C     L+G +   +M+  L       +C+ C C  G  +C    C Q C WS W   + C+ +CG GV+   R+     A +GG+ C+G     + CY
Sbjct: 2484 VDCVLAPWSGWSDCSRSC------GLGLIFQHRELLRPPLPGGSCLLDQLRSQPCFVQACPVAGAWAKWGPWE----------PCSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKVLCNLQLCPGDTDCEPGRVHVNAELCQKGLLPPCPPSCLDPEANRSCSGHCVEGCRCPPGLFLQDSHCLPLSECPC-----LVGQK---LMQPGL--AFLLDNCSQCICESGILLCKPAACSQSCGWSAWSPWTACDHSCGSGVRARFRSPTNPPAAFGGSPCEGDRQELQACY 2750          

HSP 4 Score: 74.7146 bits (182), Expect = 6.059e-12
Identity = 160/666 (24.02%), Postives = 226/666 (33.93%), Query Frame = 1
Query:  562 EEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTR---TPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVED----------MLGNCVLSDTCCDKSQVNCKPCETG----------VCENGQAVCIPNDNCDC-----------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSG----SPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICI-----------DPCEDLS----TRCVGPRIETEPCIMT-------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAV-NGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNIC--QQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
             E+  CP   I  WS W  W +CS  CGGG   ++R    P   G    S T  + V C E  C         +G   +    +  CP +C  V  G ++C  S  C  GC C  G  +           +L   +L +     + +   P   G            + GQ +     NC C                  +  W  WS C+  CG                     +G+ T  + C ++P           + P+G     P+     C    C  TA    +P +        W  WS WS CS +C + T    RSR R+C+            PC   S      C GP   +E C  T       C   C +GQ     A +    GG+               P I T  +E    R       CPV      +          +  + CD SCG G   ++         NGG +C         C    C + C A  +++SC N C   C DL +      +  C   C C +  LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT   C     C WS W   S C+ +CG   Q+  R  +  +     +CQ   +  + C
Sbjct: 3622 HEVPSCPGPGI--WSSWGPWEKCSVPCGGGEQLRSRQCARPPCPGLAQQSRTCHIHV-CRETGCP--------AGRLYRECQPSEGCPFSCAHV-TGQVACF-SESCEEGCHCPEGTFQHHSACVQECPCVLTVSLLQELGVASTALRSYPVLLGDEGQPLGPGDELDPGQMLQTVCGNCSCVHGKLSCSMEECSRVRGYFGPWGMWSLCSHSCG--------------------GLGTRTRTRQC-VLP----------TLAPAGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLA---GGWGPWSPWSPCSHSCTDLTHPAWRSRTRLCLANCTVGDSSQERPCNLPSCTTLPLCPGPGCGSENCFWTSWAPWEPCSRSCGVGQQRRLRAYHPPGPGGH-------------WCPDILTAYQE----RRFCNLRACPVPGGWSHW----------SPWSWCDRSCGGGRSLRSRSCSSPPPKNGGASCVGERHHVRSCNPMPCEKDCPAGMEMVSCANRCPYSCSDLQEAVMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECT--DAQGRSWAPGSQHQ--------DACNNCSCQAGQLSCTAQPCPPPAHCAWSHWSAWSACSHSCGPHGQQ-SRFRSSTSGSWALECQKEQSQSQPC 4202          

HSP 5 Score: 70.4774 bits (171), Expect = 1.111e-10
Identity = 122/520 (23.46%), Postives = 181/520 (34.81%), Query Frame = 1
Query:  100 WSDWSLCNASCGYGSSVRSRNCSTTENEHDSCY--------------SSDCHCDVLFSDVKFKIHRD--------IIDAWVELDD------------IIGFSSLMELIE-----DGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPN-YGGKFCE-PNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDC------------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC 1479
            W+ WS C+ASC  G   R R+CS +   +  C               ++ C  +++F   +  +             D  VE                +  +S +   +      GQ  A       +C  C C+SG + C   E C   C WS W+ WS CS  C+   + R R     P  +GG  C  PN + E       C    + WS WT CS  CGGG  N+T+    SG      + +    C+   C       +C  ++  + C     P +C  +       E +  C  GC+C       + G  +L++ C       C      +   G AV +P +NC C                  +W+ W  WS C+  C P+ + R                                C+   T+   P    +P+ VA     C     +E             W  WS WS CS +C  G RSR R C   P + L   C GP+ + E C
Sbjct: 2821 WASWSACSASCNGGIQTRGRSCSGSAPGNPVCLGPHTQTRDCNVHPCTAQCPGNMVFRSAEKCLEEGGPCPQLCLAQDPGVECTGSCAPGCSCPPGLFLHNASCLPRSQCPCQLHGQLYAPGAVARLDCNNCTCSSGEMVC-TSERCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTAPPAAFGGAECRGPNLDAEFCTL-RPCQGPGAAWSSWTPCSVPCGGGYRNRTQ---GSG----RHSPVEFSTCSLQPCAGPVPG-VCPKDQQWLDC--AQGPASCAHL---STPREANQTCHPGCYC-------LSGMLLLNNVCVPAQDCPCAH-RGRLHSPGSAVILPCENCSCVSGLITNCSSWPCEEGQPAWSSWTPWSVCSASCSPARRHRR-----------------------------RFCVRPSTTA--PFSLDLPTTVAAPTMLCPGPEAEEEPCLLPGCNQAGVWGPWSPWSGCSRSCGGGLRSRTRACDKPPPQGLGDFCEGPQAQGEAC 3286          

HSP 6 Score: 66.6254 bits (161), Expect = 1.662e-9
Identity = 106/402 (26.37%), Postives = 160/402 (39.80%), Query Frame = 1
Query:  412 DENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQI---TCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCV-LSDTCCDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPC---------NIVPCIMCIDDETSQIYPSGSPMPSN-----VACQECFCNFTAQKECQPSSDDNKP-DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDC 1503
            DE+   DC  + WS WS+CS  C      + R +++ P  GG         +   +  CP      W+ W  W  CS +CGGG  ++ R+    P  +G       S   V CN   C  +T    C   +V +    C     P      LD   +   S  CV GC C PG +++D   +C+ LS+  C   Q   +P        C   +CE+G  +C P   +  C W+ W  W+ C+  CG   + R R+        G S C G   +++ C            P         S + P G P          + ++ FC   A +E +P S    P  + W  W++WS CS +C  G ++R R C       +  C+GP  +T  C +  C   C
Sbjct: 2479 DEDDCVDCVLAPWSGWSDCSRSCGLGLIFQHRELLRPPLPGGSCLLDQLRSQPCFVQACPVAGA--WAKWGPWEPCSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKVLCNLQLCPGDTD---CEPGRVHVNAELCQKGLLPPCPPSCLDPEANRSCSGHCVEGCRCPPGLFLQD--SHCLPLSECPCLVGQKLMQPGLAFLLDNCSQCICESGILLCKPAACSQSCGWSAWSPWTACDHSCGSGVRARFRSPTNPPAAFGGSPCEGDRQELQACYTDCGTDIPGWTPWTSWSSCSQSCLVPGGDPGRRQRSRLCPSSRDTFCPGEATQE-EPCSPSLCPVPSAWGLWASWSACSASCNGGIQTRGRSCSGSAPG-NPVCLGPHTQTRDCNVHPCTAQC 2871          

HSP 7 Score: 63.5438 bits (153), Expect = 1.426e-8
Identity = 63/212 (29.72%), Postives = 79/212 (37.26%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            L C N C + C DL +  +C    C   C CP   L QDG CV  S CRC       G        E  P  +   DC+NCTC  G  +C    C     WS W   S C+  CG G     R+  +        CQ  +    +      C E      L  S C   C    + L P  +     C+ GC C PG     + TC+P   C
Sbjct: 4672 LDCANQCPRSCADLWEGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRC-------GLPSANASWELAPTQVVQLDCHNCTCINGTLMCPYPECPVLGPWSPW---SECSAVCGGGTMVRYRSCEEHP--DSAPCQALDMEQRVECNLQTCPECPPGQVL--STCATLCPSFCSHLWPGTICVREPCQLGCGC-PGGQLLHSGTCIPPEAC 4868          

HSP 8 Score: 63.1586 bits (152), Expect = 1.631e-8
Identity = 98/389 (25.19%), Postives = 134/389 (34.45%), Query Frame = 1
Query: 1342 WNEWSAWSICSGNCPNGTRSRDRICIDPCE------DLST-------RCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCAC-PDNMLEQDGQ-CVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQ------GSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEE 2439
            W+ W+ WS+CS +C    R R R C+ P        DL T        C GP  E EPC++  C    V G W+  + C+  C GG                                            L   T  C K          P  G G   + PQ        G+ C+   +PC + NCS   +   +   C  PC + C DL        C   C C P  +L  DG  CV    C C   D L G R            + P  CN+CTC +G+  CT   CQ    W  W   + C+  C    +   R  V     +GG  C       G     E C   T  C ++ A+S   S+    CD  + + + + +C  
Sbjct: 3171 WSSWTPWSVCSASCSPARRHRRRFCVRPSTTAPFSLDLPTTVAAPTMLCPGPEAEEEPCLLPGCNQAGVWGPWSPWSGCSRSCGGG--------------------------------------------LRSRTRACDK---------PPPQGLGDFCEGPQAQ------GEACQA--QPCPVANCST--IEGAEYSPCGPPCPRSCDDLVH--CMWHCQPGCYCPPGKVLSADGAICVQPHHCSCL--DLLTGKR-----HHPGSQLMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSEWTACSQPCRGQTRTRSRACVCPAPQHGGAPCPEEAGETGVQHQMEACPNPTA-CPVDGAWSPWGSW--SPCDACLGQSYRSRMCSH 3484          

HSP 9 Score: 61.6178 bits (148), Expect = 5.003e-8
Identity = 61/181 (33.70%), Postives = 76/181 (41.99%), Query Frame = 1
Query:  598 EWSPWSHWTECSQNCGGGTTNKT--RTPLNSGCDL-----SSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVT-GCFCNPGYVEDMLGNCVLSDTC-CDKSQVNCKP-------CETGVCENGQA-VCIPNDNC--DCSWNQWQDWSPCNRVC 1083
            EWS WS W+ CS+ CGG  T     R P N G D      S+ ++  T  C +  C   T    C G  V   C    CP TCDD+  G   C     C + GC+C  G V    G CV    C C    +   P       C+   C++GQ   C PN  C  DC W+ W  W+ C   C
Sbjct: 1757 EWSSWSLWSPCSEPCGGTMTRHRQCRPPQNGGQDCALLPGSTHSTHQTSPCPQEGCLNVT----CFGELVFRPC--APCPLTCDDI-SGEAVCSPDRPCSSPGCWCPEGKVLGTEGRCVRPRQCPCLVDGIRYWPGQRIKMDCQLCFCQDGQPHRCRPNPECAVDCGWSSWSPWAECLGPC 1930          

HSP 10 Score: 61.6178 bits (148), Expect = 5.443e-8
Identity = 96/369 (26.02%), Postives = 142/369 (38.48%), Query Frame = 1
Query:  328 GQTVASNITVFF--NCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQP-NYGGKFCEPNGNEEIDDCPNTC---ICEWSPWSHWTECSQNC---GGGTTNKTRT--------------------------PLNSGCDLSSDTSIVTVACN------EFSCT-TETSTPICSGNKVQITCHNV-----TCP-----RTCDDVLDGGISCEE-----------SSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCK--------------PCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPCNIVPC 1194
            GQ +      F   NC++C+C SG L C +   C + C WS WS W+ C   C +  + R R     P  +GG  CE    +E+  C   C   I  W+PW+ W+ CSQ+C   GG    + R+                          P+ S   L +  S  + +CN        SC+ +    P+C G   Q    NV      CP     R+ +  L+ G  C +           +  C  GC C PG         + + +C  +SQ  C+               C    C +G+ VC  ++ C   C W+ W  WSPC++ C    + R R         G + C G N D + C + PC
Sbjct: 2665 GQKLMQPGLAFLLDNCSQCICESGILLC-KPAACSQSCGWSAWSPWTACDHSCGSGVRARFRSPTNPPAAFGGSPCE-GDRQELQACYTDCGTDIPGWTPWTSWSSCSQSCLVPGGDPGRRQRSRLCPSSRDTFCPGEATQEEPCSPSLCPVPSAWGLWASWSACSASCNGGIQTRGRSCSGSAPGNPVCLGPHTQTRDCNVHPCTAQCPGNMVFRSAEKCLEEGGPCPQLCLAQDPGVECTGSCAPGCSCPPGLF-------LHNASCLPRSQCPCQLHGQLYAPGAVARLDCNNCTCSSGEMVCT-SERCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTAPPAAFGGAECRGPNLDAEFCTLRPC 3023          

HSP 11 Score: 61.2326 bits (147), Expect = 6.073e-8
Identity = 64/227 (28.19%), Postives = 86/227 (37.89%), Query Frame = 1
Query: 1870 CVAPKQLLSCVNPCEQRCGDLSKKCT----NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPGIMEESL----PDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT---QCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRNINNTCV 2490
            C   + LL C  PC   C DLS   T    ++ C   C CP   L QDG CV  ++C C +    +G     +R  G    S     P  +    C+NCTC  G   C     C     WS W     C+V CG G Q   R  A+        C G       C+        C     Y     +  C  +C  V  ++   +  CEEGC C  G  ++ ++ CV
Sbjct: 3514 CGGGQDLLPCGQPCPHSCQDLSLGSTCQPGSSGCQSGCGCPPGQLSQDGLCVFPADCHCHFQPKAMGIPENQSRSVGSALSSWESLEPGEVVTGPCDNCTCVAGVLQCHEVPSCPGPGIWSSWGPWEKCSVPCGGGEQLRSRQCAR------PPCPGLAQQSRTCHIHVCRETGCPAGRLYRECQPSEGCPFSCAHVTGQVACFSESCEEGCHCPEGTFQH-HSACV 3733          

HSP 12 Score: 55.0694 bits (131), Expect = 5.553e-6
Identity = 82/308 (26.62%), Postives = 112/308 (36.36%), Query Frame = 1
Query:  301 SSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVII-KQPNYGGKFCEPNGNE-----EIDDCPNTCIC----EWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPI--CSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCEN-----------------GQAVCIPNDNCDCS-----------------WNQWQDWSPCNRVCG 1086
            S L  L        S +     C  C C  G L+C  D  C+   +W  WSEW+ CS  C   ++ RSR  +   P +GG  C     E     +++ CPN   C     WSPW  W+ C    G       R+ + S    S   +       +      +STP   C G +  + C    CP +C D+  G      SS C +GC C PG +    G CV    C      + +P   G+ EN                 G+ V  P DNC C                  W+ W  W  C+  CG
Sbjct: 3351 SCLDLLTGKRHHPGSQLMRPDGCNHCTCMEGRLNC-TDLPCQVSGDWCPWSEWTACSQPCRGQTRTRSRACVCPAPQHGGAPCPEEAGETGVQHQMEACPNPTACPVDGAWSPWGSWSPCDACLG----QSYRSRMCSHPPPSDGGTPCLGGHQQSRPCRNSSTPCTDCGGGQDLLPC-GQPCPHSCQDLSLGSTCQPGSSGCQSGCGCPPGQLSQD-GLCVFPADC----HCHFQPKAMGIPENQSRSVGSALSSWESLEPGEVVTGPCDNCTCVAGVLQCHEVPSCPGPGIWSSWGPWEKCSVPCG 3647          
BLAST of Subcommissural organ spondin vs. UniProt/SwissProt
Match: sp|Q8CG65|SSPO_MOUSE (SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 SV=2)

HSP 1 Score: 112.079 bits (279), Expect = 2.103e-23
Identity = 193/763 (25.29%), Postives = 283/763 (37.09%), Query Frame = 1
Query:  100 WSDWSLCNASCG-YGSSVRSRNC--STTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENC-----------------KKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDT--CCDKSQVNCKP-------CETGVCENGQAVCIP---NDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC-IMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETN--RTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT-----YEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCGDL--SKKCTNT-DCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            W  WSLC+ SCG  G+  R+R C   T      SC       +  FS          ++    L    G  S         T  ++         CL N    D  ++  C                   +C W+ W+ W  CS  C    + R R     P  GG +C       +E   C N   C     WS WS W+ C ++CGGG + ++R+     P N G     +   V   CN   C        C      ++C N  CP +C D+ +GG+ C+E   C  GC C+ G++E   G CV      C D    +  P       C    C+ GQ  C     +    C+W+ W  WS C+  CGP  Q     ++T      + C    +  +PC  VPC  +C+ +  + ++  G     +  CQ+C C  T +      +D   P   W  WS+WS CS +C  G++ R R C +      S  C GP  +T  C    C        W     C+  C  G +   G    +        N      +T    + PCQ DC       T+        C         SC   +  +   ++      G+    T     + PC +GNCS+ SC  P +  SC +PC   C      + C +   C   C CP  +LEQ G C+   +C C W+ +  G R         P       C  C CR+G+  C++  C+     + W   SPC 
Sbjct: 3663 WGMWSLCSRSCGGLGTRTRTRQCVLPTLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLAGGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCTVGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSCGVGQQRRLRAY-HPPGPGGHWCPDILTAYQERRFC-NLRACPVPGGWSHWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVR-PCNPMPCEEG-----CPAGMEMVSCAN-HCPYSCSDLQEGGM-CQEDQACQLGCRCSEGFLEQD-GGCVPVGHCECTDAQGRSWAPGSQHQDACNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQSRFRSSTSGSWALE-CQKEQSQSQPCPEVPCPPLCLHE--AHLHELGDNW-LHGECQQCSC--TPEGAICKDTDCAVPR-GWTLWSSWSYCSVSCGGGSQVRTRSCTVSAPPHGSLSCEGPDTQTRHCGQQLCLQKLERCSWGPWGPCSRSCGTGLASRSGSCPCLLTKEDSKCNDTFLGLDTQACYSGPCQDDC-------TWGDWSSWTRC---------SCKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRLCQDLPPCQPGCYCPKGLLEQAGSCILPEQCNC-WHISGEGAR-----VTLAPGDRLQLGCKECVCRRGELQCSSQGCEGLLPLTGWSEWSPCG 4385          

HSP 2 Score: 90.1225 bits (222), Expect = 1.053e-16
Identity = 89/346 (25.72%), Postives = 140/346 (40.46%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLS-TRCVGPRIETEPCIMTCKVDCVMG--QWTNETACNAQCC--GGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKL-CSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC---EVTYEPCYLGNCSQSCV------APKQLLSCVNPCEQRC--GDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEIC 2322
             W+ WS W+ C  +C +G R+R R   +P      + C G R E + C   C  + + G   WT+ ++C+  C   GG+               P     ++ C ++R   C  +   +                 A+ + C  SC  G+ T+  +    +  G   C         C +  C+  C       + +Q L    PC Q C   D   +CT + C  SC CP  +   +  C+ +S+C C  +  L             P  +   DCNNCTC  G+ +CT+  C   C WS W   SPC+ +C  G+++  R   +  A +GG +CQG N   E C
Sbjct: 2553 GWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTE-IPGWTPWTSWSSCSQSCLVPGGD---------------PGWRQRSRLCPSSRDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRG-RSCSGSAPGNPVCLGPHTQTRDCNMHPCTAQCPGNMVFRSAEQCLEEGGPCPQLCLAQDPGVECTGS-CAPSCNCPPGLFLHNASCLPRSQCPCQLHGQLYA-----------PGAVAHLDCNNCTCISGEMVCTSKRCPVACGWSPWTPWSPCSQSCNVGIRRRFRAGTEPPAAFGGAECQGPNLDAEFC 2869          

HSP 3 Score: 83.1889 bits (204), Expect = 1.371e-14
Identity = 77/293 (26.28%), Postives = 116/293 (39.59%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEI-VKAVNGGKNCEVTYE---PCYLGNCSQSCVAPKQLL---------SCVNPCEQRCGDL-SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAV-YGGNDCQGSNTTDEICY 2325
            VDCV+  W+  + C+  C        G+I Q R+LL   +   +   +  R+  C +  CPV      +             T C  SCG G  ++    +     NGG  C        PC L  C         L+           V PC   C D  + +  +  C+E C CP  +L QD  C+  SEC C     L+  R   +++          +C+ C C +G  +C    C Q C WS W   + C+ +CG GV+   R+     V +GG+ C+G     + CY
Sbjct: 2335 VDCVLAPWSGWSDCSRSC------GLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGAWAEW----------GPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTDCEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLD----------NCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACY 2601          

HSP 4 Score: 82.0333 bits (201), Expect = 3.029e-14
Identity = 159/662 (24.02%), Postives = 227/662 (34.29%), Query Frame = 1
Query:  562 EEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGC-DLSSDTSIVTV-ACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLG-----NCVLSDTCCDKSQVNC--------------KPCETGV-CENGQAVCIPNDNCDC-----------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSG----SPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICIDPCEDLSTRCVGPRIETEPC-------IMTC------KVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVP-----CQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAV-NGGKNC---EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQ--QDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
             E+  CP   I  WS W  W +CS +CGGG   ++R      C  L+  + I  +  C E  C         +G   +    +  CP +C  V  G ++C  S  C  GC C  G  +  +       CVL+     +  +                KP   GV    GQ +     NC C                 S+  W  WS C+R CG                     +G+ T  + C ++P           + P G     P+     C    C  TA    +P +        W  WS WS CS +C +      RSR R+C+  C       VG   +  PC       ++ C        +C    W     C+  C        G+  Q R             C    T       C L  CPV      +          +  + CD SCG G   ++         NGG +C        PC    C + C A  +++SC N C   C DL +      +  C   C C +  LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT  +C     C WS W   S C+ +CG   Q+  R  +  +     +CQ   +  + C
Sbjct: 3473 HEVPSCPGPGI--WSSWGPWEKCSVSCGGGEQLRSRQCARPPCPGLAQQSRICHIHVCRETGCP--------AGRLYRECQPSDGCPFSCAHV-TGQVACF-SERCKEGCHCPEGTFQHHVACVQECPCVLTVLLLQELGLASAALGSYPTLLGDEGKPLGPGVELLPGQMLQTDCGNCSCVHGKLSCSMVECSRVHGSFGPWGMWSLCSRSCGG--------------------LGTRTRTRQC-VLP----------TLAPGGLSCRGPLQDLEYCFSPECPGTAGSTVEPVTGLA---GGWGPWSPWSPCSHSCTDPAHPAWRSRTRLCLANCT------VGDSSQERPCNLPSCAALLPCPGPGCGSGNCFWTSWAPWEPCSRSC--------GVGQQRRLRAYHPPGPGGHWCPDILTAYQERRFCNLRACPVPGGWSHW----------SPWSWCDRSCGGGRSLRSRSCSSPPPKNGGTSCVGERHHVRPCNPMPCEEGCPAGMEMVSCANHCPYSCSDLQEGGMCQEDQACQLGCRCSEGFLEQDGGCVPVGHCECT--DAQGRSWAPGSQHQDA--------CNNCSCQAGQLSCTAQLCSPPAHCAWSHWSAWSSCSHSCGPQGQQ-SRFRSSTSGSWALECQKEQSQSQPC 4053          

HSP 5 Score: 68.5514 bits (166), Expect = 4.532e-10
Identity = 104/399 (26.07%), Postives = 153/399 (38.35%), Query Frame = 1
Query:  400 DCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQI---TCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPC---------NIVPCIMCIDDETSQIYPSGSPM--------PSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM 1485
            D  +++NC  DC  + WS WS+CS  C      + R +++ P  GG         +   +  CP      W+ W  WT CS +CGGG  ++ R+    P  +G       S     CN   C  +T    C    V +    C     P      LD   +   S  C+ GC C PG +        LS+  C   Q   +P        C   +CE G  +C P   +  C W+ W  W+ C+R CG   + R R+        G S C G   +++ C            P         S + P G P         PS+   ++ FC   A +E   S       + W  W++WS CS +C  G ++R R C       +  C+GP  +T  C M
Sbjct: 2327 DGSDEDNCV-DCVLAPWSGWSDCSRSCGLGLIFQHRELLRLPLPGGSCLLDQFRSQSCFVQACPVAGA--WAEWGPWTACSVSCGGGHQSRQRSCVDPPPKNGGAPCPGPSHEKAPCNLQLCPGDTD---CEPGLVHVNAELCQKGLVPPCPPSCLDPEANRSCSGHCMEGCRCPPGLLLQDSHCLPLSECPCLVGQKLIQPRLAFLLDNCSQCICEKGTLLCKPGACSQSCGWSAWSPWTACDRSCGSGVRARFRSPTNPPVAFGGSPCEGDRQELQACYTDCGTEIPGWTPWTSWSSCSQSCLVPGGDPGWRQRSRLCPSS---RDTFCPGEATQEEPCSPPVCPVPSAWGLWASWSTCSASCNGGIQTRGRSCSGSAPG-NPVCLGPHTQTRDCNM 2715          

HSP 6 Score: 67.3958 bits (163), Expect = 8.820e-10
Identity = 141/613 (23.00%), Postives = 212/613 (34.58%), Query Frame = 1
Query:  595 CEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC----------------CDKSQVNCKPCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCI-------MCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM-------------TCKVDCV-------MGQWTNETACNAQCCGGNSVAYGIITQVRDLL--------IPSINTNAKECETNRTVPCQLDCPVDCK----VLTYETSECIKLCSANN-TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT----YEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-TRPPGIMEESLPD-TIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKI--VSPCNVTC 2226
            C W  WS WT CS  C      + R  + +       T    +  +   CT    +        +       C   C   L+  + C++   C  GC+C  G +E   G+C+L + C                 D+ Q+ CK C   VC  G+  C  +  C+       W +WSPC    GP          +     G   + + +D+ P ++           +C+D ET + + +G P         C    + Q+ C P          W  W  WS C   C  G + R R+  D     +  C GP  +TE C M                +DC           W         C  G     G + Q    +        +PS N + +   T      QLDC  +C      L     EC  L   +  ++C   CG G + +      +     + C+      ++ C L  C +    P Q+LS C   C   C  L     C    C   C CP   L  +G C+    C CT      G T P       LP  T+  ++C +CTC+ G +IC+   CQ+      W+   + PC  TC
Sbjct: 4216 CTWGDWSSWTRCS--CKVLVQQRYRHQVPAPGQAGEGTPCTRLDGHFRPCTIGNCSEDSCPPPFEFQSCGSPCAGLCATHLNHRL-CQDLPPCQPGCYCPKGLLEQA-GSCILPEQCNCWHISGEGARVTLAPGDRLQLGCKEC---VCRRGELQCS-SQGCEGLLPLTGWSEWSPC----GPCLPQSALAPASRTALEGHWPL-NTSDLPPPSVTLLASEQYRHRLCLDPETRRPW-AGDPA-------LCTVPLSQQRLC-PDPGACNDTCQWGPWGPWSPCQMPCSGGFKLRWRVARD---TSAGECPGPWAQTESCNMGSCPGESCETRDTVFTLDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPTQVV---QLDC-HNCTCINGTLMCPHLECPVLGPWSAWSECSAVCGKGTMVR--HRSCEEHPDREPCQALDLQQWQECNLQACPE--CPPGQVLSTCATMCPSLCSHLWPGTICVREPCQLGCGCPGGQLLYNGTCIPPEACPCTQFSLPWGLTLPLEEQARELPSGTVLTRNCTHCTCQGGAFICSLTDCQECAPGEIWQHGKLGPCEKTC 4795          

