RuvB-like helicase

Overview
NameRuvB-like helicase
Smed IDSMED30025807
Length (bp)1544
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RuvB-like helicase (SMED30025807) t-SNE clustered cells

Violin plots show distribution of expression levels for RuvB-like helicase (SMED30025807) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RuvB-like helicase (SMED30025807) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RuvB-like helicase (SMED30025807) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025807

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025807SMESG000033997.1 SMESG000018207.1 SMESG000044823.1 Contig6172newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30025807SMESG000033997.1 SMESG000018207.1 SMESG000044823.1 Contig6172uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
X1 cellSMED30025807SMESG000033997.1 SMESG000018207.1 SmedASXL_006781SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30025807SMESG000033997.1 SMESG000018207.1 dd_Smed_v4_2547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025807SMESG000033997.1 SMESG000018207.1 dd_Smed_v4_2547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025807SMESG000033997.1 SMESG000018207.1 dd_Smed_v4_2547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30025807SMESG000033997.1 SMESG000018207.1 dd_Smed_v4_2547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30025807SMESG000033997.1 SMESG000018207.1 dd_Smed_v4_2547_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025807SMESG000033997.1 SMESG000018207.1 SMED30025807smed_20140614PMID:22696458
Labbé et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30025807SMESG000033997.1 SMESG000018207.1 dd_Smed_v4_2547_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL2 (RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGNC:10475])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 340/450 (75.56%), Postives = 407/450 (90.44%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IRCEEEDVE S DA T+LT IG+ETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 456          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL2 (RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGNC:10475])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 258/332 (77.71%), Postives = 309/332 (93.07%), Query Frame = 2
Query:  230 MVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEE 1225
            MVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IR ++
Sbjct:    1 MVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRVQK 332          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL2 (RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGNC:10475])

HSP 1 Score: 563.918 bits (1452), Expect = 0.000e+0
Identity = 258/332 (77.71%), Postives = 309/332 (93.07%), Query Frame = 2
Query:  230 MVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEE 1225
            MVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IR ++
Sbjct:    1 MVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRVQK 332          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL1 (RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGNC:10474])

HSP 1 Score: 376.711 bits (966), Expect = 6.805e-126
Identity = 196/455 (43.08%), Postives = 291/455 (63.96%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI +HSH++GLGL +    + ++ G+VGQ  AR A G+I+E+IK   +AGR +L+AG PGTGKTA+A+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     V+  LKT +      L   + ES+ KE++++GD+I I+  SG V R GR  T A ++D    +  +V  P+G++ K KE++  V LH++DV N+R QG       +  L      EI  ++R +I+  V ++ ++G AELVPGVLF+DEVHMLD+ECF++L+RA+ES +AP+++ A+NRG   IRGT+   SPHGIP DLLDR++II T+ YT  E+ QI+KIR + E +  S +AL  L  IG +T+LRYS+QL+T ANL+ +      +    ++++  LF D K S   L + Q +++
Sbjct:    3 IEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEE--YVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Human
Match: RUVBL1 (RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGNC:10474])

HSP 1 Score: 376.711 bits (966), Expect = 6.805e-126
Identity = 196/455 (43.08%), Postives = 291/455 (63.96%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI +HSH++GLGL +    + ++ G+VGQ  AR A G+I+E+IK   +AGR +L+AG PGTGKTA+A+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     V+  LKT +      L   + ES+ KE++++GD+I I+  SG V R GR  T A ++D    +  +V  P+G++ K KE++  V LH++DV N+R QG       +  L      EI  ++R +I+  V ++ ++G AELVPGVLF+DEVHMLD+ECF++L+RA+ES +AP+++ A+NRG   IRGT+   SPHGIP DLLDR++II T+ YT  E+ QI+KIR + E +  S +AL  L  IG +T+LRYS+QL+T ANL+ +      +    ++++  LF D K S   L + Q +++
Sbjct:    3 IEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEE--YVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: ruvb-2 (RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH2])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 259/439 (59.00%), Postives = 339/439 (77.22%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTD-LKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            ++I ++ER   HSHI GLGL+D LE    S GMVGQ+ AR+AAG+I++MI++G +AGR +L+ G+PG GKTAIA+ +++ LG DTPF SI ASEI+S E++KTE+LTQAFR+++G++IKE+TEV+EGEV+ L++DR A G G K GK+ ++TT+MET++DLG KM+++ LKEK+  GD+I +DK SGRVTRLGRSF ++ DYDA G + K VQCP+GEI+K +E VHTV LH+IDVINSR QG +ALFSGDTGEIK+EVRDQI+ KV EWREEG+A+ VPGVLFIDE HMLD+ECFSFLNRAIE +++P+++MATNR + K+RGT   S HGIP D LDR+LII+ +PYTK++  +IL IRC+EE V+    AL LL  +   TSLRY I LI  A+ V R R   E+  TD +   Y LF D KRS   L E  + FL
Sbjct:   10 KDIVKVERTSVHSHITGLGLNDRLEAEYVSGGMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELGEDTPFVSIVASEIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISLEVDRSANGMGPKVGKLTMRTTDMETIYDLGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAMGPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSRTQGYVALFSGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMATNRLIEKVRGTDVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLI-AASEVIRIRSKAEIVTTDHIGSAYRLFFDTKRSEKILTEESAGFL 447          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: ruvb-2 (RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZH2])