HSP 7 Score: 66.2402 bits (160), Expect = 2.248e-9
Identity = 65/212 (30.66%), Postives = 79/212 (37.26%), Query Frame = 1
Query: 1891 LSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            L C N C + C DL    +C    C   C CP   L QDG CV  S CRC       G        E  P  +   DC+NCTC  G  +C    C     WS W   S C+  CGKG     R+  +        CQ  +           C E      L  S C   C  + + L P  +     C+ GC C PG     N TC+P   C
Sbjct: 4529 LDCANQCPRSCADLWDGVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRC-------GLPSANASWELAPTQVVQLDCHNCTCINGTLMCPHLECPVLGPWSAW---SECSAVCGKGTMVRHRSCEEHPDR--EPCQALDLQQWQECNLQACPECPPGQVL--STCATMCPSLCSHLWPGTICVREPCQLGCGC-PGGQLLYNGTCIPPEAC 4725          

HSP 8 Score: 60.4622 bits (145), Expect = 1.085e-7
Identity = 105/445 (23.60%), Postives = 154/445 (34.61%), Query Frame = 1
Query: 1186 VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSS-DDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDL-------------STRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTV--PCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACP-DNMLEQDGQ-CVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQ------GSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEE 2439
            VP   C      ++Y  GS +  ++ C+ C C       C     ++ +P   W+ W+ WS+CS +C    R R R C  P                 +T C GP  E EPC++  C        W+  + C+  C G      G+ ++ R    PS       CE  +     CQ   CPV         + C  +  A  + C P                                   C +SC     L+ CV  C+                  C CP   +L  DG  CV  S C C   D L G R       +    + P  CN+CTC +G+  CT   CQ    W  W   + C+  C    +   R  V     +GG+ C       G     E C  AT  C ++ A+S    +   +CD  + + + + VC  
Sbjct: 2973 VPVQDCPCAHRGRLYSPGSAV--HLPCENCSCISGLITNCSSWPCEEGQP--AWSSWTPWSVCSASCNPARRHRHRFCARPPHRAPFSLVLLTTVAAPTTLCPGPEAEEEPCLLPGCNQAGGWSPWSPWSGCSRSCGG------GLRSRTRACDQPSPQGLGDFCEGPQAQGEACQAQPCPV---------TNCSAMEGAEYSPCGPP----------------------------------CPRSC---DDLVHCVWRCQ----------------PGCYCPLGKVLSADGAICVKPSYCSCL--DLLTGKR-----HHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGDWCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATA-CPVDGAWSPWGPW--SSCDACLGQSYRSRVCSH 3335          

HSP 9 Score: 60.077 bits (144), Expect = 1.362e-7
Identity = 109/453 (24.06%), Postives = 156/453 (34.44%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFT----AQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICI--------DPC-EDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPGIMEESL----PDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT---QCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRN 2472
            C+D  T + + +G+ +     C  C C           CQ S D       W  WS W+ CS  C   TR+R R C+         PC E+     V  ++E  P    C VD     W   ++C+A  C G S    + +       P I+   K C                 +  Y+ S   + C  ++T C   CG G      Q+++                    C Q C    Q LS  + C+           +  C   C CP   L QDG CV   +C C +    +G     +R  G    S     P  +    C+NCTC  G   C     C     WS W     C+V+CG G Q   R  A+        C G      IC+        C     Y     +  C  +C  V  ++   +  C+EGC C  G  ++
Sbjct: 3203 CLDLLTGKRHHAGTQLMRPDGCNHCTCMEGRLNCTDLPCQVSGD-------WCPWSKWTACSQPCRGQTRTRSRACVCPAPQHGGSPCPEESGGTGVQHQMEACPNATACPVDGAWSPWGPWSSCDA--CLGQSYRSRVCSH------PPISDGGKPC-----------------LGGYQQS---RPCRNSSTLCT-DCGGG------QDLLP-------------------CGQPCPHSCQDLSLGSTCQP---------GSAGCQSGCGCPPGQLSQDGLCVFPVDCHCHFQPRAMGIPENRSRSVGSTLSSWESLEPGEVVTGPCDNCTCVAGILQCHEVPSCPGPGIWSSWGPWEKCSVSCGGGEQLRSRQCAR------PPCPGLAQQSRICHIHVCRETGCPAGRLYRECQPSDGCPFSCAHVTGQVACFSERCKEGCHCPEGTFQH 3579          
BLAST of Subcommissural organ spondin vs. UniProt/SwissProt
Match: sp|P98167|SSPO_BOVIN (SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=2)

HSP 1 Score: 106.686 bits (265), Expect = 1.102e-21
Identity = 172/673 (25.56%), Postives = 235/673 (34.92%), Query Frame = 1
Query:  397 LDCFE--DENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE----IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQIT---CHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNC--PNG---TRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVD--CKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC 2322
            LDC +  DEN   DC  + WS WS CS  C      + R +++ P  GG  C P+        +  CP      W+ W  W  CS +CGGG  ++ R+    P  +G             C    C   T    C   +V ++   C     P      LD   +   S  C+ GC C PG +    G   LS+  C   +   +P        C   VCE G  +C P      C W+ W  W PC+R CG                      G     +                   PS  P  S  A   C       + C  +     P   W  W+ WS CS +C  P G    RSR R+C  P +   T C+G   E EPC    C    V GQW   +AC+A C GG                  + T  + C  +         P D  C+    +T +C      N   C   C   MV ++ ++              +E    G C   C+A    + C                   C   CACP  +   +  C+  S+C C     L     PG +            C+NCTC  G+ +C +  C   C WS W   S C+ +C  GV++  R   A  A +GG  CQG N   E C
Sbjct: 2466 LDCQDGSDENGCVDCGLAPWSGWSSCSRSCGLGLAFQRRELLRPPLPGGS-CPPDRLRSQPCFVQACPVAGA--WAEWEAWGPCSVSCGGGHRSRRRSCMDPPPKNGGAPCPGPPQERAPCGLQPCAGGTD---CGQGRVHVSAELCRKGLVPPCPPSCLDPEANRSCSGLCLEGCRCPPGLLLQDAGCLPLSECPCLVGEELQQPGVPFLLDNCSRCVCEKGALLCEPGGCPVPCGWSAWSSWGPCDRSCG---------------------SGLRARFR------------------SPSNPPAASGGA--PCEGQRQELQACYSACGAEVP--GWTPWAPWSACSQSCLVPGGGPALRSRSRLCPGPGD---TSCIGEATEEEPCSPPVCLGLGVWGQWAAWSACSAPCNGG------------------VQTRGRRCSASA--------PGDPGCQGPHSQTRDC------NTQPCTAQCPGDMVFRSAEQ------------CRWE---GGPCPGLCLARGPGVECTG----------------VCTAGCACPTGLFLHNSSCLPPSQCPCQLRGQLYA---PGAVARL-------DSCSNCTCISGEMVCASEPCPVACGWSPWTPWSLCSRSCNVGVRRRFRAGTAPPAAFGGAACQGPNMEAEFC 3013          

HSP 2 Score: 87.0409 bits (214), Expect = 8.776e-16
Identity = 79/298 (26.51%), Postives = 123/298 (41.28%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYET-SECIKLCSANNTQCDPSC-------GHGMVTKTPQEI----VKAVNGGKNC-----EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA-QVAVYGGNDCQGSNTTDEICYAA 2331
            VDC +  W+  ++C+  C        G+  Q R+LL P +   +   +  R+ PC +  CPV      +E    C   C   +     SC       G       PQE     ++   GG +C      V+ E C  G      + P    SC++P      + ++ C+   C+E C CP  +L QD  C+  SEC C   + L   + PG+            +C+ C C +G  +C    C   C WS W    PC+ +CG G++   R+ +   A  GG  C+G     + CY+A
Sbjct: 2478 VDCGLAPWSGWSSCSRSC------GLGLAFQRRELLRPPLPGGSCPPDRLRSQPCFVQACPVAGAWAEWEAWGPCSVSCGGGHRSRRRSCMDPPPKNGGAPCPGPPQERAPCGLQPCAGGTDCGQGRVHVSAELCRKG------LVPPCPPSCLDP------EANRSCSGL-CLEGCRCPPGLLLQDAGCLPLSECPCLVGEEL---QQPGV-------PFLLDNCSRCVCEKGALLCEPGGCPVPCGWSAWSSWGPCDRSCGSGLRARFRSPSNPPAASGGAPCEGQRQELQACYSA 2746          

HSP 3 Score: 80.4925 bits (197), Expect = 9.012e-14
Identity = 115/440 (26.14%), Postives = 156/440 (35.45%), Query Frame = 1
Query: 1039 SWNQWQDWSPCNRVCG--PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICIDPCEDLSTR---------------CVGPRIETEPCIMT-------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAV-NGGKNCEVTYEPCYLGN---CSQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNIC--QQDCQWSDWKIVSPCNVTCGKGVQK 2244
             ++ W  W PC+R CG   +     +         GQ C G + D++ C                     P P         C   A    +P++        W  WS WS CSG C +      RSR R+C+  C   +                 C GP  E   C  T       C   C +GQ     A +    GG+               P + T  +E        C L  CPV      +          +  + CD SCG G   ++         NGG  C        L N   C + C A  +++SC N C +RC DL +      +  C + C CP+  LEQDG CV    C CT  D    +  PG   +        + CNNCTCR G+  CT   C     C WS W   SPC+ +CG   Q+
Sbjct: 3804 GFSPWGPWGPCSRSCGGLGTRTRSRQCVRPMPAPGGQGCHGPHWDLEYC---------------------PSPE--------CPGAAGSTAEPATGL---PGGWGLWSPWSPCSGTCTDPAHPAWRSRSRLCLANCTGGAASQERPCNLPSCTELPLCPGPGCEAGNCSWTAWAPWEPCSRSCGVGQQRRLRAYHPPGPGGH-------------WCPDVLTAYQERRF-----CNLRACPVPGGWSRW----------SPWSWCDRSCGGGRSLRSRSCSSPPPKNGGAPCVGERHHARLCNPTPCEEGCPAGMEVVSCANRCPRRCSDLQEGIVCQEDQACQQGCRCPEGSLEQDGGCVPLGHCECT--DAQGHSWAPGSQHQ--------EACNNCTCRAGQLSCTAQPCPPPAHCAWSRWSAWSPCSRSCGPAGQQ 4173          

HSP 4 Score: 74.3294 bits (181), Expect = 6.111e-12
Identity = 82/292 (28.08%), Postives = 112/292 (38.36%), Query Frame = 1
Query: 1672 PVDCKVLTYETSECIKLCSANN----TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNC-SQSCVAPKQLLS--CVNPCEQRCGDLSKK--CTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHP-----THVCEEGCRCQPGYVRNINNTCVPTSEC 2505
            P+  + L  +   C  LC        + C   C  G   +  +  +    G +      E C +G C  +SC A   + +  C N C + C DL  +  C    C   C CP   L QDG CV  S CRC       G   P       P  +   DC NCTC  G   C+++ C     WS W   S C+  CG G  K  R+  +    G   CQ  +   +       C E      L  S C  +C  + + L P        C+ GC C  G + + N TCVP +EC
Sbjct: 4594 PLSQQRLCPDPGACQDLCQWGPWGAWSPCQVPCSGGFRLRWREAGIPPGGGCRGPWAQTESCNMGPCPGESCEAQDTVPTPDCANQCPRSCVDLWDRVECLQGPCRPGCRCPPGQLVQDGHCVPVSSCRC-------GLPSPNASWALAPAEVVRLDCRNCTCVNGSLACSSHECPTLGPWSAW---SNCSAPCGGGTTKRHRSCKEGP--GVTPCQAQDMEQQQDCNLQPCPECPPGQVL--SACAVSCPRLCSHLQPGTPCMQEPCQLGCDCPRGQLLH-NGTCVPPAEC 4870          

HSP 5 Score: 63.929 bits (154), Expect = 1.155e-8
Identity = 136/568 (23.94%), Postives = 189/568 (33.27%), Query Frame = 1
Query:   82 LVVCTEWSDWSLCNASCGYGSSVRSRNCSTTENEHDSCY--------------SSDCHCDVLFSDVK-----------FKIHRD---------IIDAWVELDDIIGFSSLMELIE-----DGQTVASNITVFFN-CAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVII-----------KQPNYGGKFC--EPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSD--CVTGCFCNPGYVEDMLGN-CVLSDTCCDKSQVNCKPCETG--VCENGQAVCIPNDNCDC------------------SWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC-IDPCEDLSTRCVGPRIETEPC-IMTCKV-DCVMGQWTNETACNAQC 1548
            L V  +W+ WS C+A C  G   R R CS +      C               ++ C  D++F   +             + R                     +  SS +   +      GQ  A       + C+ C C SG + C   E C   C WS W+ WS CS  C+   + R R              + PN   +FC   P G             EW PWS    CS  CGGG  N+TR         SS  S V  +          +  +C   K  + C     P +C +     +S    +D  C  GC+C  G +  +L N CV +  C         PC  G  +   G AV  P +NC C                  +W+ W  WS C+  CGP+ + + R                    +P    P  M      S + P             C      ++ C     D      W  W  WS CS +C  G RSR R C   P + L   C GPR +   C  + C V +C   +    +AC   C
Sbjct: 2809 LGVWGQWAAWSACSAPCNGGVQTRGRRCSASAPGDPGCQGPHSQTRDCNTQPCTAQCPGDMVFRSAEQCRWEGGPCPGLCLARGPGVECTGVCTAGCACPTGLFLHNSSCLPPSQCPCQLRGQLYAPGAVARLDSCSNCTCISGEMVC-ASEPCPVACGWSPWTPWSLCSRSCNVGVRRRFRAGTAPPAAFGGAACQGPNMEAEFCSLRPCGGPAG---------EWGPWS---PCSVPCGGGYRNRTRG--------SSGPSPVDFSTCGLQPCAGPAPGVCPPGKRWLDCAQG--PASCAE-----LSAPRGADQPCHPGCYCPSGML--LLNNACVPTQDC---------PCTHGGRLHPPGSAVLRPCENCSCVSGLITNCTSWPCKEGQPTWSPWTPWSECSASCGPARRHKHRFC-----------------TRPPGGAPSSMAPPLLLSSVPPL------------CPGPEAEEEPCLLPECDRA--GGWGPWGPWSSCSRSCGGGLRSRSRACDQPPPQGLGDYCEGPRAQGAACQALPCPVTNCTAIEGAEYSACGPPC 3306          

HSP 6 Score: 63.5438 bits (153), Expect = 1.500e-8
Identity = 68/231 (29.44%), Postives = 93/231 (40.26%), Query Frame = 1
Query:  466 CSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTR-----TPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNC--------KPCETGVCENGQAVCIPND---NCDCSWNQWQDWSPCNRVCGPS 1092
            CS  C    + R R     P  GG +C       +E   C N   C     WS WS W+ C ++CGGG + ++R      P N G     +     + CN   C        C      ++C N  CPR C D+ +G I C+E   C  GC C  G +E   G   L    C  +Q +         + C    C  GQ  C          C+W++W  WSPC+R CGP+
Sbjct: 3950 CSRSCGVGQQRRLRAY-HPPGPGGHWCPDVLTAYQERRFC-NLRACPVPGGWSRWSPWSWCDRSCGGGRSLRSRSCSSPPPKNGGAPCVGERHHARL-CNPTPCEEG-----CPAGMEVVSCAN-RCPRRCSDLQEG-IVCQEDQACQQGCRCPEGSLEQDGGCVPLGHCECTDAQGHSWAPGSQHQEACNNCTCRAGQLSCTAQPCPPPAHCAWSRWSAWSPCSRSCGPA 4170          

HSP 7 Score: 59.6918 bits (143), Expect = 1.993e-7
Identity = 105/449 (23.39%), Postives = 147/449 (32.74%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKP-DANWNEWSAWSICSGNCPNGTRSRDRICI--------DPCEDLSTRCVGPRIETEPCIMT--CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSK----KCTNTDCIES-CACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPG----IMEESLPDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPG 2460
            C+D  T + +  G+ +     C  C C+   Q  C   +D   P    W  WS W+ CS  C   TR+R R C          PC   +    G + + E C  T  C VD     W   + C         V  G   + R+   P  +   + C                           + C  N+TQC                                         C   + LL C  PC + C DLS     +  +  C +  C CP   L QDG CV+ S+CRC +    +G     +R  G      E   P  +    C+NCTC  G   C     C     W  W     C+V+CG G ++L           G   Q      ++C  A   C     Y     +  C  +C  V  ++   +  CEEGC C  G
Sbjct: 3347 CLDLLTGERHRPGAQLAKPDGCNYCTCS-EGQLTC---TDLPCPVPGAWCPWSEWTACSQPCQGQTRTRSRACSCPAPQHGGAPCPGEAGE-AGAQHQRETCASTPECPVDGAWSPWGPWSPCE--------VCLGRSHRSRECSWPPTSEGGRPCPGGHRQ--------------------SRPCQGNSTQCT---------------------------------------DCAGGQDLLPCGQPCPRSCEDLSPGVECQPDSMGCQQPRCGCPPGQLSQDGLCVTPSQCRCQYQPGAMGIPENQSRSAGSGLSSWESLEPGEVVTGPCDNCTCVAGILQCQEVPACSGLGLWGSWGPWEDCSVSCGGG-EQLRFRRCPRPPCPGPARQSRTCRTQVCREAG--CPAGRLYRECQPSEGCPFSCAHVTGQVGCFSAGCEEGCHCPEG 3720          

HSP 8 Score: 56.9954 bits (136), Expect = 1.272e-6
Identity = 53/151 (35.10%), Postives = 72/151 (47.68%), Query Frame = 1
Query:  355 VFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNY-GGKFCEPNGNEEIDDCPNTCICE---WSPWSHWTECSQNC---GGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKV 786
            +  NC++C+C  G+L C E   C   C WS WS W  C   C +  + R R     P   GG  CE    +E+  C + C  E   W+PW+ W+ CSQ+C   GGG   ++R+ L   C    DTS +  A  E  C    S P+C G  V
Sbjct: 2670 LLDNCSRCVCEKGALLC-EPGGCPVPCGWSAWSSWGPCDRSCGSGLRARFRSPSNPPAASGGAPCE-GQRQELQACYSACGAEVPGWTPWAPWSACSQSCLVPGGGPALRSRSRL---CPGPGDTSCIGEATEEEPC----SPPVCLGLGV 2811          

HSP 9 Score: 56.225 bits (134), Expect = 2.453e-6
Identity = 139/603 (23.05%), Postives = 200/603 (33.17%), Query Frame = 1
Query:  595 CEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC----------------CDKSQVNCKPCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVP---CIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDR--------ICIDPCEDLSTRCVGP----------RIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLL--------IPSINTNAKECETNRTVPCQLDCPVDC----KVLTYETSECIKLCSANN-TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT----YEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCT-----WNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSP 2211
            C WS WS WT CS  C      + R    +     +      +  +   C T   +        +       C   C   L   + C++   C  GC+C  G +E   G CV  + C                 D+ Q+ CK CE   C+ G+  C  +  C      + W +WSPC   C P       +    +    Q   G +    P          +C+D ET + + +G P         C    + Q+ C P     +    W  W AWS C   C  G R R R         C  P     +  +GP           + T  C   C   CV   W         C  G     G + Q    +        +PS N +            +LDC  +C      L   + EC  L   +  + C   CG G   +      K   G   C+       + C L  C +    P Q+LS C   C + C  L     C    C   C CP   L  +G CV  +EC CT     W   L          E  P T+  ++C +C C+ G + C+   CQ+      W+ V+P
Sbjct: 4361 CVWSSWSSWTRCS--CEVLVQQRYRHQRPAPGGAGAGPPCTRLDGHFRPCLTGNCSEDSCAPPFEFQACGSPCTGLCATYLSPWL-CQDLPPCQPGCYCPEGLLEQA-GGCVPPEQCNCQHVSGEGAGVTLAPGDRLQLGCKECE---CQRGELQCT-SQGCQGLLPLSGWSEWSPCG-PCLPLGLLAPASRAALEERWPQDTAGLSPTSAPTLASEQHRHRLCLDPETGRPW-AGDP-------DLCTVPLSQQRLC-PDPGACQDLCQWGPWGAWSPCQVPCSGGFRLRWREAGIPPGGGCRGPWAQTESCNMGPCPGESCEAQDTVPTPDCANQCPRSCV-DLWDRVECLQGPCRPGCRCPPGQLVQDGHCVPVSSCRCGLPSPNASWALAPAEVV---RLDC-RNCTCVNGSLACSSHECPTLGPWSAWSNCSAPCGGGTTKR--HRSCKEGPGVTPCQAQDMEQQQDCNLQPCPE--CPPGQVLSACAVSCPRLCSHLQPGTPCMQEPCQLGCDCPRGQLLHNGTCVPPAECPCTQLSLPWGLTLTLEE---QHRELPPGTLLTQNCTHCICQGGAFSCSLTDCQECPPGETWQQVAP 4933          

HSP 10 Score: 55.8398 bits (133), Expect = 3.003e-6
Identity = 56/184 (30.43%), Postives = 77/184 (41.85%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKT--RTPLNSG-----CDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCV-TGCFCNPGYVEDMLGNCVLSDTC-----------CDKSQVNCKPCETGVCENGQAV-CIPNDNC--DCSWNQWQDWSPCNRVCG 1086
            W+ WS W+ CS+ CGG T        P N G           ++  T  C +  C   T    CSG  V   C  V CP TCDD+  G  +C     C   GC+C  G V    G CV    C             + + +C+ C   VC++G+   C P+ +C  +C W+ W  W+ C   CG
Sbjct: 1750 WTSWSRWSPCSEPCGGVTARHRECHPPQNGGRTCATLPGGPPSTRETRPCPQDGCPNVT----CSGELVFHAC--VPCPLTCDDI-SGQATCPPDRPCGGPGCWCPAGQVLGAQGRCVWPRQCPCLVDGSRYWPGQRVKTDCQLC---VCQDGRPRRCQPSLDCAVNCGWSAWSPWAECLGPCG 1923          
BLAST of Subcommissural organ spondin vs. UniProt/SwissProt
Match: sp|A2VEC9|SSPO_HUMAN (SCO-spondin OS=Homo sapiens OX=9606 GN=SSPO PE=2 SV=2)

HSP 1 Score: 105.916 bits (263), Expect = 1.815e-21
Identity = 161/620 (25.97%), Postives = 232/620 (37.42%), Query Frame = 1
Query:  466 CSGGCDNASKNRSRVIIKQPNYGGKFCEPN---GNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTT-----NKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC-CDKSQVNC--------KPCETGVCENGQAVCIPND---NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPC-EDLSTRCVGPRIET--EPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETN--RTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC---EVTYEPCYLGNCSQ-SCVAPKQLLSCVNPCEQRCG-DLSKKCTN--TDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCN 2217
            CS  C    + R R   + P  GG +C PN     +E   C N   C     WS WS W+ C ++CGGG +       +    N G   + +     + CN   C        C      +TC N  CPR C D+ +G I C++   C  GC C  G +E   G CV    C C  +Q +           C    C+ GQ  C          C+W+ W  WSPC+  CGP  Q     ++T      +     +            +C+    S+             CQ C C  T +      ++   P+A W  WS+WS C  +C  G + R R C        S  C+GP  +T  +PC    +  C  G W     C+  C  G +   G    +     P+ N+     +T    + PC  +C V     ++    C  L         P+              +    G  C   +  + PC + NCS+ SC  P +  +C +PC   C   LS +       C   C CP  +LEQ G C+   EC C W+ +  G    G+     P       C  C CR+G+  CT+  CQ     S+W   SPC 
Sbjct: 3960 CSRSCGVGQQRRLRAY-RPPGPGGHWC-PNILTAYQERRFC-NLRACPVPGGWSRWSPWSWCDRSCGGGQSLRSRSCSSPPSKNGGAPCAGERHQARL-CNPMPCEAG-----CPAGMEVVTCAN-RCPRRCSDLQEG-IVCQDDQVCQKGCRCPKGSLEQD-GGCVPIGHCDCTDAQGHSWAPGSQHQDACNNCSCQAGQLSCTAQPCPPPTHCAWSHWSAWSPCSHSCGPRGQQSRFRSSTSGSWAPECREEQSQSQPCPQPSCPPLCLQGTRSRTLGDSW---LQGECQRCSC--TPEGVICEDTECAVPEA-WTLWSSWSDCPVSCGGGNQVRTRACRAAAPHHRSPPCLGPDTQTRQQPCPGLLEA-CSWGPWG---PCSRSCGPGLASRSGSCPCLMAKADPTCNSTFLHLDTQGCYSGPCPEEC-VWSSWSSWTRCSCRVLVQQRYRHQGPA-------------SRGARAGAPCTRLDGHFRPCLISNCSEDSCTPPFEFHACGSPCAGLCATHLSHQLCQDLPPCQPGCYCPKGLLEQAGGCIPPEECNC-WHTSAAGA---GMTLA--PGDRLQLGCKECECRRGELHCTSQGCQGLLPLSEWSEWSPCG 4537          

HSP 2 Score: 96.2857 bits (238), Expect = 1.473e-18
Identity = 156/628 (24.84%), Postives = 217/628 (34.55%), Query Frame = 1
Query:  562 EEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIV--TVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLG-----NCVLSDTC--------------------CDKSQVNCKPCETGVCENGQAVCIPND--NCDCSWNQWQDWSPCNRVCG--PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYP-SGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGT----RSRDRICIDPCEDLSTRCVGPRIETEPCIMTC-------------KVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSIN----TNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGM-VTKTPQEIVKAVNGGKNCEVTYEPCYLGN---CSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTD---CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQ--DCQWSDWKIVSPCNVTCG-KGVQKLERT 2256
            +E+ DCP+  +  WS W  W +CS +CGGG   ++R      C   +  S    T  C E  C         +G   +       CP +C  V    + C  S  C  GC C  G  +  L       CVL+                        D  Q     C    C +G+  C  +D    D  +  W  W PC+R CG   +     +   T    +GQ C G   D++ C   P   C   E S + P +G P                                W  WS+WS CS +C +      RSR R+C+  C       +G  ++  PC +                 +C    W     C+  C        G   ++R    P        N       R       CPV      +          +  + CD SCG G  +         + NGG  C        L N   C   C A  ++++C N C +RC DL +     D   C + C CP   LEQDG CV    C CT  D    +  PG   +          CNNC+C+ G+  CT   C     C WS W   SPC+ +CG +G Q   R+
Sbjct: 3638 QEVPDCPDPGV--WSSWGPWEDCSVSCGGGEQLRSRRCARPPCPGPARQSRTCSTQVCREAGCP--------AGRLYRECQPGEGCPFSCAHVTQ-QVGC-FSEGCEEGCHCPEGTFQHRLACVQECPCVLTAWLLQELGATIGDPGQPLGPGDELDSGQTLRTSCGNCSCAHGKLSCSLDDCFEADGGFGPWSPWGPCSRSCGGLGTRTRSRQCVLTMPTLSGQGCRGPRQDLEYC---PSPDCPGAEGSTVEPVTGLP------------------------------GGWGPWSSWSPCSRSCTDPARPAWRSRTRLCLANCT------MGDPLQERPCNLPSCTELPVCPGPGCGAGNCSWTSWAPWEPCSRSC------GVGQQRRLRAYRPPGPGGHWCPNILTAYQERRFCNLRACPVPGGWSRW----------SPWSWCDRSCGGGQSLRSRSCSSPPSKNGGAPCAGERHQARLCNPMPCEAGCPAGMEVVTCANRCPRRCSDLQEGIVCQDDQVCQKGCRCPKGSLEQDGGCVPIGHCDCT--DAQGHSWAPGSQHQDA--------CNNCSCQAGQLSCTAQPCPPPTHCAWSHWSAWSPCSHSCGPRGQQSRFRS 4188          

HSP 3 Score: 82.4185 bits (202), Expect = 2.260e-14
Identity = 77/293 (26.28%), Postives = 123/293 (41.98%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEI-VKAVNGGKNCEVTYE---PCYLGNCSQS--CVAPKQLLSC-------VNPCEQRCGD-LSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA-QVAVYGGNDCQGSNTTDEICY 2325
            VDCV+  W+  ++C+  C        G+  Q ++LL P +   +   +  R+  C +  CPV      +E              C  SCG G  ++    +     NGG  C    +   PC L  CS    C   +  +S        V PC   C D  + +  +  C+E C CP  +L  D +C+  SEC C   + L   + PG+       +    +C+ C C +G+ +C    C   C WS W   +PC+ +CG GV+   R+ +   A +GG  C+G     + C+
Sbjct: 2500 VDCVLAPWSVWSSCSRSC------GLGLTFQRQELLRPPLPGGSCPRDRFRSQSCFVQACPVAGAWAMWEAW----------GPCSVSCGGGHQSRQRSCVDPPPKNGGAPCPGASQERAPCGLQPCSGGTDCELGRVYVSADLCQKGLVPPCPPSCLDPKANRSCSGHCVEGCRCPPGLLLHDTRCLPLSECPCLVGEEL---KWPGV-------SFLLGNCSQCVCEKGELLCQPGGCPLPCGWSAWSSWAPCDRSCGSGVRARFRSPSNPPAAWGGAPCEGDRQELQGCH 2766          

HSP 4 Score: 80.1073 bits (196), Expect = 1.363e-13
Identity = 86/343 (25.07%), Postives = 128/343 (37.32%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLS-TRCVGPRIETEPCIMTCKVDCVMG--QWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTY---EPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTD--------CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC 2322
             W+ WS+W+ C  +C +G R+R R   +P        C G R E + C   C  + V G   WT+ ++C+  C    +   G   + R  L PS   ++  C  + T         +           I    A  + C   C  G+ T+  +       G   C   +     C    C+  C     L      C Q  G   + C            C   C CP  +   +  C+ +S+C C  +  L  +   G M            CNNCTC  GK  CT+  C   C WS W + S C+ +C  G+++  R   A  A +GG +CQG     E C
Sbjct: 2718 GWSAWSSWAPCDRSCGSGVRARFRSPSNPPAAWGGAPCEGDRQELQGCHTVCGTE-VFGWTPWTSWSSCSQSCL---APGGGPGWRSRSRLCPSPGDSS--CPGDATQ-------EEPCSPPVCPVPSIWGLWAPWSTCSAPCDGGIQTRG-RSCSSLAPGDTTCPGPHSQTRDCNTQPCTAQCPE-NMLFRSAEQCHQEGGPCPRLCLTQGPGIECTGFCAPGCTCPPGLFLHNASCLPRSQCPCQLHGQLYAS---GAMARL-------DSCNNCTCVSGKMACTSERCPVACGWSPWTLWSLCSCSCNVGIRRRFRAGTAPPAAFGGAECQGPTMEAEFC 3035          

HSP 5 Score: 75.8702 bits (185), Expect = 2.397e-12
Identity = 111/451 (24.61%), Postives = 149/451 (33.04%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKP-DANWNEWSAWSICSGNCPNGTRSRDRICIDPC-EDLSTRCVGPRIETE--------PCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT----NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLG-----TRPPGIMEESL----PDTIFPKDCNNCTCRQGKWICT-TNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYS--LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRN 2472
            C+D  T Q +  G+ +     C  C C    +  C   +D   P    W  WS W++CS  C   TRSR R C  P  +     C G   E          P   TC VD   G W   + C+        +  G   + R    P      + C  N T                      + C  N+TQC   CG G                                      + L  C  PC + C DLS        +  C  +C CP   L QDG CV  + CRC +    +G     +R  G    S     P  +    C+NCTC  G   C     C     WS W     C+V+CG G Q   R  A+    G    Q    + ++C  A   C     Y        C  +C  V  ++   +  CEEGC C  G  ++
Sbjct: 3368 CLDLLTGQRHHPGARLARPDGCNHCTC-LEGRLNC---TDLPCPVPGGWCPWSEWTMCSQPCRGQTRSRSRACACPTPQHGGAPCTGEAGEAGAQHQREACPSYATCPVDGAWGPWGPWSPCD--------MCLGQSHRSRACSRPPTPEGGRPCPGNHTQ--------------------SRPCQENSTQCT-DCGGG--------------------------------------QSLHPCGQPCPRSCQDLSPGSVCQPGSVGCQPTCGCPLGQLSQDGLCVPPAHCRCQYQPGAMGIPENQSRSAGSRFSSWESLEPGEVVTGPCDNCTCVAGILQCQEVPDCPDPGVWSSWGPWEDCSVSCGGGEQLRSRRCARPPCPGPAR-QSRTCSTQVCREAG--CPAGRLYRECQPGEGCPFSCAHVTQQVGCFSEGCEEGCHCPEGTFQH 3744          

HSP 6 Score: 69.707 bits (169), Expect = 1.905e-10
Identity = 77/249 (30.92%), Postives = 91/249 (36.55%), Query Frame = 1
Query: 1786 QEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQL--LSCVNPCEQRCGDLSKK--CTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHV-----CEEGCRCQPGYVRNINNTCVPTSEC 2505
            +E      GG       E C  G C +SC A   +  L C N C   C DL  +  C    C   C CP   L QDG+CV  S CRC       G        E  P      DC NCTC     +C    C     WS W   S C+  CG G  +  RT       G   CQ  +T          C E      L  S C  +C  +   L P  +     C+ GC C PG     N TCVP + C
Sbjct: 4642 REAEALCGGGCREPWAQESCNGGPCPESCEAQDTVFTLDCANQCPHSCADLWDRVQCLQGPCRPGCRCPPGQLVQDGRCVPISSCRC-------GLPSANASWELAPAQAVQLDCQNCTCVNESLVCPHQECPVLGPWSAW---SSCSAPCGGGTMERHRTCE--GGPGVAPCQAQDTEQRQECNLQPCPECPPGQVL--SACATSCPCLCWHLQPGAICVQEPCQPGCGC-PGGQLLHNGTCVPPTAC 4875          

HSP 7 Score: 59.6918 bits (143), Expect = 1.756e-7
Identity = 159/734 (21.66%), Postives = 240/734 (32.70%), Query Frame = 1
Query:  577 CPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIV---TVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC----------------CDKSQVNCKPCETGVCENGQAVCIPNDNCD--CSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCI--------MCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSR----DRICIDPCED--LSTRCVGPRIETEPCIMTCK-------VDCV-------MGQWTNETACNAQCCGGNSVAYGIITQVRDLL--------IPSINTNAKECETNRTVPCQLDCPVDC----KVLTYETSECIKLCSANN-TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVT----YEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDLSKK--CTNTDCIESCACPDNMLEQDGQCVSKSECRCT-----WNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECY-----RCEVNGTIWQN 2541
            CP  C+  WS WS WT CS         + + P + G    +  + +      C   +C+ ++ TP       +       C   C   L   + C++   C  GC+C  G +E   G C+  + C                 D+ Q+ CK CE   C  G+  C  +  C      ++W +WSPC     PS       T  +     +  +   T + P  + P +        +C+D  T + + +G+P         C    + Q+ C P          W+ W  WS C   C  G R R    + +C   C +      C G      PC  +C+       +DC           W         C  G     G + Q    +        +PS N + +          QLDC  +C    + L     EC  L   +  + C   CG G + +      +   G   C+       + C L  C +    P Q+LS C   C   C  L     C    C   C CP   L  +G CV  + C CT     W   L         +E  P T+  ++C  C C  G + C+   CQ       W+ V+P                                  E+      C E+N   +  N    +                 GC CQPG+ R+    CVP   C      R  + G+ WQ 
Sbjct: 4364 CPEECV--WSSWSSWTRCSCRVLVQQRYRHQGPASRGARAGAPCTRLDGHFRPCLISNCSEDSCTP-----PFEFHACGSPCAGLCATHLSHQL-CQDLPPCQPGCYCPKGLLEQA-GGCIPPEECNCWHTSAAGAGMTLAPGDRLQLGCKECE---CRRGELHCT-SQGCQGLLPLSEWSEWSPCGPCLPPSALAPASRTALE-----EHWLRDPTGLSP-TLAPLLASEQHRHRLCLDPATGRPW-TGAP-------HLCTAPLSQQRLC-PDPGACPDSCQWSLWGPWSPCQVPCSGGFRLRWREAEALCGGGCREPWAQESCNG-----GPCPESCEAQDTVFTLDCANQCPHSCADLWDRVQCLQGPCRPGCRCPPGQLVQDGRCVPISSCRCGLPSANASWELAPAQAV---QLDC-QNCTCVNESLVCPHQECPVLGPWSAWSSCSAPCGGGTMER--HRTCEGGPGVAPCQAQDTEQRQECNLQPCPE--CPPGQVLSACATSCPCLCWHLQPGAICVQEPCQPGCGCPGGQLLHNGTCVPPTACPCTQHSLPWGLTLTLEE---QAQELPPGTVLTRNCTRCVCHGGAFSCSLVDCQVP-PGETWQQVAP---------------------------------GELGLCEQTCLEMNATKTQSNCSSARA---------------SGCVCQPGHFRSQAGPCVPEDHCECWHLGRPHLPGSEWQE 5004          
BLAST of Subcommissural organ spondin vs. TrEMBL
Match: A0A1C9ZVF9 (Uncharacterized protein (Fragment) OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 1263.83 bits (3269), Expect = 0.000e+0
Identity = 617/881 (70.03%), Postives = 737/881 (83.65%), Query Frame = 1
Query:   73 STELVVCTEWSDWSLCNASCGYGSSVRSRNCSTTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNGAKFIVDDIHCLHS 2715
            +T  + C+ WSDWS+CN SCG G + R RNCS  ++E   C+  +C C V+FSDV  KI R+++DAW+E+DD  G S+ +E++EDGQ +++N++V FNCA C C +G L+C  D+ CKKDC+WS+WSEWS+C G CDN+ K R+R +IKQPNYGGKFCE NG EEI+ CPN+CICEWSPWS WT C++ CGGGTTNKTR  LNSGCD + D+++V+V+CN F C+TETST  CS NK+ + CHNVTCPRTC+DV + GI CEES DC TGCFC PGYVED+LGNC+ S++CCD S  NCK CETGVCENGQAVC+PNDNCDCSWNQWQ+W+ CN++CG S QTR R  NT+QRG G+SCVG++ DIKPC  VPC+ C DDET +IYPSGSPMPSN ACQECFCNFT  KEC+ SSDDNKP A WN+WSAWSICSGNCPNGTRSRDRICIDPC D STRC GPR+ETEPC M C+V+C+MG W NET CNAQCC G  VAYG+ITQVRDLL+PSIN N +ECETNR++PCQ++CPVDCKVLTY TSECIK CSAN++QCDPSCG+GMVTK PQE++K+VNGGK+C V YEPC+LGNCS  CVAPK+LLSCVNPCE +C DLSKKC+N DCIESCACPDNMLEQDG+CV K+ECRCTWN+NLLG++P    +ESLPDTIF KDCNNC+CRQGKWICT N C QDCQWSDWKI +PCNVTCG+G+Q LERTV++VA YGG DCQG N T E+CYAAT+CCE NVAYSLKNS+CEQTCDDVIN+ HPTH+C+EGC+CQ GYVR+ NNTCVPTSEC+RC+VNG  WQNGQTKKD N+C+L++C  G++    L + NGLPACSLEDEALV+NGAK I++D  C +S
Sbjct:  161 TTSGLSCSSWSDWSVCNVSCGDGFTFRFRNCSFIQSEQKPCFPMNCFCSVVFSDVAVKIRREVVDAWIEIDDFPGLSNPLEVVEDGQLISANVSVLFNCAYCTCINGELNCQSDDICKKDCQWSQWSEWSDCLGNCDNSVKKRNRFVIKQPNYGGKFCESNGYEEIESCPNSCICEWSPWSLWTPCTEKCGGGTTNKTRISLNSGCDYTQDSTVVSVSCNNFPCSTETSTSQCSDNKIFVICHNVTCPRTCNDVQNNGIGCEESQDCDTGCFCPPGYVEDILGNCIKSESCCDISNANCKECETGVCENGQAVCVPNDNCDCSWNQWQEWTSCNKLCGESQQTRIRIKNTEQRGKGRSCVGTDKDIKPCTFVPCVTCTDDETREIYPSGSPMPSNFACQECFCNFTGVKECKESSDDNKPIAKWNDWSAWSICSGNCPNGTRSRDRICIDPCNDFSTRCQGPRLETEPCEMKCQVNCLMGPWRNETTCNAQCCSGMPVAYGVITQVRDLLVPSININ-EECETNRSIPCQMNCPVDCKVLTYATSECIKKCSANDSQCDPSCGNGMVTKIPQEVIKSVNGGKDCSVIYEPCFLGNCSAPCVAPKKLLSCVNPCETQCSDLSKKCSNIDCIESCACPDNMLEQDGKCVQKTECRCTWNENLLGSKPASYNDESLPDTIFTKDCNNCSCRQGKWICTKNTCTQDCQWSDWKIATPCNVTCGQGIQILERTVSEVAKYGGKDCQGINRTQEMCYAATKCCENNVAYSLKNSFCEQTCDDVINKQHPTHICDEGCKCQSGYVRDFNNTCVPTSECFRCDVNGVTWQNGQTKKDVNACRLFICIRGQIVSKQLDITNGLPACSLEDEALVNNGAKTIINDYRCCYS 1040          

HSP 2 Score: 162.155 bits (409), Expect = 1.458e-36
Identity = 73/132 (55.30%), Postives = 101/132 (76.52%), Query Frame = 2
Query: 2708 YIAAITRCKVNTVQVNQITLKNGQICKLTGGQLIEKTICAGGCSTSTSLRGLDEIDNAVMKFNKYSAMLANDPTALPPGFIQNSACKCCSPIQYTVNVPYEYTCINQSTNRQVNGIMVDIRITKCACINTCS 3103
            Y AAI RCKV T++VN+ITL NG  CKLT G+LI+K++C+GGC+  TS+R L++I N +  F++YS +L N+P+ LP G++ +SAC CCSP QY +N PY+YTCIN +  + V G M+D+RITKCAC N+C 
Sbjct: 1039 YSAAIPRCKVKTIKVNEITLANGDPCKLTDGKLIQKSVCSGGCNARTSIRALEQITNPLTIFSEYSKLLTNNPSELPIGYMHDSACNCCSPDQYAINPPYKYTCINLNNGKTVTGYMMDLRITKCACKNSCE 1170          
BLAST of Subcommissural organ spondin vs. TrEMBL
Match: A0A1I8GBI1 (CTCK domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 449.129 bits (1154), Expect = 2.917e-137
Identity = 305/863 (35.34%), Postives = 438/863 (50.75%), Query Frame = 1
Query:  205 DCHCDVLFSDVKFKIHRD---IIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDC-PNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGN-CVLSDTC-CDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCN-FTAQKECQPSSDDNK--PDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCV-GPRIETEPCIMTCK-------VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYET-SECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC-EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYA-ATQCCEINVAYSLKNSYCEQTCDDVIN--RLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNG---AKFIVDDIHCLH 2712
            DC C V  S+V  ++        D WVELD   G SS +E I +G  + S + +  +C +C C++G+L C +  NC  DC+W +W  W  CS  C    + R+R +     +GG+ C+P   +E + C    C C WS WS W++CSQ C GG   +TRTP   G  L  D +  T  CN   C + T++P CS  KV   C   +CP TC  V +   +C +   C TGCFC  G+V D     CV  D C CD + ++C  C  G C NG A C+P  NCDC+W  W DW PC++ C   ++TRTR   T +RG G++CVG  ++ +PCN   C  C+D   +++ P G  MPS   C+ C+C+ FT + EC P   D+   P   W++WS +S CS  C  GT+ R R C+  C + +  C    R   +    +C        VDC +  WTN T C A C G N  A G   ++R +   + N       T   VPC   C VDC V  +   SE +K C    T C+PSCG G   +T   +  A NGG+ C +  +EP  +      C  P+ L+SC   C + C D+  +K+C +  C++ C C  + + +   CV+ +EC C   +N     PPG        ++  K CN CTC  G+++C    C QDC WS W+ V  CNVTCG G Q   R++A  A  GG +C G  +    C+     CC  N AY +    CE TC  ++N     P   C+ GC+C+PG  RN N +CV   +C+ C+VNG +W +G+   D  +C   LC  G+++  PL +   +P C+L DE         A+ ++D   C +
Sbjct:   15 DCECMVAMSEVSKELQLSESYPRDVWVELDGTSGLSSPLEKINEGDMLESGVVIRIDCGQCSCSNGALRCSKT-NCSNDCQWGQWKPWGSCSSTCGTGVRYRNRTVASPARFGGEPCQPKDFQEFELCNTQRCPCVWSQWSAWSDCSQTCNGGVKTRTRTP--QGDCLLEDATTETALCNVHPCGSTTTSPSCSEGKVMRQCSTTSCPYTCGHVTN--ETCSDQLACSTGCFCEQGFVFDEKARACVKPDQCTCDLTTLSCGLCSQGRCVNGVATCVPTTNCDCTWGPWSDWEPCSKACDGGSRTRTRAQATSRRGTGRACVGLASESEPCNTGRCPGCLDRFGNRV-PPGETMPSENPCEICYCSYFTGRPECMPKRPDDASNPAPQWSDWSEFSACSAPCGTGTKRRSRACVRLCVNDTRSCAPDARGRMDADQQSCNRQDCAPPVDCQVSDWTNGT-CYANCDGVNPTATGQQLRLRQITRQAANGGKACPSTYEVVPCSKQCKVDCLVGQWSAWSERVKNCVG--TGCNPSCGVGERERTRPVLRPAANGGQACRDHEFEPVLMPCNETVCSGPETLISCATKCWRTCSDVRANKQCQDVGCMQGCGCAGDKVREADTCVAVAECSCEHPENASRLMPPG--------SVVNKACNKCTCVSGQFVCEEKSCAQDCVWSAWQKVGGCNVTCGSGKQTWTRSIATPAANGGAECVGPTSRVTDCFGDEGACCNPNDAY-VDTGRCETTCAQLLNPELAQPHSNCQPGCQCKPGMARNANGSCVSIQDCFACQVNGVVWPSGRVDVDRANCSKRLCLHGQLSTQPLELSE-VPPCTLSDEVQAGTAGSEAQRVMDKSGCCY 858          
BLAST of Subcommissural organ spondin vs. TrEMBL
Match: A0A1I8GQX8 (CTCK domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 447.588 bits (1150), Expect = 8.291e-137
Identity = 305/863 (35.34%), Postives = 437/863 (50.64%), Query Frame = 1
Query:  205 DCHCDVLFSDVKFKIHRD---IIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDC-PNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGN-CVLSDTC-CDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCN-FTAQKECQPSSDDNK--PDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCV-GPRIETEPCIMTCK-------VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYET-SECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC-EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYA-ATQCCEINVAYSLKNSYCEQTCDDVIN--RLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNG---AKFIVDDIHCLH 2712
            DC C V  S+V  ++        D WVELD   G SS +E I +G  + S + +  +C +C C++G+L C +  NC  DC+W +W  W  CS  C    + R+R +     +GG+ C+P   +E + C    C C WS WS W++CSQ C GG   +TRTP   G  L  D +  T  CN   C + T++P CS  KV   C   +CP TC  V +   +C +   C TGCFC  G+V D     CV  D C CD + ++C  C  G C NG A C+P  NCDC+W  W DW PC++ C   ++TRTR   T +RG G++CVG  ++ +PCN   C  C+D   +++ P G  MPS   C+ C+C+ FT + EC P   D+   P   W++WS +S CS  C  GT+ R R C+  C + +  C    R   +    +C        VDC +  WTN T C A C G N  A G   ++R +   + N       T   VPC   C VDC V  +   SE +K C    T C+PSCG G   +T   +  A NGG+ C +  +EP  +      C  P+ L+SC   C + C D+  +K+C +  C++ C C  + + +   CV+ +EC C   +N     PPG        ++  K CN CTC  G+++C    C QDC WS W+ V  CNVTCG G Q   R++A  A  GG +C G  +    C+     CC  N AY +    CE TC  ++N     P   C+ GC+C+PG  RN N +CV   +C+ C+VNG  W +G+   D  +C   LC  G+++  PL +   +P C+L DE         A+ ++D   C +
Sbjct:   15 DCECMVAMSEVSKELQLSESYPRDVWVELDGTSGLSSPLEKINEGDMLESGVVIRIDCGQCSCSNGALRCSKT-NCSNDCQWGQWKPWGSCSSTCGTGVRYRNRTVASPARFGGEPCQPKDFQEFELCNTQRCPCVWSQWSAWSDCSQTCNGGVKTRTRTP--QGDCLLEDATTETALCNVHPCGSTTTSPSCSEGKVMRQCSTTSCPYTCGHVTN--ETCSDQLACSTGCFCEQGFVFDEKARACVKPDQCTCDLTTLSCGLCSQGRCVNGVATCVPTTNCDCTWGPWSDWEPCSKACDGGSRTRTRAQATSRRGTGRACVGLASESEPCNTGRCPGCLDRFGNRV-PPGETMPSENPCEICYCSYFTGRPECMPKRPDDASNPAPQWSDWSEFSACSAPCGTGTKRRSRACVRLCVNDTRSCAPDARGRMDADQQSCNRQDCAPPVDCQVSDWTNGT-CYANCDGVNPTATGQQLRLRQITRQAANGGKACPSTYEVVPCSKQCKVDCLVGQWSAWSERVKNCVG--TGCNPSCGVGERERTRPVLRPAANGGQACRDHEFEPVLMPCNETVCSGPETLISCATKCWRTCSDVRANKQCQDVGCMQGCGCAGDKVREADTCVAVAECSCEHPENASRLMPPG--------SVVNKACNKCTCVSGQFVCEEKSCAQDCVWSAWQKVGGCNVTCGSGKQTWTRSIATPAANGGAECVGPTSRVTDCFGDEGACCNPNDAY-VDTGRCETTCAQLLNPELAQPQSNCQPGCQCKPGMARNANGSCVSIQDCFACQVNGVAWPSGRVDVDRANCSKRLCLHGQLSTQPLELSE-VPPCTLSDEVQAGTAGSEAQRVMDKSGCCY 858          
BLAST of Subcommissural organ spondin vs. TrEMBL
Match: A0A267DGZ8 (CTCK domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig013177g1 PE=4 SV=1)