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 259/439 (59.00%), Postives = 339/439 (77.22%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTD-LKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            ++I ++ER   HSHI GLGL+D LE    S GMVGQ+ AR+AAG+I++MI++G +AGR +L+ G+PG GKTAIA+ +++ LG DTPF SI ASEI+S E++KTE+LTQAFR+++G++IKE+TEV+EGEV+ L++DR A G G K GK+ ++TT+MET++DLG KM+++ LKEK+  GD+I +DK SGRVTRLGRSF ++ DYDA G + K VQCP+GEI+K +E VHTV LH+IDVINSR QG +ALFSGDTGEIK+EVRDQI+ KV EWREEG+A+ VPGVLFIDE HMLD+ECFSFLNRAIE +++P+++MATNR + K+RGT   S HGIP D LDR+LII+ +PYTK++  +IL IRC+EE V+    AL LL  +   TSLRY I LI  A+ V R R   E+  TD +   Y LF D KRS   L E  + FL
Sbjct:   10 KDIVKVERTSVHSHITGLGLNDRLEAEYVSGGMVGQVAARQAAGLIVKMIQEGKIAGRALLVTGEPGAGKTAIAIAISKELGEDTPFVSIVASEIYSNEINKTEALTQAFRRALGIQIKEETEVLEGEVISLEVDRSANGMGPKVGKLTMRTTDMETIYDLGSKMVDACLKEKVMPGDVIQVDKASGRVTRLGRSFNRSHDYDAMGPKVKLVQCPDGEIQKRRETVHTVCLHDIDVINSRTQGYVALFSGDTGEIKAEVRDQINKKVLEWREEGKAKFVPGVLFIDEAHMLDIECFSFLNRAIEGELSPLIIMATNRLIEKVRGTDVESAHGIPSDFLDRMLIINAIPYTKEDTAKILSIRCDEEGVKLQPTALDLLVKLQEATSLRYCIHLI-AASEVIRIRSKAEIVTTDHIGSAYRLFFDTKRSEKILTEESAGFL 447          
BLAST of RuvB-like helicase vs. Ensembl Celegans
Match: ruvb-1 (RuvB-like 1 [Source:UniProtKB/Swiss-Prot;Acc:O17607])