HSP 1 Score: 446.047 bits (1146), Expect = 7.350e-129
Identity = 307/862 (35.61%), Postives = 437/862 (50.70%), Query Frame = 1
Query:  205 DCHCDVLFSDVKFKIHRD---IIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDC-PNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGN-CVLSDTC-CDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCN-FTAQKECQPSSDDNK--PDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGP--RIETEPCIMTCK-------VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYET-SECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC-EVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYA-ATQCCEINVAYSLKNSYCEQTCDDVIN--RLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNG---AKFIVDDIHC 2706
            DC C V  S+V  ++        D WVELD   G SS +E I +G  + S + +  +C +C C++G+L C    NC  DC+W +W  W  CS  C    + R+R +     +GG+ C+P   +E + C    C C WS WS W++CSQ C GG   +TRTP   G  L  D +  T  CN   C + T++P CS  KV   C   +CP TC  V +   +C +   C TGCFC  G+V D     CV  D C CD + ++C  C  G C NG A C+P  NCDC+W  W DW PC++ C   ++TRTR   T +RG G++CVG  ++ +PCN   C  C+D   +++ P G  MPS   C+ C+C+ FT + EC P   D+   P   W++WS +S CS  C  GT+ R R C+  C +  TR   P  R   +    +C        VDC +  WTN T C A C G N  A G   ++R +   + N       T   VPC   C VDC V  +   SE +K C    T C+PSCG G   +T   +  A NGG+ C +  +EP  +      C  P+ L+SC   C + C D+  +K+C +  C++ C C  + + +   CV+ +EC C   +N     PPG        ++  K CN CTC  G+++C    C QDC WS W+ V  CNVTCG G Q   R++A  A  GG +C G  +    C+     CC  N AY +    CE TC  ++N     P   C+ GC+C+PG  RN N +CV   +C+ C+VNG +W +G+   D  +C   LC  G+++  PL +   +P C+L DE         A+ ++D   C
Sbjct: 1656 DCECMVAMSEVSKELQLSESYPRDVWVELDGTSGLSSPLEKINEGDMLESGVVIRIDCGQCSCSNGALRC-SKTNCSNDCQWGQWKPWGSCSSTCGTGVRYRNRTVASPARFGGEPCQPKDFQEFELCNTQRCPCVWSQWSAWSDCSQTCNGGVKTRTRTP--QGDCLLEDATTETALCNVHPCGSTTTSPSCSEGKVMRQCSTTSCPYTCGHVTNE--TCSDQLACSTGCFCEQGFVFDEKARACVKPDQCTCDLTTLSCGLCSQGRCVNGVATCVPTTNCDCTWGPWSDWEPCSKACDGGSRTRTRAQATSRRGTGRACVGLASESEPCNTGRCPGCLDRFGNRV-PPGETMPSENPCEICYCSYFTGRPECMPKRPDDASNPAPQWSDWSEFSACSAPCGTGTKRRSRACVRLCVN-DTRSCAPDARGRMDADQQSCNRQDCAPPVDCQVSDWTNGT-CYANCDGVNPTATGQQLRLRQITRQAANGGKACPSTYEVVPCSKQCKVDCLVGQWSAWSERVKNCVG--TGCNPSCGVGERERTRPVLRPAANGGQACRDHEFEPVLMPCNETVCSGPETLISCATKCWRTCSDVRANKQCQDVGCMQGCGCAGDKVREADTCVAVAECSCEHPENASRLMPPG--------SVVNKACNKCTCVSGQFVCEEKSCAQDCVWSAWQKVGGCNVTCGSGKQTWTRSIATPAANGGAECVGPTSRVTDCFGDEGACCNPNDAY-VDTGRCETTCAQLLNPELAQPHSNCQPGCQCKPGMARNANGSCVSIQDCFACQVNGVVWPSGRVDVDRANCSKRLCLHGQLSTQPLELSE-VPPCTLSDEVQAGTAGSEAQRVMDKSGC 2497          
BLAST of Subcommissural organ spondin vs. TrEMBL
Match: A0A267G2Q9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012947g1 PE=4 SV=1)

HSP 1 Score: 443.736 bits (1140), Expect = 3.482e-128
Identity = 314/833 (37.70%), Postives = 433/833 (51.98%), Query Frame = 1
Query:  271 WVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCN-SGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNT-CICEWSPWSHWTECSQNCGGGTTNKTRTPLNSG-CDLSSDTSIVTVACNEFSCTTETS--TPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVT---GCFCNPGYVEDMLGN-CVLSDTC-CDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNF-TAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRI-----ETEPCIMTCKVDC-------VMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYET-SECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTY-EPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLS--KKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLP-DTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAAT-QCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNGAK 2682
            +VELD + GFSS  E I +   V S + V F+C  C C   GSL C +  NC  DC  + WSEWS CS  C   ++ RSR I+     GG  C+P+   +++ C    C C    W  WT CS+ C GG  ++TR  L SG C   S     + +C    CT+ ++   P+    ++Q+ C  V+CP TCD V  G  +C ES +C +   GCFC  G V D   N CV    C C+   V C PC   VC +G   C+P+ NCDC W +WQ W PC+  CG   QTR R  +  +RG+G  C G++T  +PCN   C +C D E    Y +G  MPS+  C+EC+C++ + +++C P    + P   W  W+ W+ C+G C + TR R R+C   C      C          ETE C  T   DC       V  +W N T C+A C G N VAYG + Q R +L+   +      +T RTVPC + C VDC   ++++ S C   C    T CDPSCG G+ T+T    V+A N G+ C     EPC +   +  C AP     C N C QRC DL+  + C  TDC   CACPDN   QDGQCV KSEC C WN  LLG  P  +    +P      KDCN CTC  G W CT+  C++DC +SDW     CNVTCG G +   R++ Q A +GG +C       + C+    +CC+ N  +  ++  C+QTC  V++       C  GC C  G VRN   +CVP  +CY+C VNG ++ NG +  D ++C    C  GK   + +GV+  +P+C+  D  + ++ A+
Sbjct: 1492 YVELDGVEGFSSSEEEIHEYAAVESGVKVHFDCGTCDCKPDGSLRC-QRSNCTLDCRLTSWSEWSACSASCGPGTRKRSRDILAPAGPGGAECQPSDFSQLEACQTADCPCIKEQWGEWTPCSKTCDGGLRSRTR--LASGNCTDGSGKETQSSSCGSTPCTSPSTCVEPM----QLQL-CAAVSCPLTCDHV-SGAAACSESHECDSSGYGCFCPSGTVWDRTSNRCVKPAECPCNLEAVQCLPCSEKVCVDGVGQCVPSVNCDCQWAEWQAWQPCSVECGGGTQTRQRDHSVQRRGSGAPCEGNSTQAQPCNAQTCPLCFD-EIDYWYRAGERMPSDTVCEECYCDYASGERKCIPLDQSDLPLPVWTSWTQWTNCTGACGSQTRERQRLCHKICPADKRTCAPDSTGLANRETERCGTTNPADCNEPIDCKVSTEWQNST-CSAVCDGVNGVAYGQMVQTRQILVQPQHGGDACPQTQRTVPCSIRCDVDCIAGSWQSWSACSVTCDVG-TVCDPSCGSGLRTRTRSVTVEAQNNGQPCVTRENEPCIIPCQTDVCQAPLVKSDCANRCHQRCSDLADLEVCAATDCKSGCACPDNTYMQDGQCVRKSECACAWNAALLGPAPDSVKNGRVPPGYTTAKDCNQCTCTDGAWQCTSKDCKKDCIYSDWASDGVCNVTCGSGKKLSTRSILQQAEFGGVECTEPLEKFDDCFGEEGKCCDPNAVH-YESKTCDQTCAGVLSGAEAPAACSAGCHCSAGLVRNSTGSCVPVEDCYKCSVNGVVYPNGYSANDMDACLHRTCLQGKYEETLIGVE-AMPSCTNLDGNMDASLAQ 2310          
BLAST of Subcommissural organ spondin vs. Ensembl Cavefish
Match: scospondin (subcommissural organ spondin [Source:ZFIN;Acc:ZDB-GENE-051114-1])

HSP 1 Score: 92.4337 bits (228), Expect = 2.240e-18
Identity = 166/668 (24.85%), Postives = 243/668 (36.38%), Query Frame = 1
Query:  430 DCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCICE-------WSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPI-CSGNKVQITCHNVT------CPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTCC---------DKSQVNCKPCETGVCENGQAVCIPNDNC--DCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN-----GTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC 2322
            DC  S W+ WS CS  C   S  R R I++    GG      G  + D     C  +       W+ WS W+EC   CGGG   ++R+    P  +G       ++ +  CN   C + T     C    V +T  +        CP TC D L    +C  S  C+TGC C  G +++D  G+CV +  C             +V    C T +C++G   C  N +C   C W+ W  W+ C+  CG   Q R                   + + P  +     C+ D T                ++C+        C+P        A W+EW+ WS CS  C +     G R R R C     D S+ CVG   E EPC  + C V+     W+  + C+++C  G         Q R+    S              P  L     C     +T +C      N+  C  SC  GM   T +E          C+        G C + C+    ++ C                 T+C + C C   +   +  CV  S C C     L    P G    S+P       CNNC           ++   DC WS+W   S C+ TC  G+++  R+    +A +GG  C G     + C
Sbjct: 2368 DCVLSAWTAWSPCSTSCGLGSLFRKREILRDARAGGSC----GGAQFDS--RACFLQACPVDGHWAEWSEWSECDAACGGGVRMRSRSCSNPPSKNGGKECEGMAMQSQGCNMQPCGSGTDIQTGCVNGLVLVTELDCAEGRVEPCPLTCSD-LHSERNC--SHHCLTGCRCPAGLFLQD--GHCVNASKCLCLWEGSELQPGEEVTPDSCTTCMCQDGHVSC-DNSSCISKCDWSAWSSWTSCDSSCGIGIQQRF-----------------RSSLMPSGVESVEPCVGDSTEA--------------RQCY------SPCKPGQIPTTNGAPWSEWTTWSECSKTCFHHVDAVGMRRRFRSCNQ--TDSSSPCVGEGEEQEPCNTLHCPVNGGWSAWSAWSECSSECDSG--------AQTRERFCSS--------------PPPLYGGNSCLGPHIQTRDC------NSHPCSGSCPTGMSYLTKEE----------CQAQG-----GACPRVCLDATTIVECA----------------TECYDGCYCSPGLYLFNNTCVPLSNCPCYHKGALY---PQGA---SVPHDA----CNNCA------SLYQSVNSVDCGWSEWTSWSMCSRTCDVGIRRRYRSGTNPLASFGGRPCVGDRIGLDTC 2909          

HSP 2 Score: 85.8853 bits (211), Expect = 2.593e-16
Identity = 90/349 (25.79%), Postives = 134/349 (38.40%), Query Frame = 1
Query: 1294 QKECQPSSDDNK-PDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIM-TCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL-SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGV-QKLERTVAQVAVYGGNDCQGSNTTDEICYA 2328
             K+C   SD+    D   + W+AWS CS +C  G+  R R  +       + C G + ++  C +  C VD    +W+  + C+A C G      G+  + R    P      KECE                 +  ++  C      + T     C +G+V                  VT   C  G               V PC   C DL S++  +  C+  C CP  +  QDG CV+ S+C C W  + L    PG  EE  PD+     C  C C+ G   C  + C   C WS W   + C+ +CG G+ Q+   ++    V     C G +T    CY+
Sbjct: 2354 HKDCADGSDERDCVDCVLSAWTAWSPCSTSCGLGSLFRKREILRDARAGGS-CGGAQFDSRACFLQACPVDGHWAEWSEWSECDAACGG------GVRMRSRSCSNPPSKNGGKECEG----------------MAMQSQGCNMQPCGSGTDIQTGCVNGLVL-----------------VTELDCAEGR--------------VEPCPLTCSDLHSERNCSHHCLTGCRCPAGLFLQDGHCVNASKCLCLWEGSEL---QPG--EEVTPDS-----CTTCMCQDGHVSCDNSSCISKCDWSAWSSWTSCDSSCGIGIQQRFRSSLMPSGVESVEPCVGDSTEARQCYS 2638          

HSP 3 Score: 72.0182 bits (175), Expect = 3.888e-12
Identity = 67/206 (32.52%), Postives = 84/206 (40.78%), Query Frame = 1
Query: 1897 CVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRNINNTCVPTSEC 2505
            C N C + C DL +  +C    C   C CPD  L Q+G+CV  + CRC            G +E S P      DCN C C  G  +CT   C     W  W   S C+V+CG G +   R+       GG  C      ++ C   TQ C     +S     C  +C D+          C  GC C P  V   N TCVP SEC
Sbjct: 4507 CANQCPRSCADLWEHVQCLQGTCHPGCRCPDGWLLQEGECVRVTACRCGLPTE------NGTLELS-PGQNVTVDCNTCVCINGSLVCTNQPCPTYGSWGSW---SECSVSCGTGQRIRRRSCTHKP--GGPPCS-ETEQNQTC---TQPCPAGQVFSACAGSCPFSCQDLWPESECVPGACSPGCACPPATVM-FNGTCVPHSEC 4695          

HSP 4 Score: 67.3958 bits (163), Expect = 9.254e-11
Identity = 63/216 (29.17%), Postives = 87/216 (40.28%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTR----TPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNC-------------DCSWNQWQDWSPCNRVCGPSXXXXXXXXXX-XXXXXXQSCVGSNTDIKPCNIVPC 1194
            WS WS W+ECS  C  G   + R     P   G +      I T  CN   C+    T +    K +       CPR C   LD     E +++C  GC+C+PG         + ++TC   S  NC PC        Q   +P+D C             DC W++W  WS C+R C    + R R+         G+ CVG    +  C+I PC
Sbjct: 2712 WSAWSAWSECSSECDSGAQTRERFCSSPPPLYGGNSCLGPHIQTRDCNSHPCSGSCPTGMSYLTKEECQAQGGACPRVC---LDATTIVECATECYDGCYCSPGLY-------LFNNTCVPLS--NC-PCYHKGALYPQGASVPHDACNNCASLYQSVNSVDCGWSEWTSWSMCSRTCDVGIRRRYRSGTNPLASFGGRPCVGDRIGLDTCSIYPC 2914          

HSP 5 Score: 64.3142 bits (155), Expect = 8.636e-10
Identity = 106/468 (22.65%), Postives = 157/468 (33.55%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDP-CEDLSTRCVGPRIETEPC-------------------IMTCKVDCVMGQ----------WTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC----ETNRTVPCQLDCPVDCKV-------LTYETSECIKLCS----ANNTQCDPSCGHGMVTKTPQEIVKA--------VNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEIC--YAATQCCEINVAYSLK------NSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQT 2550
            D +W EWS WS C   C  G R R R C +P  ++    C G  ++++ C                   ++  ++DC  G+            +E  C+  C  G     G+  Q    +      NA +C    E +   P +   P  C         ++ + S CI  C     ++ T CD SCG G+  +    ++ +        V         Y PC  G    +  AP    +  + C + C              SC    N  +    CV                   G  EE  P                   C T  C  +  WS W   S C+  C  G Q  ER   +   +YGGN C G +     C  +  +  C   ++Y  K         C + C D    +     C +GC C PG +   NNTCVP S C  C   G ++  G +
Sbjct: 2423 DGHWAEWSEWSECDAACGGGVRMRSRSCSNPPSKNGGKECEGMAMQSQGCNMQPCGSGTDIQTGCVNGLVLVTELDCAEGRVEPCPLTCSDLHSERNCSHHCLTGCRCPAGLFLQDGHCV------NASKCLCLWEGSELQPGEEVTPDSCTTCMCQDGHVSCDNSSCISKCDWSAWSSWTSCDSSCGIGIQQRFRSSLMPSGVESVEPCVGDSTEARQCYSPCKPGQIPTTNGAPWSEWTTWSECSKTCFHHVDAVGMRRRFRSC----NQTDSSSPCV-------------------GEGEEQEP-------------------CNTLHCPVNGGWSAWSAWSECSSECDSGAQTRERFCSSPPPLYGGNSCLGPHIQTRDCNSHPCSGSCPTGMSYLTKEECQAQGGACPRVCLDATTIVECATECYDGCYCSPG-LYLFNNTCVPLSNC-PCYHKGALYPQGAS 2840          

HSP 6 Score: 60.8474 bits (146), Expect = 8.692e-9
Identity = 56/180 (31.11%), Postives = 80/180 (44.44%), Query Frame = 1
Query:  598 EWSPWSHWTECSQNCGGGTTNKTR--TPLNSG---CDLSSDTSIVTVA-CNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTC-CDKSQVNCKP-------CETGVCENGQAV-CIPNDNC--DCSWNQWQDWSPCNRVCG 1086
             WS W+ W+ CS+ CGG    +     P N G    +L  +T    +  C++ +C   +    C    V  +C    CP+TC  +     SC+  + C TGC+C  G V + L  CVL + C C+ + V   P       CE   CE G+   C PN  C  +C W+ W  W  C   CG
Sbjct: 1688 RWSAWTTWSNCSKGCGGVEIRQRVCVPPQNGGRACAELPGETLTTEIKPCSQDACANVS----CPVGLVSHSC--APCPKTCAHI-SSDTSCDPDAPCFTGCWCPEGKVMNHLQQCVLPEECVCEVAGVRYWPGQQVKRGCEICRCERGRPQHCQPNPECSVNCGWSSWSPWGKCLGPCG 1860          

HSP 7 Score: 58.9214 bits (141), Expect = 3.580e-8
Identity = 94/379 (24.80%), Postives = 138/379 (36.41%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKC-TNTDCIESCACPDNMLEQDGQCVSKSECRC--------------------TWND------------NLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAV-YGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSY-------CEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNT-CVPTSEC 2505
            VDC   +WT+ + C+  C        GI  + R    P  +   + C  +R         +     +      +K   +  ++C   CG G   +T   I       +      +PC  G   + C   ++   CV   E  C DL  +   N+ C   C CP     QDG+CV  S CRC                    +W+D              L +R        L  +  P    +   RQ + +C    C +D  WS+W   + C  +CG GV+   R   + A    G+ C+G  T  E+    T  C ++    +  S        C +TCDD+    H    CE GC C  G V NIN T CV   EC
Sbjct: 2859 VDCGWSEWTSWSMCSRTC------DVGIRRRYRSGTNPLASFGGRPCVGDR---------IGLDTCSIYPCSGVKGPWSAWSECSVPCGGGYRNRTRGPIRTHGTPQQFSACNLQPCGGG---KDCAEGQEWTMCVRE-ELLCSDLGLETEMNSTCSSGCQCPHGSALQDGRCVPLSLCRCDIDGEQYNPGAVYKLVLVNGSWSDWTPWSVCSVSCGAGLQSRYRFCSSPELSGSGLPCMGPD---RQDQ-VCVLLPCSRDGGWSEWTSWTDCTKSCGAGVKSRRRECDRPATEREGDYCEGLRT--EVVACNTDPCPVSPCSDVPGSVFSSCGPSCPRTCDDLA---HCEWRCEAGCYCTDGKVLNINGTACVEREEC 3209          

HSP 8 Score: 58.9214 bits (141), Expect = 3.765e-8
Identity = 48/149 (32.21%), Postives = 69/149 (46.31%), Query Frame = 1
Query: 1870 CVAPKQLLSCVNPCEQRCGDLS--KKCTNT-DCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRP--------------PGIMEESLP---DTIFPKDCNNCTCRQGKWIC-TTNICQQDCQWSDWKIVSPCNVTCGKGVQKLER 2253
            C   ++   C  PC + C DL    +C +T  C  +C CP +M+ QDG CV + ECRC ++++    +               PG  +       D+I  +DC+NCTC  G   C +   C  D  WS W   S C+V CG GV+   R
Sbjct: 3379 CGGGQEEWPCGKPCPRSCEDLHGDTECVDTPGCSPTCGCPGDMVLQDGVCVEREECRCKFHNSTTSEKNIFSGLNTSNTSWEWPGRNDWQYANSGDSII-RDCSNCTCEAGILNCDSVPGCHVDGGWSQWGPWSECSVPCGGGVRLRFR 3526          

HSP 9 Score: 57.7658 bits (138), Expect = 8.968e-8
Identity = 88/305 (28.85%), Postives = 123/305 (40.33%), Query Frame = 1
Query:   94 TEWSDWSLCNASCG-YGSSVRSRNCSTTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVA----SNITVFFNCA-----KCLCN-----SGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCV 930
            T W  W  C+ SCG  G   RSR+C+     H         C     +  +    D  D  V       +S+  +   DG   A      + V   CA     + +CN      G + C  ++   ++C W+ W EWS CS  C    + R R  +  P   G +C     GN E   C N   C     WS WS W+ C + CGGG + +TR+     P N G     + + V   CN   C T    P     +  + C N  CP+ C D L  GI C+ S++C  GC C  G ++   G CV
Sbjct: 3664 TSWGPWGPCSLSCGGLGQKTRSRSCTQPRPAHGGR-----DCVGPLQETAYCQTPDCPDEDVGFTQWSAWSACSKTCSDGGAAAVKSRERVCVSAPCAGQNRQQKVCNLPQCPDGGV-CVGEDCAHRNCSWTEWGEWSACSRSCGVGQQRRFRSFLA-PGVNGTWCPDILEGNLENRFC-NIRACRVDGSWSRWSPWSHCDKACGGGRSIRTRSCSSPPPKNGGRKCVGEKNQVK-PCNTKPCDTHGCPP----GQEFVPCAN-QCPQRCSD-LQQGIQCKASTECQPGCRCPRGEMQQD-GTCV 3952          

HSP 10 Score: 54.299 bits (129), Expect = 9.018e-7
Identity = 79/299 (26.42%), Postives = 112/299 (37.46%), Query Frame = 1
Query: 1738 TQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDL--SKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPD-----TIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHP-----THVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNG-QTKKDTNSCQLYLCSGG 2595
            ++C  SCG G   +      K   GG  C  T +      C+Q C A +   +C   C   C DL    +C    C   CACP   +  +G CV  SEC C+    LL +  P I   +LPD     T+ P  CN C C  G + CT   C    +   W+          + V +++R                                          CE+ C D+  R  P     TH   EGC C+ G  R+ +  CV  + C   + +GT+ + G + +KD   CQ  LC  G
Sbjct: 4602 SECSVSCGTGQRIRRRSCTHKP--GGPPCSETEQN---QTCTQPCPAGQVFSACAGSCPFSCQDLWPESECVPGACSPGCACPPATVMFNGTCVPHSECPCSPVSLLLTS--PNITLNALPDEVPPGTVVPHLCNFCVCDNGVFNCTEESCDACPEGERWR----------RSVLEMDRV-----------------------------------------CERGCVDMY-RAEPLNCTSTHGISEGCVCEDGRYRSTDGRCVIPALCQCEDEDGTLREPGSEWEKD---CQTCLCVNG 4838          

HSP 11 Score: 53.9138 bits (128), Expect = 1.123e-6
Identity = 54/185 (29.19%), Postives = 81/185 (43.78%), Query Frame = 1
Query: 1909 CEQRCGDLS--KKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESL-PDTI-------------FPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLE-RTVAQ-VAVYGGNDCQGSNTTDEICYAAT-QCCEINVAYSLKNSY--CEQTCDD 2400
            C   C  LS  + C +  C E C CP N  + +G CV   EC C  ++ LL +     M   L PD                  +C++C C+ G W C+   C +D   + W    PC+++CG   QK   R+  Q    +GG DC G     E  Y  T  C + +V ++  +++  C +TC D
Sbjct: 3557 CPFSCAQLSGLEGCYSEGCEEGCHCPPNTYQHNGTCVQ--ECPCLVDEELLTSLQRVSMTPELTPDLQNITMGTELQSGEELMHECSSCLCQHGLWNCSLVPCPRDGGLTSWGPWGPCSLSCGGLGQKTRSRSCTQPRPAHGGRDCVGP--LQETAYCQTPDCPDEDVGFTQWSAWSACSKTCSD 3737          

HSP 12 Score: 53.5286 bits (127), Expect = 1.861e-6
Identity = 41/126 (32.54%), Postives = 56/126 (44.44%), Query Frame = 1
Query: 1186 VPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGG 1557
            VP   C       +YP G+ +P + AC  C   + +          N  D  W+EW++WS+CS  C  G R R R   +P      R CVG RI  + C I  C    V G W+  + C+  C GG
Sbjct: 2821 VPLSNCPCYHKGALYPQGASVPHD-ACNNCASLYQSV---------NSVDCGWSEWTSWSMCSRTCDVGIRRRYRSGTNPLASFGGRPCVGDRIGLDTCSIYPCSG--VKGPWSAWSECSVPCGGG 2934          
BLAST of Subcommissural organ spondin vs. Ensembl Cavefish
Match: sema5bb (sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 5Bb [Source:ZFIN;Acc:ZDB-GENE-130530-778])

HSP 1 Score: 56.9954 bits (136), Expect = 1.126e-7
Identity = 101/368 (27.45%), Postives = 144/368 (39.13%), Query Frame = 1
Query:  391 GSLDC----FEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRV-IIKQPNYGGKFCEPNGNEEI---DDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLN----SGCDLSSDTSIVTVACNEFSCT-TETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCET-GVCENGQAVCIPNDNCD-CSWNQWQDWSPCNRVCGPSXXXXXXX-XXXXXXXXXQSCVGSNTDIKPCNIVPCI--MCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC---IDPCE 1431
            G L+C     E  NC ++  W+ WS WS CS  C    + R R      P +GG+ C     EE    ++ P      W PWS W++CS  CGGG  ++ RT  N    SGC L         ACN  +C     +TP      V +T             + G    +           NP  ++  LG   L    C         CET G+ ++   V  P ++    SW+ W+ WS C++ C    +TR R+  + D + +  SC G+  + + CN  PC   +CI   T                +E  CN     EC+           W  WS WS    +C  G + R R C    +PCE
Sbjct:  522 GGLECVGAKIEVANCSRNGGWTPWSSWSPCSTSCGVGFEVRQRSCNNPAPRHGGRVCVGQAREERLCNENTPCPLPVSWVPWSSWSKCSAPCGGGIQSRVRTCENGNTCSGCPLEYK------ACNLEACAEVRRNTPWSPWYPVNVT-------------VSGARQEQRVRFTCRALLANPHDLQ--LGKRKLETRTCPPGD-GTPGCETDGLVDDLVRVSRPVNHVQGASWSPWETWSSCSKECSKGFRTRKRSCLSPDGKSSPFSCSGTPVEYQDCNTQPCSGDICIGLHT----------------EEALCN---THECE----------GWGVWSEWS----DCEEGFQHRSRTCDVSTEPCE 834          
BLAST of Subcommissural organ spondin vs. Ensembl Cavefish
Match: adgrb1a (adhesion G protein-coupled receptor B1a [Source:ZFIN;Acc:ZDB-GENE-060607-12])