HSP 1 Score: 363.999 bits (933), Expect = 5.409e-121
Identity = 197/438 (44.98%), Postives = 282/438 (64.38%), Query Frame = 2
Query:  146 RMERIGAHSHIRGLGL-SDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVV------LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG--------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEV-GVTDLKKVYTLFMDEKRS 1411
            +++RI AHSH++GLG+ ++  E    + G VGQ  AR AA I+++MI+   +AGR +LIAG P TGKTAIA+ M+Q LG   PF  + ASE+FS E+ KTE L ++FR++IGLR+KE  +V EGEV EL     +  +G   GK +      LKT +      L   + +S+LK++++ GD+I I+  SG V R+GR    A ++D      +FV  P+G++ K K++V  V+LH++D+ N+R QG        V  L +    E+   +R +I+  V E+ E G AEL+PGVLFIDEVHMLDVECF++L RA+ES MAPV+V ATNRG T +RG   ++PHGIP ++LDRL+II T+ Y +++I +IL  R E E+V+F   A  LL+ +G E SLRY++QLI  A L C +  G+EV  V D+ +   LFMD   S
Sbjct:   29 QIKRIAAHSHVKGLGIDTETQEAHYEAAGFVGQAPARTAASIVVDMIRLKCMAGRAVLIAGPPATGKTAIALAMSQELGDGVPFVPLVASEVFSNEVKKTEVLMRSFRRAIGLRVKETKDVYEGEVTELSPVEASDNSG--MGKTISHLVLSLKTAKGSKQLKLDPSIYDSILKQRVEVGDVIYIEANSGIVKRVGRCDVYASEFDL--EADEFVPMPKGDVRKSKDIVQNVSLHDLDIANARPQGRQGDVSNIVSQLMTPKKTEVTDRLRSEINKVVNEYIESGVAELMPGVLFIDEVHMLDVECFTYLYRALESPMAPVVVFATNRGTTTVRGLGDKAPHGIPPEMLDRLMIIPTMKYNEEDIRKILVHRTEAENVQFEEKAFDLLSKVGAEKSLRYALQLIAPARL-CAQTCGREVIEVEDVDRCTKLFMDRGES 461          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: rept (gene:FBgn0040075 transcript:FBtr0331852)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 321/446 (71.97%), Postives = 387/446 (86.77%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL-TDAMEEV 1468
            R++TR+ERIGAHSHIRGLGL D LE R+ SQGMVGQ  ARRAAG++++M+++G +AGR IL+AG+P TGKTAIA+GMAQALG +TPFTS++ SEI+SLEMSKTE+L+QA RKSIG+RIKE+TE+IEGEVVE+QI+RPA+GTG K GKV LKTTEMET +DLG K+IE  +KEKIQ+GD+I IDK SG+V +LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV LHEIDVINSR  G +ALFSGDTGEIK EVRDQI+ KV EWREEG+AE+ PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPV+VMATNRG+T+IRGT  RSPHGIP DLLDR++II TVPY++ E+ +ILKIRCEEED     DALT+LT I  +TSLRY+IQLITTANLVCR+RK  EV   D+KKVY+LF+DE RS+  L EYQ +++ ++  EEV
Sbjct:   10 RDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEIQIERPASGTGQKVGKVTLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHGFLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGTNYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMFSEITEEV 455          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: rept (gene:FBgn0040075 transcript:FBtr0074988)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 321/446 (71.97%), Postives = 387/446 (86.77%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL-TDAMEEV 1468
            R++TR+ERIGAHSHIRGLGL D LE R+ SQGMVGQ  ARRAAG++++M+++G +AGR IL+AG+P TGKTAIA+GMAQALG +TPFTS++ SEI+SLEMSKTE+L+QA RKSIG+RIKE+TE+IEGEVVE+QI+RPA+GTG K GKV LKTTEMET +DLG K+IE  +KEKIQ+GD+I IDK SG+V +LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV LHEIDVINSR  G +ALFSGDTGEIK EVRDQI+ KV EWREEG+AE+ PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPV+VMATNRG+T+IRGT  RSPHGIP DLLDR++II TVPY++ E+ +ILKIRCEEED     DALT+LT I  +TSLRY+IQLITTANLVCR+RK  EV   D+KKVY+LF+DE RS+  L EYQ +++ ++  EEV
Sbjct:   10 RDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEIQIERPASGTGQKVGKVTLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHGFLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGTNYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMFSEITEEV 455          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: rept (gene:FBgn0040075 transcript:FBtr0344993)

HSP 1 Score: 683.715 bits (1763), Expect = 0.000e+0
Identity = 321/446 (71.97%), Postives = 387/446 (86.77%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL-TDAMEEV 1468
            R++TR+ERIGAHSHIRGLGL D LE R+ SQGMVGQ  ARRAAG++++M+++G +AGR IL+AG+P TGKTAIA+GMAQALG +TPFTS++ SEI+SLEMSKTE+L+QA RKSIG+RIKE+TE+IEGEVVE+QI+RPA+GTG K GKV LKTTEMET +DLG K+IE  +KEKIQ+GD+I IDK SG+V +LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV LHEIDVINSR  G +ALFSGDTGEIK EVRDQI+ KV EWREEG+AE+ PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPV+VMATNRG+T+IRGT  RSPHGIP DLLDR++II TVPY++ E+ +ILKIRCEEED     DALT+LT I  +TSLRY+IQLITTANLVCR+RK  EV   D+KKVY+LF+DE RS+  L EYQ +++ ++  EEV
Sbjct:   10 RDVTRIERIGAHSHIRGLGLDDVLEARLVSQGMVGQKDARRAAGVVVQMVREGKIAGRCILLAGEPSTGKTAIAVGMAQALGTETPFTSMSGSEIYSLEMSKTEALSQALRKSIGVRIKEETEIIEGEVVEIQIERPASGTGQKVGKVTLKTTEMETNYDLGNKIIECFMKEKIQAGDVITIDKASGKVNKLGRSFTRARDYDATGAQTRFVQCPEGELQKRKEVVHTVTLHEIDVINSRTHGFLALFSGDTGEIKQEVRDQINNKVLEWREEGKAEINPGVLFIDEVHMLDIECFSFLNRALESDMAPVVVMATNRGITRIRGTNYRSPHGIPIDLLDRMIIIRTVPYSEKEVKEILKIRCEEEDCIMHPDALTILTRIATDTSLRYAIQLITTANLVCRRRKATEVNTEDVKKVYSLFLDENRSSKILKEYQDDYMFSEITEEV 455          
BLAST of RuvB-like helicase vs. Ensembl Fly
Match: pont (gene:FBgn0040078 transcript:FBtr0082226)