HSP 1 Score: 53.9138 bits (128), Expect = 1.257e-6
Identity = 54/201 (26.87%), Postives = 75/201 (37.31%), Query Frame = 1
Query:  964 NCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDET-SQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC--IMTCKVDCVMGQWTNETACNAQCCGG 1557
            NC P   G          P+ + +  W+ W +W  C+  CG                    C G   + +PCN  PCI      T SQ   S      +        +    +  Q SS  + P     EWS WS+CS  C  G +SR R C+      ST+C GP  E  PC     C V     +W+  + C++ C  G
Sbjct:  223 NCLPAVKGTA--------PDSDTNGGWSSWGNWMECSSECG-GGVQTRTRVCNSPPDEAYMCDGVLEEGRPCNSQPCIGKGRHGTRSQSLRSVDSRKRD--------DVDKSRAAQQSSQTDSPSG--EEWSPWSVCSATCGEGWQSRTRFCVS--VSYSTQCSGPLREQRPCNNTAVCPVHGAWDEWSPWSLCSSTCGRG 402          
BLAST of Subcommissural organ spondin vs. Ensembl Cavefish
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 53.5286 bits (127), Expect = 1.271e-6
Identity = 71/253 (28.06%), Postives = 97/253 (38.34%), Query Frame = 1
Query: 1327 KPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC--ETNRTVPC-QLDCPVDCKVLT--YETSECIKL---------CSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCY--------------LGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLE 1995
            + D  W+ WS WS CS  C  G  +R R+C  P   +  R C G   +TEPC M+ C V+   G W+    C+  C G      G+ T+ R    P      KEC  +   T  C   DCP+D  + +  +  ++C            C    T     C      K   E    +NG   CE T EP Y               G   +  +A KQ+ +  NPCE    D +K   N +CI      D M  
Sbjct:  403 RQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGEGRQTEPCKMSPCPVNGGWGPWSLWDTCSVTCGG------GLQTRHRLCNNPMPKHGGKECVGDAKGTRLCNSEDCPIDGCLSSPCFAGTKCTSFPDGSWKCGECPVGYTGDGMHCEDIDECKAVPEACFTLNGVHRCENT-EPGYNCLPCPPRYSGVQPFGKGIEQAMANKQVCAPKNPCEDGSHDCNK---NANCIYLGVFSDIMFR 645          
BLAST of Subcommissural organ spondin vs. Ensembl Cavefish
Match: thbs1a (thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402-2])

HSP 1 Score: 53.5286 bits (127), Expect = 1.594e-6
Identity = 71/253 (28.06%), Postives = 97/253 (38.34%), Query Frame = 1
Query: 1327 KPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKEC--ETNRTVPC-QLDCPVDCKVLT--YETSECIKL---------CSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCY--------------LGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLE 1995
            + D  W+ WS WS CS  C  G  +R R+C  P   +  R C G   +TEPC M+ C V+   G W+    C+  C G      G+ T+ R    P      KEC  +   T  C   DCP+D  + +  +  ++C            C    T     C      K   E    +NG   CE T EP Y               G   +  +A KQ+ +  NPCE    D +K   N +CI      D M  
Sbjct:  437 RQDGGWSHWSPWSSCSVTCGEGVITRIRLCNSPTPQMGGRDCQGEGRQTEPCKMSPCPVNGGWGPWSLWDTCSVTCGG------GLQTRHRLCNNPMPKHGGKECVGDAKGTRLCNSEDCPIDGCLSSPCFAGTKCTSFPDGSWKCGECPVGYTGDGMHCEDIDECKAVPEACFTLNGVHRCENT-EPGYNCLPCPPRYSGVQPFGKGIEQAMANKQVCAPKNPCEDGSHDCNK---NANCIYLGVFSDIMFR 679          
BLAST of Subcommissural organ spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000925.1 (pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 108.612 bits (270), Expect = 5.659e-24
Identity = 203/789 (25.73%), Postives = 303/789 (38.40%), Query Frame = 1
Query:   94 TEWSDWSLCNASCG-YGSSVRSRNCSTTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLM------ELIEDGQTVASNITVFFNCAKCLCNSGSLDCF-------------EDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGY-VEDMLGNCVLSDTC-----------CDKSQVNCKPCETGVCENGQAVCI--PNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPC-EDLSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD--CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGD--LSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLL----GTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQD---CQWSDWKIVSPC---NVTCGKGVQKLERTVAQVAV 2274
            + WS W  C+ +CG  G   R+R CS     H         C     D+K+    D         D  GF S            D +  A    V F   +  C   S                 ED +C  DC W+ W+ WS CS  C    + R R     P   G +C     GN E+  C NT +C+    WS WS W  C + CGGG + + R        N G     D   VTV CN   C  E   P      +   C N  CPR+C D L  G +C +   C  GC C  G  + +  G CV +  C              S+ +   C    C +G+  C   P  +  C+W+ W  WS C+  C    +TR R++ T       S C G  + +KPC++  C         + Y     +     C++C C       CQ    D + D  W  W+ WS C+ +C  G + R R CI+P   +  T C GP +E + C    C  D V+                       + + R   + S N+N++EC   R     L+  C  +  ++++ + + + L    +   +       +    Q +++ +     C     PC L  C   C  P     C +PC Q CG   L  +C   +C+  C CP  +LEQ+G CV  +EC C    +LL    G++P  I     P +     C  C C  G+  C+ + CQ       WS+W    PC   ++  G  ++   R + + ++
Sbjct: 1418 SSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGR-----PCTGPTMDIKYCHTPDCRGE--RSADTEGFGSWTPWSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPCGVGQQQRMRTY-NPPLGNGSWCPDIIAGNWEVRFC-NTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTV-CNTQPCDGEGCPP----EMLLSDCGN-RCPRSCAD-LQQGFACVDPEHCQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRIECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQGERSQVKPCDLGSCPPLCRHGNWERYLGDVWLEGE--CEQCQCTPEGSF-CQ--VIDCRVDGGWTPWAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECATAPCPDDGVVD----------------------VNKWRLGTMESNNSNSRECGEIRRGGANLNGMCRNEYLMISWSSIDLLALNIIIDQDFNFPIASRSLPLLRQPVIENLPKRHLC-----PC-LCQCEGVCPEPLVFDPCGSPCSQYCGGRTLGTECVQ-ECVPGCYCPQGLLEQNGTCVDGAECGCV---HLLTEAEGSKP--IPSLIAPGSRVTVGCLECLCEDGQLHCSNDSCQGAGVLGAWSEWTTCRPCVPPSILVGGHLRPFLRPLHEGSL 2151          

HSP 2 Score: 82.0333 bits (201), Expect = 5.934e-16
Identity = 99/362 (27.35%), Postives = 128/362 (35.36%), Query Frame = 1
Query: 1249 PSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLE--QDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKD-CNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA-QVAVYGGNDCQGSNTTDE 2316
            P  + C +C C       C   S D   D  W++WS W+ CS  C  G + R R C +P      R C GP  E   C    C  D     W+    C+  C GG     G+ ++ R    P+       CE                                        G G+ T+               E   EPC   NCS+  VA      C  PC + C D+S    +  C   C C D  L   +   CV K +C C  + N     PPG       DT+   D CNNCTC  G  +CT   C  D  W +W   +PC+ TCG       RT A  +   GG  C G+    E
Sbjct:  754 PIQIGCTKCTCENGEAARC--VSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAWSGWSRWAECSRSCGGG-----GLRSRARACDAPAPGGGGDYCE----------------------------------------GPGVDTQ---------------ECHAEPCPDRNCSE--VAGSYYSHCGPPCPRTCDDVSF--CSWSCEPGCYCTDGRLMNGEGKACVDKQDCTCL-DINTGRRHPPG-------DTVPHADGCNNCTCMHGALVCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHE 1041          

HSP 3 Score: 78.9518 bits (193), Expect = 5.477e-15
Identity = 87/355 (24.51%), Postives = 130/355 (36.62%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWI-CTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYG-GNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCE 2385
            D  W+EW+AWS+C+  C  GTR R R    P      R C G  +E   C ++ CK   V G+W   + C+A C GG  V    +  +R++  P    N            Q     D + L+    +  +LC A+                  E +   + G++   +   C+ G                                      C CP+  L  +  CV  SEC C    ++            LP +     C  CTC  G+   C +  C  D  WSDW   +PC+  CG GVQ+  R   +    G G DC G  + + +C   T  C  + A+S  + + E
Sbjct:  579 DCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPCKA--VWGEWEAWSGCSASCGGG--VRAHTMCSIRNVPQPWNYCN------------QYRNAADGQTLSCPEGKVWRLCHAD------------------EPITCADLGRDLTFSGRECHPG--------------------------------------CYCPNGTLLLNQTCVRISECPCFVGGSVY-----------LPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCN--THACTQDGAWSGWSRWAE 848          

HSP 4 Score: 70.8626 bits (172), Expect = 1.654e-12
Identity = 119/440 (27.05%), Postives = 156/440 (35.45%), Query Frame = 1
Query:   85 VVCTEWSDWSLCNASCGYGSSVRS----RN-------CSTTENEHD----SCYSSD----CHCDV------LFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIE-----DGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYG-GKFCEPNGNEEIDDCPNTCICE--WSPWSHWTECSQNCGGGTTNKTRTPLNS-----GCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCH-NVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETG------------------VCENGQAVCIPNDNC--DCSWNQWQDWSPCNRVCG------------PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVP 1191
             V  EW  WS C+ASCG G    +    RN       C+   N  D    SC        CH D       L  D+ F         +     ++   + + + E      G        +   C KC C +G        +C  D  WS WS W+ CS  C    + R R   + P  G G+ C   G+EE     + C  +  WS WS W ECS++CGGG         ++     G D      + T  C+   C        CS        H    CPRTCDDV     SCE       GC+C  G + +  G       C DK    C    TG                   C +G  VC  N  C  D  W +W  W+PC+R CG            P  +         QRG+    VG   + KPCN+ P
Sbjct:  635 AVWGEWEAWSGCSASCGGGVRAHTMCSIRNVPQPWNYCNQYRNAADGQTLSCPEGKVWRLCHADEPITCADLGRDLTFSGRECHPGCYCPNGTLLLNQTCVRISECPCFVGGSVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQECHAEPCPDRN----CSEVAGSYYSHCGPPCPRTCDDVSFCSWSCE------PGCYCTDGRLMNGEGK-----ACVDKQDCTCLDINTGRRHPPGDTVPHADGCNNCTCMHGALVCT-NQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFP 1058          

HSP 5 Score: 69.3218 bits (168), Expect = 4.674e-12
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 1
Query: 1888 LLSCVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
            L +C N C + C DL +  +C    C E C CP+  L QD  CV  ++CRC       G   P   +E  P  +   DCN C C +G ++CT ++C +   WS W     C+ +CG G +   R     +    + C G     E C
Sbjct: 2272 LSTCANQCPRSCSDLWEHVECLQGSCREGCRCPEGWLLQDRACVPVAQCRC-------GLPSPNASQEYRPGEVVRVDCNECVCVKGTFVCTEHVCPELGPWSAW---GECSRSCGGGTRARHRDCPDASAP--HACPGEPQQSEAC 2406          

HSP 6 Score: 69.3218 bits (168), Expect = 4.959e-12
Identity = 76/296 (25.68%), Postives = 116/296 (39.19%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGM-VTKTPQEIVKAVNGGKNCE---VTYEPCYLGNCSQ-SCVAPKQLL--------SCVNPCEQRCGDLSKKCT-NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFP-KDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGN-DCQGSNTTDEICYAA 2331
            +DCV+  WT  + C+  C        G++ + RD+L       +       +  C +  CPV+ +   +          ++ + CD  CG GM V +         NGG+ C    V  E C +  C++ S   P  +           V PC   C  L K       C+E C C   +  + G+CV   EC+C  +  +             P  +F   +C+NC+CR G   C  + C   C WS W   +PC+  C  G Q+  R+    A  GG   C G +T    C A 
Sbjct:   96 LDCVVSPWTEWSQCSRSC------GLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVEGQWGAW----------SSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCVEGCRCKPGLYLKSGRCVEAGECQCRVDGRVY-----------KPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAG 364          

HSP 7 Score: 67.781 bits (164), Expect = 1.343e-11
Identity = 152/612 (24.84%), Postives = 214/612 (34.97%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITC-HNVTCPRTCDDVLD----GGISCEESSDCVTGCFCNPGY-VEDMLGNCVLSDTCC----DKSQVNC--KPCETGVC-ENGQAVCIPND------------NCDCS----------------WNQWQDWSPCNRVCG--PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCI--MCIDDETSQIYPSGSP---------MPS---------------NVACQECFCNFT---AQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDP------CEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPD--NMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQ-DCQWS 2190
            WS WS W  CS  CGGG   + R+ L+  C      +  + ACN   C        C  +K+   C  +  CP TC  V       G +CEE   C  G + + G  V++    CVL +       ++S ++   K  + G   ++G AV +  +            NC C+                 + W  W  C+R CG           +    R  G+ C G   DIK C+   C      D E    +   SP         +P+                 + QE  CN     A   C+    D   D +WN W+AWS CS  C  G + R R    P      C D+    +    E   C    CKVD     W+    C+  C GG S+      +VR    P      + C  ++                Y+ + C      N   CD   G G     P E++ +  G +             C +SC   +Q  +CV+P                C   C+CPD   +LEQDG+CV   +C CT  D       PG    SL        C +CTC  G+  C    C    C WS
Sbjct: 1237 WSEWSPWANCSVGCGGGEQTRHRSCLHPPC---PGLATHSKACNTHVCQASAG---CPADKLFRECVQDEECPYTCAHVRGEAECRGETCEEGCHCPVGTWLHQGRCVQEC--PCVLDEATAVLLWEQSALSAAEKAADQGALRDDGTAVFLGQEIPSGASITHECSNCTCAHGNLRCAARPCPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRGERSADTEGFGSWTPWSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCE--DGDCSVDCSWNAWTAWSTCSRPCGVGQQQRMRTYNPPLGNGSWCPDI----IAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSL------RVRACTNPPRKNGGQPCPGDK----------------YQVTVC------NTQPCD---GEGC----PPEMLLSDCGNR-------------CPRSCADLQQGFACVDP--------------EHCQPGCSCPDGIGLLEQDGRCVPTWQCECT--DMSGQAWAPGSSRPSL------SSCADCTCSHGRIECAEKPCADGSCAWS 1764          

HSP 8 Score: 65.0846 bits (157), Expect = 1.081e-10
Identity = 114/443 (25.73%), Postives = 163/443 (36.79%), Query Frame = 1
Query:  256 DIIDAWVELDDIIGFSSLMELIEDGQTV--------ASNITVFF---NCAKCL-----CNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPN-YGGKFCEPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNC----------KPCETG----VCENGQAV-CIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNC-PNGTRSRDRICIDPCEDLST-RCVGPRIETEPC 1479
            ++I  ++ L   +G S    L E G T+        AS     F   + A+ L     C +G + C     C  DC WS W+ WS C+  CD  ++ R R     P  +GG+ C     E        C   W  W  W+ CS +CGGG    T   +        +       CN++    +  T  C   KV   CH    P TC D+  G        +C  GC+C  G +       +L+ TC   S+  C           P + G     CENG+A  C+  D + D +W+ W  W+PC+  CG                     +G     + C   P          +    G P       +E  CN  A  +          D  W+ WS W+ CS +C   G RSR R C  P        C GP ++T+ C
Sbjct:  506 EVILEYLPLCSPMGISIAGVLFELGNTLTXPTIAGSASAHRPHFSSSDVARSLHMNSTCVNGEMQCG-SLPCSVDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPCKAVWGEWEAWSGCSASCGGGVRAHTMCSIR-------NVPQPWNYCNQYRNAADGQTLSCPEGKVWRLCHADE-PITCADL--GRDLTFSGRECHPGCYCPNGTL-------LLNQTCVRISECPCFVGGSVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCG---------------------LGVQRRYRFCTEPP-------PAGEGRDCGGP-----GSEERVCNTHACTQ----------DGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQEC 887          

HSP 9 Score: 63.5438 bits (153), Expect = 2.668e-10
Identity = 115/456 (25.22%), Postives = 157/456 (34.43%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKP---DANWNEWSAWSICSGNCPNGTRSRDRICI--------DPCEDLST----RCVGPRIETEPCIMT--CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT----NTDCIESCACP-DNMLEQDG-QCVSKSEC----------RCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYG-GNDCQGSNTTDEICYAATQCCEINVAYS-LKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPG 2460
            C+D  T + +P G  +P    C  C C   A          N+P   D  W EWS W+ CS  C + T SR R C          PC         R VG ++E +PC +   C  D   G W++ +A        ++ A G   + R+   P+      ECE N TV                     + C  + + C P C  G V                                      +L C  PC + C DL           +C  +CACP D +L +DG  CV  S C               D     +P  I+    P       CNNCTC  G+  CT         WS+W   + C+V CG G Q   R+       G     +  NT   +C A+  C    +    +++  C  TC  V          CEEGC C  G
Sbjct:  953 CLDINTGRRHPPGDTVPHADGCNNCTCMHGAL------VCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSA-------CDACAGGAAVRTRECNSPTPRFGGAECEGNSTV--------------------SRPCQGDPSSC-PDCPEGQV--------------------------------------VLPCGKPCPRSCEDLRSGVLCVEPPAECRPACACPGDLVLREDGTACVPPSRCPCRYRPPRPPHSHGRDRECRVQPAWILVH--PGETVAIRCNNCTCESGQLSCTE---LDSWPWSEWSPWANCSVGCGGGEQTRHRSCLHPPCPGLATHSKACNT--HVCQASAGCPADKLFRECVQDEECPYTCAHVRGEAECRGETCEEGCHCPVG 1329          

HSP 10 Score: 62.003 bits (149), Expect = 8.479e-10
Identity = 89/298 (29.87%), Postives = 120/298 (40.27%), Query Frame = 1
Query:  376 CLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVT------CPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC-CDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGP-SXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPC 1194
            CL  S  LDC        DC  S W+EWS+CS  C      R R ++++   GG             +  CP     +W  WS W+ C   CGGG   + RT    P  +G    +   +    CN   C   +    C  + V ++  +        CP TCD  LD    C     CV GC C PG Y++   G CV +  C C       KP        C    C +G   C P+     C W+ W  W+PC+R C   S +     TN    G G  CVG +T+++ CN  PC
Sbjct:   86 CLDGSDELDCL-------DCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVEG--QWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSD---CGPDMVFVSAEDCKRRTVEPCPLTCDH-LDKSPDCR--VPCVEGCRCKPGLYLKS--GRCVEAGECQCRVDGRVYKPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPC 366          

HSP 11 Score: 57.7658 bits (138), Expect = 1.482e-8
Identity = 52/195 (26.67%), Postives = 80/195 (41.03%), Query Frame = 1
Query: 2059 TRPPGIMEESLPDTIFPKDCNNCTCR---QGKW---ICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVY-GGNDCQGSNTTDEICYAAT---QCCEINVAYSLKNSYCEQTCDDVINRLH---PTHVCEEGCRCQPGY-VRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKM 2601
            +RP G+ ++    T  P   N   C     G W    C T++C+ D  WS W   +PC+  CG G     R         GG  C G      +C       + C   +  S   + C ++C D+        P H C+ GC C  G  +   +  CVPT +C   +++G  W  G ++   +SC    CS G++
Sbjct: 1556 SRPCGVGQQQRMRTYNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADLQQGFACVDPEH-CQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRI 1749          

HSP 12 Score: 56.9954 bits (136), Expect = 2.745e-8
Identity = 47/155 (30.32%), Postives = 63/155 (40.65%), Query Frame = 1
Query: 2137 QGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDE-----ICYAATQCCEINVAYSLKN------SYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTN 2565
             G   C    C  + QW  W   SPC+V CG G++  +RT  A     GG  C G     E      C   + C    V  S ++        C  TCD +         C EGCRC+PG     +  CV   EC +C V+G +++ GQ     N
Sbjct:  139 MGSRACFMQACPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCVEGCRCKPGLYLK-SGRCVEAGEC-QCRVDGRVYKPGQVFSTAN 291          
BLAST of Subcommissural organ spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000917.1 (pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000917.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.605 bits (257), Expect = 1.865e-22
Identity = 202/790 (25.57%), Postives = 302/790 (38.23%), Query Frame = 1
Query:   94 TEWSDWSLCNASC-GYGSSVRSRNCSTTENEHDSCYSSDCHCDVLF---SDVKFKIHRDI--IDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCF-------------EDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGY-VEDMLGNCVLSDTC-----------CDKSQVNCKPCETGVCENGQAVCI--PNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICID-PCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGI--ITQVRDLLIPSINTNAKECETNRTVPCQLD--CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTK-TPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGD--LSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLL----GTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQD---CQWSDWKIVSPC---NVTCGKGVQKLERTVAQVAV 2274
            + WS W  C+ +C G G   R+R CS     H     +    D+ +    D + +   D     +W        +S       D +  A    V F   +  C   S                 ED +C  DC W+ W+ WS CS  C    + R R     P   G +C     GN E+  C NT +C+    WS WS W  C + CGGG + + R        N G     D   VTV CN   C  E   P      +   C N  CPR+C D L  G +C +   C  GC C  G  + +  G CV +  C              S+ +   C    C +G+  C   P  +  C+W+ W  WS C+  C    +TR R++ T       S C G  + +KPC++  C         + Y     +     C++C C       CQ    D + D  W  W+ WS C+ +C  G + R R CI+ P  +  T C GP +E + C                    A C     V  G+  + + R   + S N+N++EC   R     L+  C  +  ++ +      +   A+  +   + GH   T+ TP  +   V  G                  C  P     C +PC Q CG   L  +C   +C+  C CP  +LEQ+G CV  +EC C    +LL    G++P  I     P +     C  C C  G+  C+ + CQ       WS+W    PC   ++  G  ++   R + + ++
Sbjct: 1593 SSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRGERSADTEGFGSWTP------WSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPCGVGQQQRMRT-YNPPLGNGSWCPDIIAGNWEVRFC-NTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTV-CNTQPCDGEGCPP----EMLLSDCGN-RCPRSCAD-LQQGFACVDPEHCQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRIECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQGERSQVKPCDLGSCPPLCRHGNWERYLGDVWLEGE--CEQCQCTPEGSF-CQ--VIDCRVDGGWTPWAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECA------------------TAPC----PVHDGVVDVNKWRLGTMESNNSNSRECGEIRRGGANLNGMCRNEYLMIDFLVKLSNREPLASTAE---AAGHRKSTQETPLSLPLPVPEG-----------------VCPEPLVFDPCGSPCSQYCGGRTLGTECVQ-ECVPGCYCPQGLLEQNGTCVDGAECGCV---HLLTEAEGSKP--IPSLIAPGSRVTVGCLECLCEDGQLHCSNDSCQGAGVLGAWSEWTTCRPCVPPSILVGGHLRPFLRPLHEGSL 2314          

HSP 2 Score: 83.1889 bits (204), Expect = 3.293e-16
Identity = 123/438 (28.08%), Postives = 158/438 (36.07%), Query Frame = 1
Query:   85 VVCTEWSDWSLCNASCGYGSSVRSRNCST-TENEHDSCYSSDCHCDVLF---SDVKFKIHRDIIDAWVELDDIIGFSSL-------------------MELIE-----DGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYG-GKFCEPNGNEEIDDCPNTCICE--WSPWSHWTECSQNC-GGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCH-NVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETG------------------VCENGQAVCIPNDNC--DCSWNQWQDWSPCNRVCG------------PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVP 1191
             V  EW  WS C+ASCG G  VRSR C T    + +SC +  C    L      V    H D      +L   + FS                     + + E      G        +   C KC C +G        +C  D  WS WS W+ CS  C    + R R   + P  G G+ C   G+EE     + C  +  WS WS W ECS++C GGG  ++ R         G D      + T  C+   C        CS        H    CPRTCDDV     SCE       GC+C  G + +  G       C DK    C    TG                   C +G  VC  N  C  D  W +W  W+PC+R CG            P  +         QRG+    VG   + KPCN+ P
Sbjct:  800 AVWGEWEAWSGCSASCGGGVRVRSRTCPTPAPPDMESCGTESCDGQTLSCPEGKVWRLCHADEPITCADLGRDLTFSGRECHPGCYCPNGTLLLNQTCVRISECPCFVGGSVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQECHAEPCPDRN----CSEVAGSYYSHCGPPCPRTCDDVSFCSWSCE------PGCYCTDGRLMNGEGK-----ACVDKQDCTCLDINTGRRHPPGDTVPHADGCNNCTCMHGALVCT-NQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFP 1221          

HSP 3 Score: 82.0333 bits (201), Expect = 6.529e-16
Identity = 99/362 (27.35%), Postives = 128/362 (35.36%), Query Frame = 1
Query: 1249 PSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNML--EQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKD-CNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA-QVAVYGGNDCQGSNTTDE 2316
            P  + C +C C       C   S D   D  W++WS W+ CS  C  G + R R C +P      R C GP  E   C    C  D     W+    C+  C GG     G+ ++ R    P+       CE                                        G G+ T+               E   EPC   NCS+  VA      C  PC + C D+S    +  C   C C D  L   +   CV K +C C  + N     PPG       DT+   D CNNCTC  G  +CT   C  D  W +W   +PC+ TCG       RT A  +   GG  C G+    E
Sbjct:  917 PIQIGCTKCTCENGEAARC--VSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTQDGAWSGWSRWAECSRSCGGG-----GLRSRARACDAPAPGGGGDYCE----------------------------------------GPGVDTQ---------------ECHAEPCPDRNCSE--VAGSYYSHCGPPCPRTCDDVSF--CSWSCEPGCYCTDGRLMNGEGKACVDKQDCTCL-DINTGRRHPPG-------DTVPHADGCNNCTCMHGALVCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHE 1204          

HSP 4 Score: 69.707 bits (169), Expect = 4.085e-12
Identity = 46/147 (31.29%), Postives = 66/147 (44.90%), Query Frame = 1
Query: 1888 LLSCVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
            L +C N C + C DL +  +C    C E C CP+  L QD  CV  ++CRC       G   P   +E  P  +   DCN C C +G ++CT ++C +   WS W     C+ +CG G +   R     +    + C G     E C
Sbjct: 2444 LSTCANQCPRSCSDLWEHVECLQGSCREGCRCPEGWLLQDRACVPVAQCRC-------GLPSPNASQEYRPGEVVRVDCNECVCVKGTFVCTEHVCPELGPWSAW---GECSRSCGGGTRARHRDCPDASAP--HACPGEPQQSEAC 2578          

HSP 5 Score: 69.3218 bits (168), Expect = 4.483e-12
Identity = 76/296 (25.68%), Postives = 116/296 (39.19%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGM-VTKTPQEIVKAVNGGKNCE---VTYEPCYLGNCSQ-SCVAPKQLL--------SCVNPCEQRCGDLSKKCT-NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFP-KDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGN-DCQGSNTTDEICYAA 2331
            +DCV+  WT  + C+  C        G++ + RD+L       +       +  C +  CPV+ +   +          ++ + CD  CG GM V +         NGG+ C    V  E C +  C++ S   P  +           V PC   C  L K       C+E C C   +  + G+CV   EC+C  +  +             P  +F   +C+NC+CR G   C  + C   C WS W   +PC+  C  G Q+  R+    A  GG   C G +T    C A 
Sbjct:  248 LDCVVSPWTEWSQCSRSC------GLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVEGQWGAW----------SSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCVEGCRCKPGLYLKSGRCVEAGECQCRVDGRVY-----------KPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAG 516          

HSP 6 Score: 65.4698 bits (158), Expect = 8.249e-11
Identity = 103/373 (27.61%), Postives = 143/373 (38.34%), Query Frame = 1
Query:  421 CKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPN-YGGKFCEPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT-PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNC----------KPCETG----VCENGQAV-CIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNC-PNGTRSRDRICIDPCEDLST-RCVGPRIETEPC 1479
            C  DC WS W+ WS C+  CD  ++ R R     P  +GG+ C     E        C   W  W  W+ CS +CGGG   ++RT P  +  D+ S        C   SC  +T +  C   KV   CH    P TC D+  G        +C  GC+C  G +       +L+ TC   S+  C           P + G     CENG+A  C+  D + D +W+ W  W+PC+  CG                     +G     + C   P          +    G P       +E  CN  A  +          D  W+ WS W+ CS +C   G RSR R C  P        C GP ++T+ C
Sbjct:  741 CPLDCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPCKAVWGEWEAWSGCSASCGGGVRVRSRTCPTPAPPDMES--------CGTESCDGQTLS--CPEGKVWRLCHADE-PITCADL--GRDLTFSGRECHPGCYCPNGTL-------LLNQTCVRISECPCFVGGSVYLPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCG---------------------LGVQRRYRFCTEPP-------PAGEGRDCGGP-----GSEERVCNTHACTQ----------DGAWSGWSRWAECSRSCGGGGLRSRARACDAPAPGGGGDYCEGPGVDTQEC 1050          

HSP 7 Score: 65.0846 bits (157), Expect = 1.002e-10
Identity = 82/326 (25.15%), Postives = 120/326 (36.81%), Query Frame = 1
Query: 1465 ETEPCIMT--------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECE--TNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTK-----TPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT--NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWI-CTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYG-GNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCE 2385
             + PC ++        C +DC   +WT  + C   C        G   + R    P      + C         C L   + CK +  E  E    CSA       SCG G+  +     TP        G ++C+     C  G   + C A + +          C DL +  T    +C   C CP+  L  +  CV  SEC C    ++            LP +     C  CTC  G+   C +  C  D  WSDW   +PC+  CG GVQ+  R   +    G G DC G  + + +C   T  C  + A+S  + + E
Sbjct:  725 HSRPCFLSGPVAIAPCCPLDCGWSEWTAWSLCTKTC------DVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGL---LPCKAVWGEW-EAWSGCSA-------SCGGGVRVRSRTCPTPAPPDMESCGTESCDGQTLSCPEGKVWRLCHADEPIT---------CADLGRDLTFSGRECHPGCYCPNGTLLLNQTCVRISECPCFVGGSVY-----------LPRSPIQIGCTKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCN--THACTQDGAWSGWSRWAE 1011          

HSP 8 Score: 63.929 bits (154), Expect = 2.196e-10
Identity = 120/425 (28.24%), Postives = 161/425 (37.88%), Query Frame = 1
Query:  376 CLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHN------VTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC-CDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGP-SXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNC---PN--GTRSRDRIC---------IDPC--EDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNE 1527
            CL  S  LDC        DC  S W+EWS+CS  C      R R ++++   GG             +  CP     +W  WS W+ C   CGGG   + RT    P  +G    +   +    CN   C   +    C  + V ++  +        CP TCD  LD    C     CV GC C PG Y++   G CV +  C C       KP        C    C +G   C P+     C W+ W  W+PC+R C   S +     TN    G G  CVG +T+++ CN  PC                  P + A               P    +     W +WSAWS C+  C   P   GTR+R R C          DPC  ED  T   G R    PC +  K    + +W+N+
Sbjct:  238 CLDGSDELDCL-------DCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVEG--QWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSD---CGPDMVFVSAEDCKRRTVEPCPLTCDH-LDKSPDCR--VPCVEGCRCKPGLYLKS--GRCVEAGECQCRVDGRVYKPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPC------------------PGDEA---------------PEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRCNATAVDDVTGDPCPEEDAQTELCGVR----PCPVKKKTSFFV-EWSNK 607          

HSP 9 Score: 57.7658 bits (138), Expect = 1.666e-8
Identity = 52/195 (26.67%), Postives = 80/195 (41.03%), Query Frame = 1
Query: 2059 TRPPGIMEESLPDTIFPKDCNNCTCR---QGKW---ICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVY-GGNDCQGSNTTDEICYAAT---QCCEINVAYSLKNSYCEQTCDDVINRLH---PTHVCEEGCRCQPGY-VRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKM 2601
            +RP G+ ++    T  P   N   C     G W    C T++C+ D  WS W   +PC+  CG G     R         GG  C G      +C       + C   +  S   + C ++C D+        P H C+ GC C  G  +   +  CVPT +C   +++G  W  G ++   +SC    CS G++
Sbjct: 1731 SRPCGVGQQQRMRTYNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADLQQGFACVDPEH-CQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRI 1924          

HSP 10 Score: 57.3806 bits (137), Expect = 2.354e-8
Identity = 47/155 (30.32%), Postives = 63/155 (40.65%), Query Frame = 1
Query: 2137 QGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDE-----ICYAATQCCEINVAYSLKN------SYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTN 2565
             G   C    C  + QW  W   SPC+V CG G++  +RT  A     GG  C G     E      C   + C    V  S ++        C  TCD +         C EGCRC+PG     +  CV   EC +C V+G +++ GQ     N
Sbjct:  291 MGSRACFMQACPVEGQWGAWSSWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCVEGCRCKPGLYLK-SGRCVEAGEC-QCRVDGRVYKPGQVFSTAN 443          

HSP 11 Score: 54.6842 bits (130), Expect = 1.283e-7
Identity = 90/341 (26.39%), Postives = 125/341 (36.66%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDP------CEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDN--MLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQ-DCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGND-CQGSNTTDEIC 2322
            D +WN W+AWS CS  C  G + R R    P      C D+    +    E   C    CKVD     W+    C+  C GG S+      +VR    P      + C  ++                Y+ + C      N   CD   G G     P E++ +  G +             C +SC   +Q  +CV+P                C   C+CPD   +LEQDG+CV   +C CT  D       PG    SL        C +CTC  G+  C    C    C WS W   S C+ +C  G +   R+       G +  CQG  +  + C
Sbjct: 1718 DCSWNAWTAWSTCSRPCGVGQQQRMRTYNPPLGNGSWCPDI----IAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSL------RVRACTNPPRKNGGQPCPGDK----------------YQVTVC------NTQPCD---GEGC----PPEMLLSDCGNR-------------CPRSCADLQQGFACVDP--------------EHCQPGCSCPDGIGLLEQDGRCVPTWQCECT--DMSGQAWAPGSSRPSL------SSCADCTCSHGRIECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQGERSQVKPC 1984          

HSP 12 Score: 51.2174 bits (121), Expect = 1.739e-6
Identity = 31/80 (38.75%), Postives = 41/80 (51.25%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSV 1566
            D  W+EW+AWS+C+  C  GTR R R    P      R C G  +E   C ++ CK   V G+W   + C+A C GG  V
Sbjct:  744 DCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPCKA--VWGEWEAWSGCSASCGGGVRV 821          
BLAST of Subcommissural organ spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000912.1 (pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:ENSPMAG00000000814.1 transcript:ENSPMAT00000000912.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 6.410e-17
Identity = 180/712 (25.28%), Postives = 252/712 (35.39%), Query Frame = 1
Query:  316 LIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVI-IKQPNYGGKFCEPNGNEEIDDCPNTCI--CEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITC-HNVTCPRTCDDVLD----GGISCEESSDCVTGCFCNPGY-VEDMLGNCVLSDTCC----DKSQVNC--KPCETGVC-ENGQAVCIPND------------NCDCS----------------WNQWQDWSPCNRVCG--PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPN----GTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT------------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSEC-IKLCSANN--------TQCDPSCGHGMVTKTPQEIVKA------VNGGKNC---EVTYEPCYLGNCSQSCVAPKQLLS-CVNPCEQRCGDLSKKCTNTD---CIESCACPD--NMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQ-DCQWS 2190
            L+  G+TVA        C  C C SG L C E   C+ D  W  W+ WS C+  C +  + R R+     P+ GG+ C     EE +    +C+    WS WS W  CS  CGGG   + R+ L+  C      +  + ACN   C        C  +K+   C  +  CP TC  V       G +CEE   C  G + + G  V++    CVL +       ++S ++   K  + G   ++G AV +  +            NC C+                 + W  W  C+R CG           +    R  G+ C G   DIK C+   C               +P P+NV         +A  E             +  W+ WS CS  C +      ++R R C          C G   +   C +             C VDC    WT  + C+  C        G+  Q R         N   C              D     +E   C   +C  +           CD +CG G   +     V+A       NGG+ C   +     C    C      P+ LLS C N C + C DL +     D   C   C+CPD   +LEQDG+CV   +C CT  D       PG    SL        C +CTC  G+  C    C    C WS
Sbjct: 1360 LVHPGETVA------IRCNNCTCESGQLSCTE-LACRIDGGWGSWTGWSACARSCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKECRARSCVDSWPWSEWSPWANCSVGCGGGEQTRHRSCLHPPC---PGLATHSKACNTHVCQASAG---CPADKLFRECVQDEECPYTCAHVRGEAECRGETCEEGCHCPVGTWLHQGRCVQEC--PCVLDEATAVLLWEQSALSAAEKAADQGALRDDGTAVFLGQEIPSGASITHECSNCTCAHGNLRCAARPCPVDGRLSSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRAAYT----------TPSPANVTIAPMPGVRSADTE------------GFGSWTPWSPCSRTCSDPELPALKTRVRFCAP-----RATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPC--------GVGQQQRMRTYNPPLGNGSWCP-------------DIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLR-----VRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADLQQGFACVDPEHCQPGCSCPDGIGLLEQDGRCVPTWQCECT--DMSGQAWAPGSSRPSL------SSCADCTCSHGRIECAEKPCADGSCAWS 1995          

HSP 2 Score: 72.7886 bits (177), Expect = 4.119e-13
Identity = 208/891 (23.34%), Postives = 312/891 (35.02%), Query Frame = 1
Query:   94 TEWSDWSLCNASCG-YGSSVRSRNCSTTENEHDS------------CYSSDCHCDVLF---SDVKFKIHRDIIDAWVE-LDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCF-------------EDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEP--NGNEEIDDCPNTCICE----WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGY-VEDMLGNCVLSDTC-----------CDKSQVNCKPCETGVCENGQAVCI--PNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQS-CVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICID-PCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQ----------EIVKAVNGGKNCEVTYEPCYLGNCS-QSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDC-------IESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGG--NDCQGSNTTDE--------ICYAATQCCEINVAY-SLKNSYCEQTCDDVINRLH-PTHVCEEGCRCQPGYVRNINNTCVPTSEC 2505
            + WS W  C+ +CG  G   R+R CS     H              C++ DC         ++V       +  A  E       +S       D +  A    V F   +  C   S                 ED +C  DC W+ W+ WS CS  C    + R R     P   G +C     GN E+  C NT +C+    WS WS W  C + CGGG + + R        N G     D   VTV CN   C  E   P      +   C N  CPR+C D L  G +C +   C  GC C  G  + +  G CV +  C              S+ +   C    C +G+  C   P  +  C+W+ W  WS C+  C    +TR R++ T       S C G  + +KPC++  C         + Y     +     C++C C       CQ    D +   +   W+ WS C+ +C  G + R R CI+ P  +  T C GP +E + C       C +  W++ +          +  +   TQ   L +P         E     PC   C   C   T  T EC++ C          C  G++ +              ++    G K       P          C+     L C N   Q  G L      T C       I   A   +   + G+   + +   +W+     T  P + E +  D +                C+ ++C     W  W     C   C  G +  +R     A   G    C G+    E        +C A  +C +   A+ S   + C ++C D+   +      C EGCRC  G++   +  CVP ++C
Sbjct: 1632 SSWSGWERCSRTCGGLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCHTPDCRAAYTTPSPANVTIAPMPGVRSADTEGFGSWTPWSPCSRTCSDPELPALKTRVRFCAPRATCRGESYQEHLCNLPQCDAPVSCEDGDCSVDCSWNAWTAWSTCSRPCGVGQQQRMRTY-NPPLGNGSWCPDIIAGNWEVRFC-NTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTV-CNTQPCDGEGCPP----EMLLSDCGN-RCPRSCAD-LQQGFACVDPEHCQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRIECAEKPCADGSCAWSVWSAWSSCSASCDSGTRTRFRSSITSGSEGASSTCQGERSQVKPCDLGSCPPLCRHGNWERYLGDVWLEGE--CEQCQCTPEGSF-CQ--VIDCRDYEHCFYWAPWSDCTTSCGTGKQIRTRACINPPPRNNGTACQGPSLENQECAT---APCPVISWSSLSNREPLASTAEAAGHRKSTQETPLSLPLPVPEGVCPEPLVFDPCGSPCSQYCGGRTLGT-ECVQECVPGCY-----CPQGLLEQNGTCVDGAECGCVHLLTEAEGSKPIPSLIAPGSRVTVGCLECLCEDGQLHCSNDSCQGAGVLGAWSEWTTCRPCVPPSILGSAPSSHASSRSGKAAYRPQMGRSWDPAETCTA-PAMEERTCADAV---------------ACSDDVC----VWGAWGPWGGCREPCSGGFRVRQRAPLAPADPTGPRARCHGARLQSESCNTATCPVCAAGERCEDRGKAFLSTCANQCPRSCSDLWEHVECLQGSCREGCRCPEGWLLQ-DRACVPVAQC 2478          

HSP 3 Score: 72.4034 bits (176), Expect = 6.554e-13
Identity = 108/410 (26.34%), Postives = 145/410 (35.37%), Query Frame = 1
Query: 1201 CIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKP---DANWNEWSAWSICSGNCPNGTRSRDRICI--------DPCEDLST----RCVGPRIETEPC--IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCT----NTDCIESCACP-DNMLEQDG-QCVSKSECRCTWNDNLLGT--------RPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVY-GGNDCQGSNTTDEICYAAT 2334
            C+D  T + +P G  +P    C  C C   A          N+P   D  W EWS W+ CS  C + T SR R C          PC         R VG ++E +PC     C  D   G W++ +A        ++ A G   + R+   P+      ECE N TV                     + C  + + C P C  G V                                      +L C  PC + C DL           +C  +CACP D +L +DG  CV  S C C +               RP  I+    P       CNNCTC  G+  CT   C+ D  W  W   S C  +CG GVQ   R     A + GG  C G +  ++ C A +
Sbjct: 1109 CLDINTGRRHPPGDTVPHADGCNNCTCMHGAL------VCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHEHRDVGVQLEAKPCNLFPFCPTDGGWGFWSSWSA-------CDACAGGAAVRTRECNSPTPRFGGAECEGNSTV--------------------SRPCQGDPSSC-PDCPEGQV--------------------------------------VLPCGKPCPRSCEDLRSGVLCVEPPAECRPACACPGDLVLREDGTACVPPSRCPCRYRPPRPPHSHGRDRECRPAWILVH--PGETVAIRCNNCTCESGQLSCTELACRIDGGWGSWTGWSACARSCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKECRARS 1444          

HSP 4 Score: 67.781 bits (164), Expect = 1.440e-11
Identity = 50/188 (26.60%), Postives = 70/188 (37.23%), Query Frame = 1
Query: 1888 LLSCVNPCEQRCGDLSK--KCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNIC---------------------------------------------------QQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDC 2292
            L +C N C + C DL +  +C    C E C CP+  L QD  CV  ++CRC       G   P   +E  P  +   DCN C C +G ++CT ++C                                                   + DC   DW   S C+ +CG GV    R+V   A +GG +C
Sbjct: 2430 LSTCANQCPRSCSDLWEHVECLQGSCREGCRCPEGWLLQDRACVPVAQCRC-------GLPSPNASQEYRPGEVVRVDCNECVCVKGTFVCTEHVCPELGPWSAWGECSRSCGGGTRARHRDCPDASAPHACPGEPQQSEACSPQPCRADCVLGDWAAWSSCSASCGGGVSSRNRSVVTAAAFGGAEC 2610          

HSP 5 Score: 67.3958 bits (163), Expect = 1.705e-11
Identity = 76/296 (25.68%), Postives = 113/296 (38.18%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGM-VTKTPQEIVKAVNGGKNCE---VTYEPCYLGNCSQ-SCVAPKQLL--------SCVNPCEQRCGDLSKKCT-NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFP-KDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGN-DCQGSNTTDEICYAA 2331
            +DCV+  WT  + C+  C        G++ + RD+L       +       +  C +  CPV+ +   +             + CD  CG GM V +         NGG+ C    V  E C +  C++ S   P  +           V PC   C  L K       C E C C   +  + G+CV   EC+C  +  +             P  +F   +C+NC+CR G   C  + C   C WS W   +PC+  C  G Q+  R+    A  GG   C G +T    C A 
Sbjct:  305 LDCVVSPWTEWSQCSRSC------GLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVEGQWGAWSAW----------SPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCAEGCRCKPGLYLKSGRCVEAGECQCRVDGRVY-----------KPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAG 573          

HSP 6 Score: 65.4698 bits (158), Expect = 7.282e-11
Identity = 116/459 (25.27%), Postives = 157/459 (34.20%), Query Frame = 1
Query: 1033 DCSWNQWQDWSPCNRVCG-PSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRIC---IDPCEDLSTRCVGPRI-----ETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKL-CSANN--------TQCDPSCGHGMV------TKTPQEIVKAVNGGKNCEVTY---EPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLE--QDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKD-CNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA-QVAVYGGNDCQGSNTTDE 2316
            DC W++W  WS C + C   + +     T+      G+ C G   ++  C ++PC                                               A W EW AWS CS +C  G R R R C     P    +  C   ++       EP  +TC  D       +   C+  C   N       T VR    P     +     +   P Q+ C   C     E + C+ + C  +         T C   CG G+       T+ P        GG   E        C   NCS+  VA      C  PC + C D+S    +  C   C C D  L   +   CV K +C C  + N     PPG       DT+   D CNNCTC  G  +CT   C  D  W +W   +PC+ TCG       RT A  +   GG  C G+    E
Sbjct:  804 DCGWSEWTAWSLCTKTCDVGTRRRFRSATHPPAAFGGRGCSGLPVEVAYCGLLPC----------------------------------------------KAVWGEWEAWSGCSASCGGGVRVRSRTCPTPAPPPHGQTLSCPEGKVWRLCHADEP--ITC-ADLGRDLTFSGRECHPGCYCPNGTLLLNQTCVRISECPCFVGGSVYLPRS---PIQIGC-TKCTCENGEAARCVSVDCDVDGAWSDWSPWTPCSAPCGLGVQRRYRFCTEPPPAGEGRDCGGPGSEERVCNTHACTHRNCSE--VAGSYYSHCGPPCPRTCDDVSF--CSWSCEPGCYCTDGRLMNGEGKACVDKQDCTCL-DINTGRRHPPG-------DTVPHADGCNNCTCMHGALVCTNQPCPVDGGWCEWSPWTPCSRTCGSETASRYRTCACPLPRDGGAPCAGAQRGHE 1197          

HSP 7 Score: 61.2326 bits (147), Expect = 1.532e-9
Identity = 117/415 (28.19%), Postives = 154/415 (37.11%), Query Frame = 1
Query:  376 CLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHN------VTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC-CDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGP-SXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNC---PN--GTRSRDRIC---------IDPC--EDLSTRCVGPRIETEPCIMTCKV 1497
            CL  S  LDC        DC  S W+EWS+CS  C      R R ++++   GG             +  CP     +W  WS W+ C   CGGG   + RT    P  +G    +   +    CN   C   +    C  + V ++  +        CP TCD  LD    C     C  GC C PG Y++   G CV +  C C       KP        C    C +G   C P+     C W+ W  W+PC+R C   S +     TN    G G  CVG +T+++ CN  PC                  P + A               P    +     W +WSAWS C+  C   P   GTR+R R C          DPC  ED  T   G R    PC   C+ 
Sbjct:  295 CLDGSDELDCL-------DCVVSPWTEWSQCSRSCGLGVMFRQRDVLREEQTGGSCNRTLMGSRACFMQACPVEG--QWGAWSAWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSD---CGPDMVFVSAEDCKRRTVEPCPLTCDH-LDKSPDCR--VPCAEGCRCKPGLYLKS--GRCVEAGECQCRVDGRVYKPGQVFSTANCSNCSCRDGTVECEPSSCPVHCGWSAWSPWTPCDRPCRTGSQERYRSPTNPAASGGGAPCVGDSTELRDCNAGPC------------------PGDEA---------------PEEGGDGDRGGWGQWSAWSRCTRTCFYSPERVGTRARHRRCNATAVDDVTGDPCPEEDAQTELCGVR----PCPDICRA 655          

HSP 8 Score: 60.8474 bits (146), Expect = 1.724e-9
Identity = 84/339 (24.78%), Postives = 124/339 (36.58%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIMTCKVDC-VMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIP---SINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVA---QVAVYGGNDCQGSNTTDEICY 2325
            D  W  W+ WS C+ +C +G + R R+C  P      R C GP  E + C     VD     +W+    C+  C GG        T+ R  L P    + T++K C T+        CP D K+      EC++     + +C  +C H  V    +   +    G +C V     + G C Q C       + V   EQ     ++K  +             L  DG  V             LG       +E         +C+NCTC  G   C    C  D + S W     C+ TCG G+ ++ RT         +GG  C G     + C+
Sbjct: 1391 DGGWGSWTGWSACARSCGDGVQYRYRLCDSPAPHAGGRGCAGPSREEKECRARSCVDSWPWSEWSPWANCSVGCGGGEQ------TRHRSCLHPPCPGLATHSKACNTH-VCQASAGCPAD-KLF----RECVQ-----DEECPYTCAH--VRGEAECRGETCEEGCHCPVGTW-LHQGRCVQECPCVLDEATAVLLWEQSALSAAEKAAD----------QGALRDDGTAV------------FLG-------QEIPSGASITHECSNCTCAHGNLRCAARPCPVDGRLSSWSGWERCSRTCG-GLGRMTRTRTCSEPAPRHGGRPCTGPTMDIKYCH 1679          

HSP 9 Score: 58.5362 bits (140), Expect = 9.561e-9
Identity = 47/155 (30.32%), Postives = 63/155 (40.65%), Query Frame = 1
Query: 2137 QGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDE-----ICYAATQCCEINVAYSLKN------SYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTN 2565
             G   C    C  + QW  W   SPC+V CG G++  +RT  A     GG  C G     E      C   + C    V  S ++        C  TCD +         C EGCRC+PG     +  CV   EC +C V+G +++ GQ     N
Sbjct:  348 MGSRACFMQACPVEGQWGAWSAWSPCDVRCGGGMRVRQRTCSAPPPKNGGRACAGDGVQPERCNVRPCARPSDCGPDMVFVSAEDCKRRTVEPCPLTCDHLDKSPDCRVPCAEGCRCKPGLYLK-SGRCVEAGEC-QCRVDGRVYKPGQVFSTAN 500          

HSP 10 Score: 57.7658 bits (138), Expect = 1.627e-8
Identity = 55/207 (26.57%), Postives = 84/207 (40.58%), Query Frame = 1
Query: 2032 CTWNDNLLGT---RPPGIMEESLPDTIFPKDCNNCTCR---QGKW---ICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVY-GGNDCQGSNTTDEICYAAT---QCCEINVAYSLKNSYCEQTCDDVINRLH---PTHVCEEGCRCQPGY-VRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKM 2601
            C+WN     +   RP G+ ++    T  P   N   C     G W    C T++C+ D  WS W   +PC+  CG G     R         GG  C G      +C       + C   +  S   + C ++C D+        P H C+ GC C  G  +   +  CVPT +C   +++G  W  G ++   +SC    CS G++
Sbjct: 1775 CSWNAWTAWSTCSRPCGVGQQQRMRTYNPPLGNGSWCPDIIAGNWEVRFCNTDVCKVDGGWSSWSPWAPCDRACGGGRSLRVRACTNPPRKNGGQPCPGDKYQVTVCNTQPCDGEGCPPEMLLSDCGNRCPRSCADLQQGFACVDPEH-CQPGCSCPDGIGLLEQDGRCVPTWQCECTDMSGQAWAPGSSRPSLSSCADCTCSHGRI 1980          

HSP 11 Score: 50.8322 bits (120), Expect = 2.044e-6
Identity = 30/72 (41.67%), Postives = 39/72 (54.17%), Query Frame = 1
Query: 1351 WSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNS 1563
            WSAW  CS +C  GTR+R R C D        C G   ++E C    C+ DCV+G W   ++C+A C GG S
Sbjct: 2524 WSAWGECSRSCGGGTRARHRDCPD--ASAPHACPGEPQQSEACSPQPCRADCVLGDWAAWSSCSASCGGGVS 2593          
BLAST of Subcommissural organ spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000072.1 (pep scaffold:Pmarinus_7.0:GL479818:18487:29074:1 gene:ENSPMAG00000000067.1 transcript:ENSPMAT00000000072.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 2.643e-8
Identity = 45/162 (27.78%), Postives = 69/162 (42.59%), Query Frame = 1
Query: 1348 EWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC--IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC 1824
            EWS WS+CS +C  G++ R R+C+      S  C GP  E   C     C V  V G+W+  + C+  C        G+ T++R   +P    ++ E   N+T  C +  CPVD +   +       +   N TQ           +  +E V  + GG  C
Sbjct:    2 EWSEWSVCSSSCGEGSQVRARVCLA--SSKSAACSGPLREIRVCDSSSVCPVHGVWGEWSPWSLCSYTC------GRGLRTRMRHCSVPQHGGSSCEGPYNQTKVCNIALCPVDGQWADWSKWSTCSVTCENGTQ-----------QRSRECVGPIYGGTEC 144          