HSP 1 Score: 355.91 bits (912), Expect = 5.011e-118
Identity = 200/455 (43.96%), Postives = 298/455 (65.49%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG---VIA----LFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRG-TQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +   R +RI AHSH++GLGL +      S+ G+VGQ  AR AAGI++++IK   +AGR +L+AG PGTGKTAIA+ +AQ LG   PF  +  SE+FS E+ KTE L + FR+SIGLRI+E  EV EGEV EL   + + P  G G     VV  LKT +      L   + +++ KEK++ GD+I I+  SG V R GRS T A ++D      ++V  P+G++ K KEV+  V LH++DV N+R QG   V++    L      EI  ++R +I+  V ++ ++G AELVPGVLFIDE+HMLD+E F++L++++ES +AP+++ ATNRG   IRG T   SPHGIP DLLDRLLII T+ Y+  ++ QI+K+R + E ++   +A T L+ IG  ++LRY++QL+T A+ +C+     ++   D++ V++LF+D KRS+ +L+E  ++F+
Sbjct:    3 IEEVKSTVRTQRIAAHSHVKGLGLDEVGAAVHSAAGLVGQKAAREAAGIVVDLIKSKKMAGRALLLAGPPGTGKTAIALAIAQELGNKVPFCPMVGSEVFSNEIKKTEVLMENFRRSIGLRIRETKEVYEGEVTELTPVETENPMGGYGKTISNVVIGLKTAKGTKQLKLDPSIFDALQKEKVEVGDVIYIEANSGAVKRQGRSDTFATEFDL--ETEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQGGQDVLSMMGQLMKPKKTEITDKLRMEINKVVNKYIDQGIAELVPGVLFIDEIHMLDLETFTYLHKSLESPIAPIVIFATNRGRCVIRGTTDIVSPHGIPLDLLDRLLIIRTLLYSTADMEQIIKLRAQTEGLQLEENAFTRLSEIGTSSTLRYAVQLLTPAHQMCKVNGRNQISKDDIEDVHSLFLDAKRSSKHLSEKNNKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Match: ruvbl2 (RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:317678])

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 336/451 (74.50%), Postives = 405/451 (89.80%), Query Frame = 2
Query:   95 QMMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            Q+    +P++   R+ITR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL +RRAAG+ILEMIKDG +AGR +LIAGQPGTGKTAIAMG+AQ+LGPDTPFT++A SEIFSLEMSKTE+L+QAFRK+IG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KE++Q+GD+I IDK +G++++LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKV+EWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESD++PVL+MATNRG+T+IRGT  +SPHGIP D+LDRLLII+T PYT+ E  QILKIRCEEEDVE S +A T+LT IG ETSLRY+IQLI+TA LVCRKR+G EV V D+K+VY+LF+DE RS+ Y+ EYQ  FL
Sbjct:    4 QVATTKVPEV---RDITRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGLILEMIKDGQIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLSKERVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGTNYQSPHGIPIDMLDRLLIIATTPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFL 451          
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Match: ruvbl2 (RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:317678])

HSP 1 Score: 707.212 bits (1824), Expect = 0.000e+0
Identity = 335/445 (75.28%), Postives = 403/445 (90.56%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            +P++   R+ITR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL +RRAAG+ILEMIKDG +AGR +LIAGQPGTGKTAIAMG+AQ+LGPDTPFT++A SEIFSLEMSKTE+L+QAFRK+IG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KE++Q+GD+I IDK +G++++LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKV+EWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESD++PVL+MATNRG+T+IRGT  +SPHGIP D+LDRLLII+T PYT+ E  QILKIRCEEEDVE S +A T+LT IG ETSLRY+IQLI+TA LVCRKR+G EV V D+K+VY+LF+DE RS+ Y+ EYQ  FL
Sbjct:    1 VPEV---RDITRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGLILEMIKDGQIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLSKERVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGTNYQSPHGIPIDMLDRLLIIATTPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFL 442          
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Match: ruvbl1 (RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:317679])

HSP 1 Score: 373.629 bits (958), Expect = 6.560e-125
Identity = 201/455 (44.18%), Postives = 292/455 (64.18%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI +HSH++GLGL +    + S+ G+VGQ  AR A GII E+I+   +AGR IL+AG PGTGKTA+A+ MAQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     V+  LKT +      L   + ES+ KE+++ GD+I I+  SG V R GR  T A ++D      ++V  P+G++ K KE++  V LH++DV N+R QG       +  L      EI  ++R +I+  V ++ ++G AELVPGVLFIDEVHMLD+ECF++L+RA+ES +AP++V A+NRG   IRGT+   SPHGIP DLLDR++II T+ YT  E+ QI+KIR + E +  S +AL+ L  IG +T+LRY++QL+T A+L+ R +  + V    ++++  LF D K S   L +  ++F+
Sbjct:    3 IEEVKSTTKTQRIASHSHVKGLGLDEAGNAKQSASGLVGQESAREACGIITELIRSKKMAGRAILLAGPPGTGKTALALAMAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDL--EAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFIDEVHMLDIECFTYLHRALESSIAPIVVFASNRGNCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGLNISEEALSHLGEIGTKTTLRYAVQLLTPASLLARVQGREVVEKEHVEEINELFYDAKSSAKILQDQHTKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 735.332 bits (1897), Expect = 0.000e+0
Identity = 343/455 (75.38%), Postives = 406/455 (89.23%), Query Frame = 2
Query:   98 MMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            M    +P++   R++TR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL ARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGR+FT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY + E  QILKIRCEEEDV+ + DA T+LT IG+ETSLRYS+QLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  F+ + M+
Sbjct:    4 MATTKVPEV---RDVTRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMFNEMK 455          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 342/450 (76.00%), Postives = 405/450 (90.00%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P++   R++TR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL ARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGR+FT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY + E  QILKIRCEEEDV+ + DA T+LT IG+ETSLRYS+QLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  F+ + M+
Sbjct:   17 VPEV---RDVTRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMFNEMK 463          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 718.768 bits (1854), Expect = 0.000e+0
Identity = 339/453 (74.83%), Postives = 398/453 (87.86%), Query Frame = 2
Query:  104 NPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            N   P+I     I  +   GAHSHIRGLGL D LEPR  SQGMVGQL ARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGR+FT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY + E  QILKIRCEEEDV+ + DA T+LT IG+ETSLRYS+QLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  F+ + M+
Sbjct:    2 NTETPNIPIPSNIC-LSLPGAHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMFNEMK 453          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 335/434 (77.19%), Postives = 392/434 (90.32%), Query Frame = 2
Query:  161 GAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            GAHSHIRGLGL D LEPR  SQGMVGQL ARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGR+FT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY + E  QILKIRCEEEDV+ + DA T+LT IG+ETSLRYS+QLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  F+ + M+
Sbjct:   25 GAHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMFNEMK 458          
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:448144])

HSP 1 Score: 717.227 bits (1850), Expect = 0.000e+0
Identity = 334/433 (77.14%), Postives = 391/433 (90.30%), Query Frame = 2
Query:  164 AHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            AHSHIRGLGL D LEPR  SQGMVGQL ARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGR+FT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY + E  QILKIRCEEEDV+ + DA T+LT IG+ETSLRYS+QLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  F+ + M+
Sbjct:   16 AHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMTEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMFNEMK 448          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 340/450 (75.56%), Postives = 407/450 (90.44%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IRCEEEDVE S DA T+LT IG+ETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 456          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 340/450 (75.56%), Postives = 407/450 (90.44%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IRCEEEDVE S DA T+LT IG+ETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 456          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 370.163 bits (949), Expect = 9.693e-127
Identity = 177/250 (70.80%), Postives = 213/250 (85.20%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG 862
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR                    +MI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPR--------------------QMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQG 236          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl1 (RuvB-like protein 1 [Source:MGI Symbol;Acc:MGI:1928760])

HSP 1 Score: 377.096 bits (967), Expect = 3.642e-126
Identity = 196/455 (43.08%), Postives = 291/455 (63.96%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI +HSH++GLGL +    + ++ G+VGQ  AR A G+I+E+IK   +AGR +L+AG PGTGKTA+A+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     V+  LKT +      L   + ES+ KE++++GD+I I+  SG V R GR  T A ++D    +  +V  P+G++ K KE++  V LH++DV N+R QG       +  L      EI  ++R +I+  V ++ ++G AELVPGVLF+DEVHMLD+ECF++L+RA+ES +AP+++ A+NRG   IRGT+   SPHGIP DLLDR++II T+ YT  E+ QI+KIR + E +  S +AL  L  IG +T+LRYS+QL+T ANL+ +      +    ++++  LF D K S   L + Q +++
Sbjct:    3 IEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAASGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLEAEE--YVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNCVIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYM 455          
BLAST of RuvB-like helicase vs. Ensembl Mouse
Match: Ruvbl2 (RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:1342299])