HSP 2 Score: 51.9878 bits (123), Expect = 1.918e-7
Identity = 64/210 (30.48%), Postives = 88/210 (41.90%), Query Frame = 1
Query:   97 EWSDWSLCNASCGYGSSVRSRNCSTTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDI--------IGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNG--NEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRT---PLNSG 687
            EWS+WS+C++SCG GS VR+R C    ++  +C        V  S     +H      W E             G  + M      Q   S+    +N  K +CN           C  D +W+ WS+WS CS  C+N ++ RSR  +  P YGG  C   G  N   D+ P      W  W+ W ECS  CG G   + R    P + G
Sbjct:    2 EWSEWSVCSSSCGEGSQVRARVC-LASSKSAACSGPLREIRVCDSSSVCPVH----GVWGEWSPWSLCSYTCGRGLRTRMRHCSVPQHGGSSCEGPYNQTK-VCNIAL--------CPVDGQWADWSKWSTCSVTCENGTQQRSRECVG-PIYGGTECVGPGTENRRCDNNPCPVDGRWGVWAAWGECSATCGSGLRWRQRKCWGPFHGG 196          

HSP 3 Score: 51.2174 bits (121), Expect = 3.593e-7
Identity = 32/76 (42.11%), Postives = 36/76 (47.37%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGG 1557
            D  W +WS WS CS  C NGT+ R R C+ P     T CVGP  E   C    C VD   G W     C+A C  G
Sbjct:  107 DGQWADWSKWSTCSVTCENGTQQRSRECVGPIYG-GTECVGPGTENRRCDNNPCPVDGRWGVWAAWGECSATCGSG 181          

HSP 4 Score: 47.7506 bits (112), Expect = 5.042e-6
Identity = 46/167 (27.54%), Postives = 69/167 (41.32%), Query Frame = 1
Query: 1342 WNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVA----YGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCE 1827
            W EWS WS+CS  C  G R+R R C  P +   + C GP  +T+ C I  C VD     W+  + C+  C  G         G I    + + P   T  + C+ N        CPVD +   +          A   +C  +CG G+  +  ++     +GG  C+
Sbjct:   55 WGEWSPWSLCSYTCGRGLRTRMRHCSVP-QHGGSSCEGPYNQTKVCNIALCPVDGQWADWSKWSTCSVTCENGTQQRSRECVGPIYGGTECVGP--GTENRRCDNN-------PCPVDGRWGVW----------AAWGECSATCGSGLRWRQ-RKCWGPFHGGLLCQ 200          
BLAST of Subcommissural organ spondin vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008652.1 (pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1 gene:ENSPMAG00000007836.1 transcript:ENSPMAT00000008652.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 52.373 bits (124), Expect = 5.317e-7
Identity = 43/138 (31.16%), Postives = 63/138 (45.65%), Query Frame = 1
Query: 1849 LGNCSQSCVAPKQLLSCVNPCEQRCGDLSK-KCTNTDCIESCACPDNML-EQDG-QCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWIC--------TTNICQQDCQWSDWKIVSPCNVTCG 2229
            L +C+ +C        C + C   C  LS  +  + +C E C CPD +L + DG  CV +S+C+C+++                P +I    C NCTC  G W C         + +C ++ QWS  K  S C VTCG
Sbjct:  161 LLDCTVTCPGDMVYQQCASSCRSTCASLSNIEDCHEECAEGCNCPDGLLLDFDGLSCVDQSQCKCSYSST-----------NYAPGSILQMGCKNCTCEYGGWSCWSSEGCVDDSGLCPENMQWSPCK--SSCPVTCG 285          
BLAST of Subcommissural organ spondin vs. Ensembl Nematostella
Match: EDO41854 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A9])

HSP 1 Score: 62.3882 bits (150), Expect = 6.952e-11
Identity = 50/156 (32.05%), Postives = 68/156 (43.59%), Query Frame = 1
Query: 1336 ANWNEWSAWSICSGNCPNGTRSRDRICIDPCED-LSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECE----TNRTVPCQLD-CPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKT 1782
              +++WS WS CS +C  G R R R+C +P    L   C G   E E C +  C VD    +W+  + C+  C G      G+ T+ RD   P      KECE       T  C  + CPVD     Y       LC AN+     +CG G  ++T
Sbjct:   33 GGFSQWSGWSQCSESCGQGERGRTRVCNNPVPGRLGKHCAGNPREVEKCFLRHCPVDGRYTEWSEYSECDKSCGG------GVRTRSRDCQNPPAQHGGKECEHGFTQKETTSCNPNPCPVD---GGYSRWTNFGLCVANSG----NCGAGKRSRT 175          
BLAST of Subcommissural organ spondin vs. Ensembl Nematostella
Match: EDO31173 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYQ3])

HSP 1 Score: 58.151 bits (139), Expect = 3.861e-10
Identity = 32/77 (41.56%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPC-EDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGG 1557
            D +W  W+AWS CS  C +GT++R R+C DP  ++  + CVG   +T+ C I T  VD   G WT  +AC+  C  G
Sbjct:    2 DGHWGRWTAWSACSKTCGDGTQTRTRVCDDPAPKNGGSACVGDSSQTQACKIATSPVDGHWGSWTAWSACSKTCGDG 78          
BLAST of Subcommissural organ spondin vs. Ensembl Nematostella
Match: EDO47421 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RM08])

HSP 1 Score: 56.9954 bits (136), Expect = 8.076e-10
Identity = 31/80 (38.75%), Postives = 45/80 (56.25%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPC-EDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSV 1566
            D +W  WS WS CS  C +GT++R R+C DP  ++  + CVG   + + C I T  VD   G+W++  AC+  C  G  V
Sbjct:    1 DGHWGRWSVWSACSQTCGDGTQTRTRVCDDPAPKNGGSACVGDSSQAQVCKIATSPVDGHWGRWSSWGACSKSCGDGTHV 80          
BLAST of Subcommissural organ spondin vs. Ensembl Nematostella
Match: EDO48831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIN8])

HSP 1 Score: 55.4546 bits (132), Expect = 5.915e-8
Identity = 93/384 (24.22%), Postives = 136/384 (35.42%), Query Frame = 1
Query: 1336 ANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLD---CPVDCKVLTYET-------SECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNC--------EVTYEPCYLGNCSQSCV---------------APKQLLSCVNPCEQRCG-DLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCN-NCTCRQGK-WICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQ-VAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNS 2376
             N+  W  WS CS  C  GTR R R C +P       C G   E+E C +T     +  +W+    CNA C        G   ++R +   S    +  C+ + TV  + D   CP       Y         S C + C A       +C     TK P     A  GG NC        E   +PC +G  + +                    ++ +C NP     G + S     T   E+  CPD+ L  DG     ++    W            M         P +   NC+    +   C+   C  D  W++W   S CN  CG G +   R  +    +YGG DC+G +   + C  +   C   VA   K++
Sbjct:    7 GNYTTWGEWSACSVTCGTGTRMRMRNCTNPAPLYGDSCHGDDKESESCSVTPSCKGIFSEWSRWGPCNATC--------GPGVKMRTMNFTSF--ASPHCQGSLTVVRKCDNLCCPDHNDTTGYTVWSAWGPWSTCTRTCGAGTQWRMRTC-----TKPP-----AAYGGLNCSGPANQTQECETQPCPVGPVNGNFTEWTKWTTCTRTCGTGTQWRMRTCTNPAPANGGLNCSGPANQTQECETQLCPDSPL--DGNFTEWTK----WTTCTRTCGTGAQMRMRTCTNPAPANGGLNCSGPANQTQECSKQPCPVDGNWTEWSTWSYCNRPCGTGYENRSRFCSNPPPMYGGKDCKGEDHQAKTCNKSI--CPGKVASKRKHT 362          
BLAST of Subcommissural organ spondin vs. Ensembl Nematostella
Match: EDO26284 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCE9])

HSP 1 Score: 49.6766 bits (117), Expect = 2.504e-7
Identity = 34/115 (29.57%), Postives = 53/115 (46.09%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRT--VPCQL 1665
            D  +++W+ W+ C+ +C  G RSR R C  P  +L  + CVGP  +T  C    C V+     WT   +C+A C        G+ ++ R    P        CE + T   PC++
Sbjct:    1 DGEFSDWTEWTKCTSSCGKGVRSRSRSCTAPAPELGGKPCVGPTEQTMACDYGDCPVNGTWSPWTGWQSCSATC------GDGVQSRTRTCNFPQDANPGSMCEGDDTEQKPCKI 109          
BLAST of Subcommissural organ spondin vs. Ensembl Medaka
Match: scospondin (SCO-spondin [Source:NCBI gene;Acc:101172449])

HSP 1 Score: 92.4337 bits (228), Expect = 2.258e-18
Identity = 154/618 (24.92%), Postives = 227/618 (36.73%), Query Frame = 1
Query:  601 WSPWSHWTECSQNCGGGTTNKTR---TPLNSGCDLSSDTSIVTVACNEFSCTTETSTPIC-SGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQ-------VNCKPCETGVCENGQAVC-IPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQ----PSSDDNKPDANWNEWSAWSICSGNCPN----GTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-------CKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSEC-IKLCSANN--------TQCDPSCGHGMVTKTPQ-EIVKAVNGGKNCEV---TYEPCYLGNC-SQSCVAPKQLLSCVNPCEQRCGDLSKKCT---NTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEIC 2322
            W  W+ W++CS +CGGG  ++ R   +P   G    S T  + V C +  C        C  G     +C  V+    C    DG   CEE   C    + + G     L  C   + C  +S         +C  C +G CE+G+  C +     D   + W  WS C+  CG                     VG  T  + C                     P P++   ++C         CQ    P S      + ++ WS WS C+  C +      +SR R C+ P       C G   + +PC +           +C   +W   + C+  C        G   ++R    P   TN   CE             D      E   C I+ C  N         ++CD  CG G   +T         NGG+ CE      +PC    C  + C A ++   C + C QRC DL +      +T+C   C CP   L+QDG CV   +C C   D+       G   +         DCNNC+C  GK +C+ + CQ  C WS W   + C+V+CG+G +   R++  V    G DC       ++C
Sbjct: 3020 WGQWA-WSQCSVSCGGGQQSRFRLCSSPPCHGLSHQSKTCNIQV-CLDVGCPPGRLYRECERGEGCPFSCAQVSGREGCYS--DG---CEEGCHCPLETYQHRGLC---LSVCPPGEPCGRRSSGLLPWGVSDCPSCSSG-CEHGRWNCSLEYCPIDGGLSPWGPWSSCSLSCGG--------------------VGVTTRSRGCT-------------------QPSPAHGG-RDCQGPLQETTYCQAPDCPGSALLLLYSGFSPWSTWSPCTKTCTDVQSPAVKSRHRSCVRP------PCSGNSHQDKPCNLPQCPGAECAGRNCTWTEWGEWSLCSRSC------GVGQQQRIRTYFHP--GTNGSWCE-------------DIIGGNLENRFCNIRPCRVNGGWSRWSPWSRCDKLCGGGRSIRTRSCSSPPPKNGGQKCEGEKNQIKPCNTKPCEGKRCPASQEFDPCASQCPQRCSDLQQGLQCQGDTECQPGCRCPKGQLQQDGLCVEVWQCDCV--DSAGQIWAAGSWHQV--------DCNNCSCSDGKLLCSNHSCQSACVWSSWSSWAQCSVSCGQGQRTRYRSL--VPETEGVDCNFEEVQHKLC 3547          

HSP 2 Score: 78.9518 bits (193), Expect = 2.830e-14
Identity = 139/516 (26.94%), Postives = 197/516 (38.18%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNCSTTENEH--DSCY-----SSDCH---CDVLFSDVKFKIHR----------DIIDAWVELDDI--------IGF----SSLMELIE-----DGQTVASNITVFFN-CAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQP-NYGGKFCEPNGNEEIDDCP-NTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTP---ICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPG-YVEDMLGNCVLSDTC-CDKSQVNCKP-------CETGVCENGQAVCIPNDNC-DCSWNQWQDWSPCNRVCGPSXXXXXXX-XXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDP--------CEDLSTRCVG 1455
            + WS WS C+  C  G   R R CS+   +H  +SC      + DC+   C     +V F +            D+    V+   +         GF    SS + L +      G+   +  T+  + C  C C +G+++C    +C  DC WS W++WS CS  CD   + R R     P  +GG  CE      ID C    C+    PW+ W+ECS  CGGG   +TR P+         T+    ACN   C     TP    C G            P++C D     I+   SS+C  GC C  G +++D  G CV    C C    V  KP       C    CE G+ V     NC +  W++W  W PC+  CG   Q+R R   +     +G  C+G +   + C + PC                                              D  W++WS W+ C+ +C  G  SR R C +P        CE L T  V 
Sbjct: 2239 SPWSPWSQCSLECDSGVQTRMRVCSSPAPQHGGNSCLGPHIQTKDCNSQPCSGTQHNVSFSLEAQGGACPRVCLDMTSLEVQCATVCYDGCYCAPGFYLFNSSCVPLAQCPCYHMGEVYPAETTLSVDACNNCTCINGTMEC-GSISCSVDCGWSSWTQWSSCSRTCDVGVRRRYRSGTNPPPAFGGHPCE-GPRVGIDTCSIEPCL---EPWTAWSECSVTCGGGYRTRTRGPIR-----IHGTAQQFSACNLQPCAVPGLTPEWKQCVGR-----------PQSCAD-----ITMNLSSNCTPGCQCPHGTFLQD--GMCVPESDCRCHVDGVQYKPGDAVNQNCNNCTCERGRLVQCSQVNCIEGQWSEWTPWGPCSLSCGSGIQSRYRFCASPQSSSSGLPCLGPHRHDQVCILTPC--------------------------------------------NRDGGWSQWSNWTECTKSCGWGITSRRRECDNPIPQGEGNYCEGLGTEVVA 2682          

HSP 3 Score: 78.9518 bits (193), Expect = 2.854e-14
Identity = 72/281 (25.62%), Postives = 120/281 (42.70%), Query Frame = 1
Query: 1483 MTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQV-AVYGGNDCQGSNTTDEIC 2322
            ++C VDC    WT  ++C+  C        G+  + R    P        CE  R             + T     C++  +A  ++C  +CG G  T+T   I   ++G       +  C L  C+   + P+       P  Q C D++    +++C   C CP     QDG CV +S+CRC  +         G+  +  P     ++CNNCTC +G+ +  + +   + QWS+W    PC+++CG G+Q   R  A   +   G  C G +  D++C
Sbjct: 2383 ISCSVDCGWSSWTQWSSCSRTC------DVGVRRRYRSGTNPPPAFGGHPCEGPRV-----------GIDTCSIEPCLEPWTAW-SECSVTCGGGYRTRTRGPI--RIHGTAQ---QFSACNLQPCAVPGLTPEWKQCVGRP--QSCADITMN-LSSNCTPGCQCPHGTFLQDGMCVPESDCRCHVD---------GVQYK--PGDAVNQNCNNCTCERGRLVQCSQVNCIEGQWSEWTPWGPCSLSCGSGIQSRYRFCASPQSSSSGLPCLGPHRHDQVC 2626          

HSP 4 Score: 74.3294 bits (181), Expect = 8.331e-13
Identity = 204/886 (23.02%), Postives = 309/886 (34.88%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNCSTT--ENEHDSCY-----SSDC-------HCDVLFSDVKFKIHRDIIDAWVELDDIIGF----SSLMELIE-------------DGQTVASNITVFF-NCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCI-----------------------------------------------CEWSPWSHWTECSQNCGGGTTNKTR-----TPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGV---------CENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXXXX-XXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDET------SQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGN--------------------CPNGTRSRDRICI--------------DPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNET---ACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNG------GKNCEVTY---EPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQ--CVSKSECRCTWNDNLLGTR-PPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCG-KGVQKLERTVAQVAVYGGNDCQG 2298
            +EWS+WS+C+A CG G S R+RNCS+   +N    CY     S  C       + D+      + +   + ++   L+  +      SS + L E             +G+TV     V   +C  C+C  G + C +   C   C WS WS+WS C   C    + R R  +  P        P  + E   C + C+                                                 WSPWS W++CS  C  G   + R      P + G +      I T  CN   C+              +      CPR C D+    + C  ++ C  GC+C PG+      +CV    C         P ET +         C NG   C     + DC W+ W  WS C+R C    + R R+         G  C G    I  C+I PC+      +         Y + +  P  +       + TAQ   Q S+ + +P A       W  C G                     CP+GT  +D +C+               P + ++  C     E    +   +V+C+ GQW+  T    C+  C        GI ++ R    P  +++   C      P + D      +LT    +      +N T+C  SCG G+ ++  +       G      G   EV     + C +  CS+  V      SC   C + C DL+       C   C C +  +       CV++  C C   D   G R  PG +  +         CNNCTC  G++ CT   C     W +W   + C+ TCG + V +           GG+ C G
Sbjct: 1991 SEWSEWSVCDALCGGGISTRNRNCSSPPPKNGGRDCYGMTLQSQSCNHHPCTNYTDIHRGKPGYMLPFHLFESIPWLNICVSAGCRCSSGLYLQEGRCVNSSQCVCLWNGRTVQPGQVVKRDHCTMCICKDGQVIC-DPSTCLATCSWSAWSQWSPCDVSCGVGLQQRYRSPVNPPGSIRVQLCPGDSTEARSCSSPCVPGTPGNVVYQWSGWSECSKTCFSHVDDVGIRRRFRSCTNCSGIISVHGAWSPWSPWSQCSLECDSGVQTRMRVCSSPAPQHGG-NSCLGPHIQTKDCNSQPCSGTQHN-----VSFSLEAQGGACPRVCLDMTSLEVQC--ATVCYDGCYCAPGFYL-FNSSCVPLAQCPCYHMGEVYPAETTLSVDACNNCTCINGTMECGSISCSVDCGWSSWTQWSSCSRTCDVGVRRRYRSGTNPPPAFGGHPCEGPRVGIDTCSIEPCLEPWTAWSECSVTCGGGYRTRTRGPIRI-------HGTAQ---QFSACNLQPCAVPGLTPEWKQCVGRPQSCADITMNLSSNCTPGCQCPHGTFLQDGMCVPESDCRCHVDGVQYKPGDAVNQNCNNCTCERGRLVQCSQVNCIEGQWSEWTPWGPCSLSC------GSGIQSRYRFCASPQSSSSGLPC----LGPHRHD---QVCILTPCNRDGGWSQWSNWTECTKSCGWGITSRRRECDNPIPQGEGNYCEGLGTEVVACNTDHCPVSPCSE--VPGTAFSSCGPSCPRSCDDLAH--CEWKCEPGCYCSEGKVLSVNATVCVARENCPCL--DLNTGQRLKPGEITRAR------DGCNNCTCVDGRFNCTREACPVSGGWCEWSEWTSCSRTCGAESVSRYRSCSCPEPKAGGDHCPG 2831          

HSP 5 Score: 68.5514 bits (166), Expect = 4.239e-11
Identity = 110/389 (28.28%), Postives = 155/389 (39.85%), Query Frame = 1
Query:  430 DCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDD---CPNTCICE--WSPWSHWTECSQNCGGGTTNKTRT-----PLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVT-GCFCNPG-YVEDMLGNCVLSDTC-CDKSQVNCKP--------CETGVCENGQAVCIPND-NCDCSWNQWQDWSPCNRVCGPSXXXXXXX-XXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQ---------ECFCNF------TAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPC-EDLSTRCVGPRIETEPC 1479
            DC  S W+ WS CS  C   S  R R I++     G      G  + D     P  C     WS WS W+ C   CGGG + + R      P N G D    T + + +CN   CT  T   I  G    +   ++              S    + CV+ GC C+ G Y+++  G CV S  C C  +    +P        C   +C++GQ +C P+     CSW+ W  WSPC+  CG   Q R R+  N       Q C G +T+ + C+  PC+                 P NV  Q          CF +          + C   S        W+ WS WS CS  C +G ++R R+C  P  +     C+GP I+T+ C
Sbjct: 1932 DCIMSPWTAWSSCSVTCGLGSLFRQREILRDALPRGSC----GGAQFDSRACFPQACPVHGHWSEWSEWSVCDALCGGGISTRNRNCSSPPPKNGGRDCYGMT-LQSQSCNHHPCTNYTD--IHRGKPGYMLPFHLF------------ESIPWLNICVSAGCRCSSGLYLQE--GRCVNSSQCVCLWNGRTVQPGQVVKRDHCTMCICKDGQVICDPSTCLATCSWSAWSQWSPCDVSCGVGLQQRYRSPVNPPGSIRVQLCPGDSTEARSCS-SPCV--------------PGTPGNVVYQWSGWSECSKTCFSHVDDVGIRRRFRSCTNCSGIISVHGAWSPWSPWSQCSLECDSGVQTRMRVCSSPAPQHGGNSCLGPHIQTKDC 2284          

HSP 6 Score: 65.0846 bits (157), Expect = 4.568e-10
Identity = 65/271 (23.99%), Postives = 104/271 (38.38%), Query Frame = 1
Query: 1495 VDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLL---IPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQ-EIVKAVNGGKNC--------EVTYEPCY----LGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKD-CNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT 2256
            VDC+M  WT  ++C+  C        G + + R++L   +P  +    + ++    P    CPV      +          +  + CD  CG G+ T+          NGG++C           + PC     +       + P  L              S    N      C C   +  Q+G+CV+ S+C C WN   +            P  +  +D C  C C+ G+ IC  + C   C WS W   SPC+V+CG G+Q+  R+
Sbjct: 1931 VDCIMSPWTAWSSCSVTC------GLGSLFRQREILRDALPRGSCGGAQFDSRACFP--QACPVHGHWSEW----------SEWSVCDALCGGGISTRNRNCSSPPPKNGGRDCYGMTLQSQSCNHHPCTNYTDIHRGKPGYMLPFHLFE------------SIPWLNICVSAGCRCSSGLYLQEGRCVNSSQCVCLWNGRTV-----------QPGQVVKRDHCTMCICKDGQVICDPSTCLATCSWSAWSQWSPCDVSCGVGLQQRYRS 2160          

HSP 7 Score: 60.077 bits (144), Expect = 1.628e-8
Identity = 60/202 (29.70%), Postives = 85/202 (42.08%), Query Frame = 1
Query: 1870 CVAPKQLLSCVNPCEQRCGDLSKKCTNTD---CIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESL-PDTIFPKDCNNCTCRQGKWICTTNI-CQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSL--KNSYCEQTCDDVINRLH-PTHVCEEGCRC 2451
            C+A  Q  +C  PC + C DL       D   C  SC C  + + QDG CV++ EC C +++    T   G+   +L P  +   DC NC+C  G   C +   C  D  W  W   S C+V+CG G Q   R  +    +G +  Q      ++C      C     Y    +   C  +C  V  R    +  CEEGC C
Sbjct: 2914 CIAGHQEWACGKPCPRSCSDLHGDTECLDPPLCARSCGCQGDRVLQDGVCVAREECLCKYHN----TSTNGLDFITLSPGDVITNDCKNCSCEAGFMHCQSFPGCHVDGGWGQWAW-SQCSVSCGGGQQSRFRLCSSPPCHGLSH-QSKTCNIQVCLDVG--CPPGRLYRECERGEGCPFSCAQVSGREGCYSDGCEEGCHC 3107          

HSP 8 Score: 56.225 bits (134), Expect = 2.717e-7
Identity = 107/455 (23.52%), Postives = 163/455 (35.82%), Query Frame = 1
Query: 1339 NWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTR-CVGPRIETEPCIMTCKVDC---VMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPS--INTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLP--DTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERT-VAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYC--------------------------------------------EQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNG 2544
            +W+ WS WS C  +C  G + R R  ++P   +  + C G   E   C   C       V+ QW+  + C ++ C  +    GI  + R     S  I+ +      +    C L+C  D  V T      +++CS+      P+  HG  +     I       + C  T         +Q    P+  L   +        L  +C  T C + C C       +  CV  ++C C              M E  P   T+    CNNCTC  G   C +  C  DC WS W   S C+ TC  GV++  R+       +GG+ C+G     + C +   C E   A+S  +  C                                             Q+C D+   L  +  C  GC+C  G     +  CVP S+C RC V+G  ++ G
Sbjct: 2136 SWSAWSQWSPCDVSCGVGLQQRYRSPVNPPGSIRVQLCPGDSTEARSCSSPCVPGTPGNVVYQWSGWSEC-SKTCFSHVDDVGIRRRFRSCTNCSGIISVHGAWSPWSPWSQCSLEC--DSGVQTR-----MRVCSS------PAPQHGGNSCLGPHIQTKDCNSQPCSGTQHNVSFSLEAQGGACPRVCLDMTS--------LEVQCA-TVCYDGCYCAPGFYLFNSSCVPLAQCPCY------------HMGEVYPAETTLSVDACNNCTCINGTMECGSISCSVDCGWSSWTQWSSCSRTCDVGVRRRYRSGTNPPPAFGGHPCEGPRVGIDTC-SIEPCLEPWTAWSECSVTCGGGYRTRTRGPIRIHGTAQQFSACNLQPCAVPGLTPEWKQCVGRPQSCADITMNL--SSNCTPGCQCPHGTFLQ-DGMCVPESDC-RCHVDGVQYKPG 2550          
BLAST of Subcommissural organ spondin vs. Ensembl Medaka
Match: adgrb1b (adhesion G protein-coupled receptor B1 [Source:NCBI gene;Acc:101171679])

HSP 1 Score: 55.8398 bits (133), Expect = 2.704e-7
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGG 1557
            D  W+EW+ WS+CS  C  G R+R R C  P ++    C GP  +T+ C I  C VD    +W+  TAC++ C  G
Sbjct:  373 DGAWDEWTPWSLCSSTCGRGYRARTRTCKQP-QNGGQPCNGPEKQTKFCNIAVCPVDGSWNEWSAWTACSSTCSNG 447          

HSP 2 Score: 51.6026 bits (122), Expect = 4.999e-6
Identity = 30/76 (39.47%), Postives = 39/76 (51.32%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGG 1557
            D +WNEWSAW+ CS  C NGT  R R C  P     + C G   E+  C +  C VD     W++  +C+  C GG
Sbjct:  428 DGSWNEWSAWTACSSTCSNGTMQRTRECNGPSYG-GSECHGSWKESANCFLKECPVDGRWHSWSSWGSCSKTCGGG 502          
BLAST of Subcommissural organ spondin vs. Ensembl Medaka
Match: adgrb1b (adhesion G protein-coupled receptor B1 [Source:NCBI gene;Acc:101171679])