HSP 1 Score: 350.132 bits (897), Expect = 5.013e-119
Identity = 164/215 (76.28%), Postives = 198/215 (92.09%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQ 757
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+Q
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQ 221          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q9DE27|RUVB2_XENLA (RuvB-like 2 OS=Xenopus laevis OX=8355 GN=ruvbl2 PE=2 SV=1)

HSP 1 Score: 735.717 bits (1898), Expect = 0.000e+0
Identity = 343/455 (75.38%), Postives = 406/455 (89.23%), Query Frame = 2
Query:   98 MMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            M    +P++   R++TR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL +RRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGR+FT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY + E  QILKIRCEEEDV+ S DA T+LT IG+ETSLRYS+QLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  F+ + M+
Sbjct:    4 MAATKVPEV---RDVTRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGSDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEVQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRAFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTSPYNEKETKQILKIRCEEEDVDMSEDAYTVLTRIGLETSLRYSMQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFMFNEMK 455          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q9Y230|RUVB2_HUMAN (RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1 SV=3)

HSP 1 Score: 733.791 bits (1893), Expect = 0.000e+0
Identity = 340/450 (75.56%), Postives = 407/450 (90.44%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IRCEEEDVE S DA T+LT IG+ETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 456          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q9WTM5|RUVB2_MOUSE (RuvB-like 2 OS=Mus musculus OX=10090 GN=Ruvbl2 PE=1 SV=3)

HSP 1 Score: 733.406 bits (1892), Expect = 0.000e+0
Identity = 340/450 (75.56%), Postives = 407/450 (90.44%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IRCEEEDVE S DA T+LT IG+ETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 456          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|Q2TBU9|RUVB2_BOVIN (RuvB-like 2 OS=Bos taurus OX=9913 GN=RUVBL2 PE=2 SV=3)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 340/450 (75.56%), Postives = 407/450 (90.44%), Query Frame = 2
Query:  113 IPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            +P+I   R++TR+ERIGAHSHIRGLGL D LEPR +SQGMVGQL ARRAAG++LEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALGPDTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTGSK GK+ LKTTEMET++DLG KMIES+ K+K+Q+GD+I IDK +G++++LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+E FSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLI+ST PY++ +  QIL+IRCEEEDVE S DA T+LT IG+ETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:   10 VPEI---RDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTSPYSEKDKKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTEVQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 456          
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Match: sp|P83571|RUVB2_DANRE (RuvB-like 2 OS=Danio rerio OX=7955 GN=ruvbl2 PE=1 SV=1)

HSP 1 Score: 709.138 bits (1829), Expect = 0.000e+0
Identity = 336/451 (74.50%), Postives = 405/451 (89.80%), Query Frame = 2
Query:   95 QMMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            Q+    +P++   R+ITR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL +RRAAG+ILEMIKDG +AGR +LIAGQPGTGKTAIAMG+AQ+LGPDTPFT++A SEIFSLEMSKTE+L+QAFRK+IG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KE++Q+GD+I IDK +G++++LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKV+EWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESD++PVL+MATNRG+T+IRGT  +SPHGIP D+LDRLLII+T PYT+ E  QILKIRCEEEDVE S +A T+LT IG ETSLRY+IQLI+TA LVCRKR+G EV V D+K+VY+LF+DE RS+ Y+ EYQ  FL
Sbjct:    4 QVATTKVPEV---RDITRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGLILEMIKDGQIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLSKERVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGTNYQSPHGIPIDMLDRLLIIATTPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFL 451          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A3M7SN78 (RuvB-like helicase OS=Brachionus plicatilis OX=10195 GN=BpHYR1_011185 PE=3 SV=1)

HSP 1 Score: 754.207 bits (1946), Expect = 0.000e+0
Identity = 357/467 (76.45%), Postives = 409/467 (87.58%), Query Frame = 2
Query:   98 MMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN 1498
            M  P++ DI   REITRMERIGAHSHIRGLG+ D LEPR  SQGMVGQ KARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFTSIA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPA+GTG+K GK+ LKTTEMETV+DLGQKMIES+ +EK+Q+GDII IDK +GR+TRLGRSFT+ARDYDA G QTKFVQCPEGE++K KEVVHTV LHEIDVINSR QG +ALFSGDTGEIKSEVRDQI+AKVAEWREEG+AE+VPGVLFIDEVHMLD+ECFSFLNRA+ESDMAPV +MATNRG+T+IRGT  +SPHGIP DLLDRLLIIST PY ++EI QILKIRCEEEDVE S +ALT+LT IG ETSLRYSIQLITTANL  +KRKG EV + D+K+VYTLF+DE RS+ +L EY+  FL   +       ++M V+
Sbjct:    1 MTTPSVSDIKEVREITRMERIGAHSHIRGLGIDDSLEPRQVSQGMVGQKKARRAAGLILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGQDTPFTSIAGSEIFSLEMSKTEALTQAFRRSIGIRIKEETEIIEGEVVEIQIDRPASGTGAKVGKLTLKTTEMETVYDLGQKMIESLTQEKVQAGDIITIDKATGRITRLGRSFTRARDYDAMGPQTKFVQCPEGELQKRKEVVHTVTLHEIDVINSRTQGFLALFSGDTGEIKSEVRDQINAKVAEWREEGKAEIVPGVLFIDEVHMLDIECFSFLNRALESDMAPVFIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIISTTPYEENEIRQILKIRCEEEDVEMSDEALTVLTKIGKETSLRYSIQLITTANLASKKRKGTEVSIDDIKRVYTLFLDEARSSEFLKEYEQNFLFSEITPTAAGTEKMTVD 467          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A210QDU4 (RuvB-like helicase OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT01373 PE=3 SV=1)

HSP 1 Score: 742.265 bits (1915), Expect = 0.000e+0
Identity = 350/464 (75.43%), Postives = 407/464 (87.72%), Query Frame = 2
Query:   98 MMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEM 1489
            M  PT+  +   RE+TR+ERIGAHSHIRGLGL D L+ R  SQGMVGQ+ ARRAAG+ILEMIK+G +AGR  LIAG PGTGKTAIAM MAQALG DTPFTSIA SEIFSLEMSKTE+LTQAFRKSIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLGQKMIES+ KEK+Q+GDII IDK +G++T+LGRSFT+ARDYDA GAQTKFVQCPEGE++K KEVVHTV LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI++KVAEWREEG+AE+VPGVLF+DEVHMLD+ECFSFLNRA+E DMAP+L+MATNRG+T+IRGT  +SPHGIP DLLDRLLII+T PY + EI QILKIRCEEEDVE + DALT+LT IGMETSLRY+IQLIT A+LVCRKRKG EV V D+K+VY+LF+DE RST +L EYQ EF+     E++G+   M
Sbjct:    1 MAAPTVEKVQEVREVTRIERIGAHSHIRGLGLDDALDARNVSQGMVGQVDARRAAGVILEMIKEGKIAGRACLIAGHPGTGKTAIAMAMAQALGTDTPFTSIAGSEIFSLEMSKTEALTQAFRKSIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTEMETIYDLGQKMIESLTKEKVQAGDIITIDKATGKITKLGRSFTRARDYDAMGAQTKFVQCPEGELQKRKEVVHTVTLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINSKVAEWREEGKAEIVPGVLFVDEVHMLDIECFSFLNRALEDDMAPILIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIIATTPYDEKEIKQILKIRCEEEDVEMTDDALTVLTKIGMETSLRYAIQLITVASLVCRKRKGSEVDVDDIKRVYSLFLDESRSTQFLKEYQEEFM---FNEMSGTAQSM 461          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A151NKW1 (RuvB-like helicase OS=Alligator mississippiensis OX=8496 GN=RUVBL2 PE=3 SV=1)

HSP 1 Score: 740.725 bits (1911), Expect = 0.000e+0
Identity = 347/454 (76.43%), Postives = 404/454 (88.99%), Query Frame = 2
Query:  101 MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAME 1462
            M  T   +   R++TR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL ARRAAG+ILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEIFSLEMSKTE+LTQAFR+SIG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++T+LGRSFT+ARDYDA G+QTKFVQCP+GE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKVAEWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  RSPHGIP DLLDRLLIIST PY+  E  QILKIRCEEEDVE + DA T+LT IG+ETSLRY+IQLIT ANLVCRKRKG EV V D+K+VY+LF+DE RST Y+ EYQ  FL + ++
Sbjct:    1 MTTTTTKVPEVRDVTRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLAARRAAGVILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQALGLDTPFTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKEKVQAGDVITIDKATGKITKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEVIPGVLFIDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYRSPHGIPIDLLDRLLIISTSPYSDKETKQILKIRCEEEDVEMNEDAYTVLTRIGLETSLRYAIQLITAANLVCRKRKGTEVQVEDIKRVYSLFLDESRSTQYMKEYQDAFLFNELK 454          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A267FF67 (RuvB-like helicase (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003568g1 PE=3 SV=1)