HSP 1 Score: 55.8398 bits (133), Expect = 2.816e-7
Identity = 30/76 (39.47%), Postives = 42/76 (55.26%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGG 1557
            D  W+EW+ WS+CS  C  G R+R R C  P ++    C GP  +T+ C I  C VD    +W+  TAC++ C  G
Sbjct:  373 DGAWDEWTPWSLCSSTCGRGYRARTRTCKQP-QNGGQPCNGPEKQTKFCNIAVCPVDGSWNEWSAWTACSSTCSNG 447          

HSP 2 Score: 51.6026 bits (122), Expect = 5.477e-6
Identity = 30/76 (39.47%), Postives = 39/76 (51.32%), Query Frame = 1
Query: 1333 DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMT-CKVDCVMGQWTNETACNAQCCGG 1557
            D +WNEWSAW+ CS  C NGT  R R C  P     + C G   E+  C +  C VD     W++  +C+  C GG
Sbjct:  428 DGSWNEWSAWTACSSTCSNGTMQRTRECNGPSYG-GSECHGSWKESANCFLKECPVDGRWHSWSSWGSCSKTCGGG 502          
BLAST of Subcommissural organ spondin vs. Ensembl Medaka
Match: spon1b (spondin-1 [Source:NCBI gene;Acc:101161803])

HSP 1 Score: 53.9138 bits (128), Expect = 1.008e-6
Identity = 59/209 (28.23%), Postives = 81/209 (38.76%), Query Frame = 1
Query:   88 VCTEWSDWSLCNASCGYGSSVRSRN----------CSTTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEE---IDDCP----NTCICEWSPWSHWTECSQNCGGGTTNK 663
            V TEW +W  C+ +CG G   R R           C     E D C   +CH D             +   W E       ++    I   Q +        N A C   +   +C   E C  DC  S WSEWSEC+  C      R+R++  +P +GG+ C      +   +  CP     T  C   PWS WT C++ CGGG   +
Sbjct:  552 VVTEWGEWDPCSVTCGLGMRRRERMVKMPPSDGSMCKAEIAEVDKCMVPECHADTC-----------VPTPWSEWSKCS--ATCGRGIRTRQRMRKT-----NQADCREETEQKECRLPE-CSIDCMVSEWSEWSECNKSCGKGHTIRTRMVKLEPQFGGRACPETIQRKKCKLRKCPGKRKETRGCRMQPWSSWTTCTKPCGGGIQER 741          
BLAST of Subcommissural organ spondin vs. Ensembl Medaka
Match: adgrb3 (adhesion G protein-coupled receptor B3 [Source:NCBI gene;Acc:101172925])

HSP 1 Score: 53.9138 bits (128), Expect = 1.271e-6
Identity = 35/110 (31.82%), Postives = 52/110 (47.27%), Query Frame = 1
Query: 1246 MPSNVACQECFC-NFTAQKECQPSSDDNKP----DANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPC-IMTCKVDCVMGQWTNETACNAQCCGG 1557
            +P N   + C      A + C  S++  +P       W EWS WS+CS  C  G R+R R+C  P +     C GP  +T+ C I  C VD    +W++ + C+  C  G
Sbjct:  219 LPLNPQTEGCLSPQLHAGQICNLSAEVKRPPKEVHGVWEEWSPWSLCSFTCGRGQRTRTRMCAPP-QHGGRACDGPETQTKLCNIALCPVDGQWQEWSSWSVCSVTCANG 327          
BLAST of Subcommissural organ spondin vs. Planmine SMEST
Match: SMESG000042714.1 (SMESG000042714.1)

HSP 1 Score: 1541.55 bits (3990), Expect = 0.000e+0
Identity = 799/801 (99.75%), Postives = 800/801 (99.88%), Query Frame = 1
Query:  310 MELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCXXXXXXXXXXCSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSXXXXXXXXXXXXXXXXQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNGAKFIVDDIHCLH 2712
            MELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCEWSRWSEWSECSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSNQTRTRTTNTDQRGNGQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNGAKFIVDDIHC +
Sbjct:    1 MELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCEWSRWSEWSECSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCICEWSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTTETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPGYVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQWQDWSPCNRVCGPSNQTRTRTTNTDQRGNGQSCVGSNTDIKPCNIVPCIMCIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNEWSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVDCVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRTVPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVKAVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTNTDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDTIFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLERTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDDVINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQTKKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNGAKFIVDDIHCCY 801          

HSP 2 Score: 269.24 bits (687), Expect = 1.578e-75
Identity = 133/134 (99.25%), Postives = 133/134 (99.25%), Query Frame = 2
Query: 2708 YIAAITRCKVNTVQVNQITLKNGQICKLTGGQLIEKTICAGGCSTSTSLRGLDEIDNAVMKFNKYSAMLANDPTALPPGFIQNSACKCCSPIQYTVNVPYEYTCINQSTNRQVNGIMVDIRITKCACINTCSNP 3109
            YIAAITRCKVNTVQVNQITLKNGQICKLTGGQLIEKTICAGGCSTSTSLRGLDEIDNAVMKFNKYSAMLANDPTALPPGFIQNSACKCCSPIQYTVNVPYEYTCINQSTNRQVNGIMVDIRITKCACINTCS P
Sbjct:  801 YIAAITRCKVNTVQVNQITLKNGQICKLTGGQLIEKTICAGGCSTSTSLRGLDEIDNAVMKFNKYSAMLANDPTALPPGFIQNSACKCCSPIQYTVNVPYEYTCINQSTNRQVNGIMVDIRITKCACINTCSKP 934          
BLAST of Subcommissural organ spondin vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.648e-10
Identity = 39/135 (28.89%), Postives = 56/135 (41.48%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC--------STTEN-------------EHDSCYSSDCHCDVLFSDVKFKIHR----------DIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDC 405
            ++WS WS C+  CG G   R R C        ST+E              E   C   +C C  +FS    KIH           D+   W+E D++ G +   EL++ G  + S IT+   C +C C +G   C
Sbjct: 4343 SDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSC--VFSKELMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKC 4475          
BLAST of Subcommissural organ spondin vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.648e-10
Identity = 39/135 (28.89%), Postives = 56/135 (41.48%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC--------STTEN-------------EHDSCYSSDCHCDVLFSDVKFKIHR----------DIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDC 405
            ++WS WS C+  CG G   R R C        ST+E              E   C   +C C  +FS    KIH           D+   W+E D++ G +   EL++ G  + S IT+   C +C C +G   C
Sbjct: 4351 SDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSC--VFSKELMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKC 4483          
BLAST of Subcommissural organ spondin vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.793e-10
Identity = 39/135 (28.89%), Postives = 56/135 (41.48%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC--------STTEN-------------EHDSCYSSDCHCDVLFSDVKFKIHR----------DIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDC 405
            ++WS WS C+  CG G   R R C        ST+E              E   C   +C C  +FS    KIH           D+   W+E D++ G +   EL++ G  + S IT+   C +C C +G   C
Sbjct: 4347 SDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSC--VFSKELMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKC 4479          
BLAST of Subcommissural organ spondin vs. Planmine SMEST
Match: SMESG000017972.1 (SMESG000017972.1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.942e-10
Identity = 39/135 (28.89%), Postives = 56/135 (41.48%), Query Frame = 1
Query:   94 TEWSDWSLCNASCGYGSSVRSRNC--------STTEN-------------EHDSCYSSDCHCDVLFSDVKFKIHR----------DIIDAWVELDDIIGFSSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDC 405
            ++WS WS C+  CG G   R R C        ST+E              E   C   +C C  +FS    KIH           D+   W+E D++ G +   EL++ G  + S IT+   C +C C +G   C
Sbjct: 4355 SDWSTWSPCSGICGTGIRRRFRQCQGINCKDMSTSEAGLKRFMATNDIQAEDKQCMIKECSC--VFSKELMKIHIGLDSINKFNIDLSAFWIEKDNVKGLTHSKELVKSGDIIKSGITIQAKCTQCSCKNGQFKC 4487          
The following BLAST results are available for this feature:
BLAST of Subcommissural organ spondin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MUC25.721e-932.17mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
MUC26.181e-932.17mucin 2, oligomeric mucus/gel-forming [Source:NCBI... [more]
MUC26.181e-932.17mucin 2, oligomeric mucus/gel-forming [Source:NCBI... [more]
MUC26.330e-932.17mucin 2, oligomeric mucus/gel-forming [Source:HGNC... [more]
OTOG4.203e-837.33otogelin [Source:HGNC Symbol;Acc:HGNC:8516][more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
T21B6.38.288e-931.15pep chromosome:WBcel235:X:10945160:10948970:-1 gen... [more]
adt-18.526e-725.00A disintegrin and metalloproteinase with thrombosp... [more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin9.277e-1323.29subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
adgrb1a7.828e-826.23adhesion G protein-coupled receptor B1a [Source:ZF... [more]
muc5.11.798e-626.72mucin 5.1, oligomeric mucus/gel-forming [Source:ZF... [more]
adgrb1b1.989e-639.24adhesion G protein-coupled receptor B1b [Source:ZF... [more]
otog8.171e-636.67otogelin [Source:ZFIN;Acc:ZDB-GENE-120228-1][more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000006505.12.327e-3230.25SCO-spondin [Source:NCBI gene;Acc:100497129][more]
THBS16.087e-925.87thrombospondin 1 [Source:NCBI gene;Acc:100170153][more]
THBS17.258e-925.87thrombospondin 1 [Source:NCBI gene;Acc:100170153][more]
THBS17.619e-925.87thrombospondin 1 [Source:NCBI gene;Acc:100170153][more]
THBS17.851e-925.87thrombospondin 1 [Source:NCBI gene;Acc:100170153][more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sspo1.975e-2425.23SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo2.724e-2425.23SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo3.006e-2425.29SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Sspo3.866e-2326.32SCO-spondin [Source:MGI Symbol;Acc:MGI:2674311][more]
Otog9.394e-936.00otogelin [Source:MGI Symbol;Acc:MGI:1202064][more]
back to top
BLAST of Subcommissural organ spondin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2PC93|SSPO_CHICK1.944e-2925.98SCO-spondin OS=Gallus gallus OX=9031 GN=SSPO PE=2 ... [more]
sp|Q700K0|SSPO_RAT1.693e-2325.07SCO-spondin OS=Rattus norvegicus OX=10116 GN=Sspo ... [more]
sp|Q8CG65|SSPO_MOUSE2.103e-2325.29SCO-spondin OS=Mus musculus OX=10090 GN=Sspo PE=2 ... [more]
sp|P98167|SSPO_BOVIN1.102e-2125.56SCO-spondin OS=Bos taurus OX=9913 GN=SSPO PE=2 SV=... [more]
sp|A2VEC9|SSPO_HUMAN1.815e-2125.97SCO-spondin OS=Homo sapiens OX=9606 GN=SSPO PE=2 S... [more]
back to top
BLAST of Subcommissural organ spondin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1C9ZVF91.458e-3670.03Uncharacterized protein (Fragment) OS=Dugesia japo... [more]
A0A1I8GBI12.917e-13735.34CTCK domain-containing protein OS=Macrostomum lign... [more]
A0A1I8GQX88.291e-13735.34CTCK domain-containing protein OS=Macrostomum lign... [more]
A0A267DGZ87.350e-12935.61CTCK domain-containing protein OS=Macrostomum lign... [more]
A0A267G2Q93.482e-12837.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin2.240e-1824.85subcommissural organ spondin [Source:ZFIN;Acc:ZDB-... [more]
sema5bb1.126e-727.45sema domain, seven thrombospondin repeats (type 1 ... [more]
adgrb1a1.257e-626.87adhesion G protein-coupled receptor B1a [Source:ZF... [more]
thbs1a1.271e-628.06thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
thbs1a1.594e-628.06thrombospondin 1a [Source:ZFIN;Acc:ZDB-GENE-120402... [more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000925.15.659e-2425.73pep scaffold:Pmarinus_7.0:GL477542:4188:92377:1 ge... [more]
ENSPMAT00000000917.11.865e-2225.57pep scaffold:Pmarinus_7.0:GL477542:941:92377:1 gen... [more]
ENSPMAT00000000912.16.410e-1725.28pep scaffold:Pmarinus_7.0:GL477542:3:94122:1 gene:... [more]
ENSPMAT00000000072.12.643e-827.78pep scaffold:Pmarinus_7.0:GL479818:18487:29074:1 g... [more]
ENSPMAT00000008652.15.317e-731.16pep scaffold:Pmarinus_7.0:GL477625:577100:586386:1... [more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418546.952e-1132.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO311733.861e-1041.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474218.076e-1038.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO488315.915e-824.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO262842.504e-729.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Subcommissural organ spondin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scospondin2.258e-1824.92SCO-spondin [Source:NCBI gene;Acc:101172449][more]
adgrb1b2.704e-739.47adhesion G protein-coupled receptor B1 [Source:NCB... [more]
adgrb1b2.816e-739.47adhesion G protein-coupled receptor B1 [Source:NCB... [more]
spon1b1.008e-628.23spondin-1 [Source:NCBI gene;Acc:101161803][more]
adgrb31.271e-631.82adhesion G protein-coupled receptor B3 [Source:NCB... [more]
back to top
BLAST of Subcommissural organ spondin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042714.11.578e-7599.75SMESG000042714.1[more]
SMESG000017972.15.648e-1028.89SMESG000017972.1[more]
SMESG000017972.15.648e-1028.89SMESG000017972.1[more]
SMESG000017972.15.793e-1028.89SMESG000017972.1[more]
SMESG000017972.15.942e-1028.89SMESG000017972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025808 ID=SMED30025808|Name=Subcommissural organ spondin|organism=Schmidtea mediterranea sexual|type=transcript|length=3290bp
ACACAATCGATATCGGAGAGTACTTCAACTGGATCAGCAACTACTTCACC
AATAATATTTACGCAATCGACATCTACTGAATTAGTTGTATGTACTGAAT
GGTCTGATTGGTCTTTGTGCAATGCTTCTTGTGGTTATGGATCTTCAGTG
AGATCTAGAAATTGCTCAACAACTGAAAATGAACATGACTCTTGTTATAG
TTCTGATTGTCATTGCGATGTTTTGTTCTCTGATGTCAAATTCAAAATAC
ATCGGGATATTATAGATGCGTGGGTTGAATTGGACGATATAATTGGGTTT
AGTTCTCTAATGGAATTAATTGAAGATGGACAGACAGTGGCTTCTAATAT
TACTGTTTTCTTTAATTGTGCAAAATGTTTATGCAATAGTGGCAGTTTAG
ATTGTTTTGAAGACGAAAATTGTAAAAAAGATTGTGAGTGGTCTCGATGG
AGTGAATGGTCTGAATGCAGCGGCGGCTGTGATAATGCATCTAAGAATCG
AAGTCGTGTAATAATAAAACAACCAAATTACGGAGGAAAATTCTGTGAAC
CAAATGGTAATGAAGAAATAGATGACTGTCCAAATACTTGTATTTGTGAA
TGGAGTCCTTGGTCACATTGGACAGAATGTTCTCAAAATTGTGGTGGAGG
AACCACAAATAAAACAAGAACTCCATTAAATAGTGGATGCGATCTTTCTT
CAGACACATCTATTGTAACTGTTGCTTGTAATGAATTCTCTTGCACGACT
GAAACATCAACGCCTATATGCAGTGGAAACAAAGTGCAGATCACGTGTCA
TAATGTCACATGTCCAAGGACGTGCGATGATGTACTAGATGGAGGAATAA
GCTGCGAAGAGTCGTCCGATTGCGTAACTGGTTGCTTCTGCAACCCAGGA
TATGTAGAAGACATGCTAGGAAATTGTGTATTGTCTGACACATGTTGTGA
TAAATCACAAGTCAATTGTAAACCATGCGAAACTGGAGTATGTGAAAACG
GGCAAGCAGTTTGTATACCGAATGACAATTGTGATTGTTCATGGAATCAA
TGGCAAGATTGGTCTCCTTGCAATAGAGTTTGTGGACCTAGTAATCAAAC
GAGAACTCGAACCACAAATACCGATCAAAGAGGAAATGGCCAATCATGTG
TTGGTTCCAATACAGATATTAAGCCTTGCAATATTGTACCTTGCATAATG
TGCATAGACGATGAAACAAGCCAAATATATCCCAGTGGTTCTCCGATGCC
ATCAAATGTAGCATGTCAAGAATGCTTCTGTAATTTTACTGCTCAAAAAG
AATGTCAACCATCGAGTGATGATAATAAACCGGATGCTAATTGGAATGAA
TGGTCAGCGTGGTCAATATGTTCTGGTAACTGTCCTAATGGTACCAGATC
CAGAGACCGAATCTGTATCGACCCTTGTGAAGACCTTTCCACTAGATGCG
TTGGACCACGTATTGAAACAGAGCCCTGCATAATGACATGCAAAGTTGAT
TGTGTAATGGGACAATGGACAAATGAAACGGCTTGTAATGCACAGTGTTG
CGGTGGAAACTCAGTGGCATACGGCATAATAACGCAAGTGAGAGATTTAC
TCATTCCATCAATAAATACAAATGCGAAAGAATGCGAAACAAACCGTACA
GTTCCTTGTCAGTTGGACTGTCCAGTTGATTGCAAAGTTTTGACTTATGA
AACATCGGAATGCATTAAACTGTGTTCCGCAAACAATACCCAATGTGATC
CGAGCTGTGGACATGGAATGGTTACAAAAACTCCCCAGGAAATCGTCAAA
GCAGTTAATGGTGGGAAGAATTGTGAGGTCACCTATGAGCCCTGTTATCT
GGGAAATTGCAGTCAATCGTGTGTTGCACCGAAACAATTGCTTTCTTGTG
TAAACCCCTGTGAACAACGATGCGGTGATTTGTCTAAAAAGTGTACCAAT
ACCGATTGTATTGAATCTTGCGCCTGTCCTGATAACATGTTAGAACAAGA
CGGTCAATGTGTTTCGAAATCCGAATGCCGCTGTACTTGGAATGATAATT
TGCTGGGAACAAGACCACCTGGAATTATGGAAGAATCTCTTCCCGACACA
ATTTTCCCTAAAGATTGCAACAATTGCACATGTCGACAAGGAAAATGGAT
TTGTACAACCAATATTTGCCAGCAGGATTGCCAATGGAGTGATTGGAAGA
TCGTTTCTCCGTGCAATGTAACCTGCGGTAAAGGCGTTCAAAAACTGGAA
AGAACTGTTGCTCAAGTTGCCGTTTACGGTGGTAACGATTGCCAAGGATC
CAATACGACTGACGAAATTTGCTATGCTGCGACCCAATGCTGTGAAATAA
ATGTAGCGTATTCATTGAAAAATAGCTATTGTGAACAGACGTGCGATGAT
GTGATAAATAGATTGCATCCTACTCATGTTTGCGAGGAGGGCTGCAGATG
TCAACCAGGCTATGTCAGAAATATTAATAACACGTGCGTTCCAACATCCG
AATGTTATCGTTGTGAAGTTAACGGAACGATATGGCAGAATGGACAAACC
AAAAAGGATACCAACTCTTGTCAATTATATTTATGTTCTGGTGGAAAAAT
GACCGTATCCCCACTGGGTGTGAAAAATGGGTTACCTGCTTGCTCATTGG
AAGATGAAGCTTTAGTGTCGAATGGCGCGAAATTCATTGTAGATGACATT
CATTGCTTACATAGCCGCCATTACTAGATGTAAAGTAAATACAGTTCAGG
TGAATCAGATTACTTTGAAAAATGGACAAATATGTAAACTTACTGGTGGA
CAACTGATTGAGAAAACCATTTGTGCTGGTGGATGCAGTACATCGACTTC
ACTTCGTGGTTTGGATGAAATTGACAATGCAGTTATGAAGTTCAATAAAT
ATTCTGCAATGCTTGCAAACGACCCAACAGCACTGCCACCTGGATTTATT
CAAAACTCGGCCTGTAAATGCTGCTCACCAATTCAATACACAGTCAATGT
GCCTTACGAATACACTTGTATCAACCAGTCAACCAATAGGCAAGTCAATG
GTATCATGGTGGATATCCGAATAACTAAATGTGCTTGCATTAACACTTGT
TCAAACCCTTGAAATATTTTTGATTGGTAAATAAATTATTATGGCATCAC
TTTCGTGTTATTATCTGTTTTACTAATTTTACTAAAACATTTTTTATAAT
CTTATGTCAAAATTTATCTTTTCATTTTAATTAATAAAACAATAATTAAT
AAATTTTACGTACAATACTTACCAGTTCTAATAATTTAAT
back to top

protein sequence of SMED30025808-orf-1

>SMED30025808-orf-1 ID=SMED30025808-orf-1|Name=SMED30025808-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=140bp
MTFIAYIAAITRCKVNTVQVNQITLKNGQICKLTGGQLIEKTICAGGCST
STSLRGLDEIDNAVMKFNKYSAMLANDPTALPPGFIQNSACKCCSPIQYT
VNVPYEYTCINQSTNRQVNGIMVDIRITKCACINTCSNP*
back to top

protein sequence of SMED30025808-orf-2

>SMED30025808-orf-2 ID=SMED30025808-orf-2|Name=SMED30025808-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=909bp
TQSISESTSTGSATTSPIIFTQSTSTELVVCTEWSDWSLCNASCGYGSSV
RSRNCSTTENEHDSCYSSDCHCDVLFSDVKFKIHRDIIDAWVELDDIIGF
SSLMELIEDGQTVASNITVFFNCAKCLCNSGSLDCFEDENCKKDCEWSRW
SEWSECSGGCDNASKNRSRVIIKQPNYGGKFCEPNGNEEIDDCPNTCICE
WSPWSHWTECSQNCGGGTTNKTRTPLNSGCDLSSDTSIVTVACNEFSCTT
ETSTPICSGNKVQITCHNVTCPRTCDDVLDGGISCEESSDCVTGCFCNPG
YVEDMLGNCVLSDTCCDKSQVNCKPCETGVCENGQAVCIPNDNCDCSWNQ
WQDWSPCNRVCGPSNQTRTRTTNTDQRGNGQSCVGSNTDIKPCNIVPCIM
CIDDETSQIYPSGSPMPSNVACQECFCNFTAQKECQPSSDDNKPDANWNE
WSAWSICSGNCPNGTRSRDRICIDPCEDLSTRCVGPRIETEPCIMTCKVD
CVMGQWTNETACNAQCCGGNSVAYGIITQVRDLLIPSINTNAKECETNRT
VPCQLDCPVDCKVLTYETSECIKLCSANNTQCDPSCGHGMVTKTPQEIVK
AVNGGKNCEVTYEPCYLGNCSQSCVAPKQLLSCVNPCEQRCGDLSKKCTN
TDCIESCACPDNMLEQDGQCVSKSECRCTWNDNLLGTRPPGIMEESLPDT
IFPKDCNNCTCRQGKWICTTNICQQDCQWSDWKIVSPCNVTCGKGVQKLE
RTVAQVAVYGGNDCQGSNTTDEICYAATQCCEINVAYSLKNSYCEQTCDD
VINRLHPTHVCEEGCRCQPGYVRNINNTCVPTSECYRCEVNGTIWQNGQT
KKDTNSCQLYLCSGGKMTVSPLGVKNGLPACSLEDEALVSNGAKFIVDDI
HCLHSRHY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007399nervous system development
GO:0030154cell differentiation
GO:0007155cell adhesion
GO:0008150biological_process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005576extracellular region
GO:0005615extracellular space
GO:0005737cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000240body wall musculature
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036383TSP1_rpt_sf
IPR030119SCO-spondin
IPR036084Ser_inhib-like_sf
IPR000884TSP1_rpt
IPR002919TIL_dom
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000884Thrombospondin type-1 (TSP1) repeatSMARTSM00209TSP1_2coord: 147..198
e-value: 6.3E-6
score: 35.7
coord: 201..249
e-value: 5.0E-5
score: 32.7
coord: 503..558
e-value: 1.4
score: 8.0
coord: 729..782
e-value: 6.0E-4
score: 29.1
coord: 448..498
e-value: 6.2E-4
score: 29.1
coord: 31..71
e-value: 0.039
score: 21.8
coord: 348..399
e-value: 1.3E-6
score: 38.0
coord: 575..621
e-value: 4.1
score: 3.9
IPR000884Thrombospondin type-1 (TSP1) repeatPFAMPF00090TSP_1coord: 202..244
e-value: 0.0052
score: 17.0
coord: 148..193
e-value: 7.0E-5
score: 23.0
coord: 730..780
e-value: 2.4E-7
score: 30.9
coord: 450..495
e-value: 7.5E-7
score: 29.3
coord: 33..66
e-value: 2.1E-4
score: 21.4
coord: 350..398
e-value: 2.5E-6
score: 27.6
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 726..782
score: 9.115
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 28..71
score: 8.933
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 144..194
score: 9.796
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 345..399
score: 11.327
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 197..249
score: 10.093
IPR000884Thrombospondin type-1 (TSP1) repeatPROSITEPS50092TSP1coord: 445..498
score: 11.192
IPR002919Trypsin Inhibitor-like, cysteine rich domainPFAMPF01826TILcoord: 781..835
e-value: 5.5E-8
score: 32.9
coord: 257..315
e-value: 3.2E-8
score: 33.7
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 725..780
e-value: 4.4E-8
score: 35.3
coord: 344..398
e-value: 6.0E-10
score: 41.3
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 12..75
e-value: 4.6E-7
score: 31.4
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilyGENE3DG3DSA:2.20.100.10coord: 141..193
e-value: 6.5E-11
score: 44.4
coord: 443..494
e-value: 4.7E-8
score: 35.2
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 344..394
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 30..70
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 199..229
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 445..494
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 144..193
IPR036383Thrombospondin type-1 (TSP1) repeat superfamilySUPERFAMILYSSF82895TSP-1 type 1 repeatcoord: 726..774
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 781..835
e-value: 3.2E-9
score: 38.8
coord: 256..315
e-value: 1.0E-7
score: 34.0
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 610..724
e-value: 3.0E-15
score: 58.4
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 120..255
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 580..781
NoneNo IPR availablePANTHERPTHR11339EXTRACELLULAR MATRIX GLYCOPROTEIN RELATEDcoord: 248..428
IPR030119SCO-spondinPANTHERPTHR11339:SF358SCO-SPONDINcoord: 580..781
coord: 120..255
IPR030119SCO-spondinPANTHERPTHR11339:SF358SCO-SPONDINcoord: 248..428
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 778..835
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 255..315
IPR036084Serine protease inhibitor-like superfamilySUPERFAMILYSSF57567Serine protease inhibitorscoord: 620..678