HSP 1 Score: 739.569 bits (1908), Expect = 0.000e+0
Identity = 344/438 (78.54%), Postives = 398/438 (90.87%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            REITR+ERIGAHSHIRGLGL D L  R +S GMVGQL ARR+AG+ILEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEI+SLEMSKTE+LTQAFRKSIG+RIKE+TE+IEGEVVE+QIDRPAT +G+K GK+ LKTTEMET++DLGQKMIES+ KEK+Q+GD++ IDK SGR++RLGRSFT+ARDYDA G QTKFVQCPEGE++K KEVVHTV LHEIDVINSR QG +ALFSGDTGEIK+EVRDQI++KVAEWREEG+AE+VPGVLF+DEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLII+T PY + E+ QILKIRCEEEDVE S DALT+LT IGMETSLRY+IQLITTANLVCRKRKG EV V D+K+VY+LF+DE+RS  YL EYQ EF+
Sbjct:   18 REITRIERIGAHSHIRGLGLDDGLNARQTSHGMVGQLHARRSAGLILEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGQDTPFTAIAGSEIYSLEMSKTEALTQAFRKSIGVRIKEETEIIEGEVVEVQIDRPATASGAKVGKLTLKTTEMETIYDLGQKMIESLTKEKVQAGDVVTIDKASGRISRLGRSFTRARDYDATGGQTKFVQCPEGELQKRKEVVHTVTLHEIDVINSRTQGFLALFSGDTGEIKTEVRDQINSKVAEWREEGKAEIVPGVLFVDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIIATHPYKESEVKQILKIRCEEEDVEMSEDALTVLTKIGMETSLRYAIQLITTANLVCRKRKGLEVAVEDVKRVYSLFLDERRSEEYLKEYQQEFM 455          
BLAST of RuvB-like helicase vs. TrEMBL
Match: A0A1I8IJU7 (RuvB-like helicase OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 739.184 bits (1907), Expect = 0.000e+0
Identity = 344/438 (78.54%), Postives = 398/438 (90.87%), Query Frame = 2
Query:  134 REITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            REITR+ERIGAHSHIRGLGL D L  R +S GMVGQL ARR+AG+ILEMI++G +AGR +LIAGQPGTGKTAIAMGMAQALG DTPFT+IA SEI+SLEMSKTE+LTQAFRKSIG+RIKE+TE+IEGEVVE+QIDRPAT +G+K GK+ LKTTEMET++DLGQKMIES+ KEK+Q+GD++ IDK SGR++RLGRSFT+ARDYDA G QTKFVQCPEGE++K KEVVHTV LHEIDVINSR QG +ALFSGDTGEIK+EVRDQI++KVAEWREEG+AE+VPGVLF+DEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLII+T PY + E+ QILKIRCEEEDVE S DALT+LT IGMETSLRY+IQLITTANLVCRKRKG EV V D+K+VY+LF+DE+RS  YL EYQ EF+
Sbjct:   21 REITRIERIGAHSHIRGLGLDDGLNARQTSHGMVGQLHARRSAGLILEMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGQDTPFTAIAGSEIYSLEMSKTEALTQAFRKSIGVRIKEETEIIEGEVVEVQIDRPATASGAKVGKLTLKTTEMETIYDLGQKMIESLTKEKVQAGDVVTIDKASGRISRLGRSFTRARDYDATGGQTKFVQCPEGELQKRKEVVHTVTLHEIDVINSRTQGFLALFSGDTGEIKTEVRDQINSKVAEWREEGKAEIVPGVLFVDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIIATHPYKESEVKQILKIRCEEEDVEMSEDALTVLTKIGMETSLRYAIQLITTANLVCRKRKGLEVAVEDVKRVYSLFLDERRSEEYLKEYQQEFM 458          
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:103024854])

HSP 1 Score: 726.087 bits (1873), Expect = 0.000e+0
Identity = 337/451 (74.72%), Postives = 405/451 (89.80%), Query Frame = 2
Query:   95 QMMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            QM    +P++   R+ITR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL +RRAAG+ILEMIKDG++AGR +LIAGQPGTGKTAIAMG+AQ+LG DTPFT++A SEIFSLEMSKTE+L+QAFRK+IG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTT+MET++DLG KMIES+ KEK+Q+GD+I IDK +G++++LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKV+EWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESD++PVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLII+T PYT+ E  QILKIRCEEEDVE S +A T+LT IG ETSLRY+IQLI+TA LVCRKR+G EV V D+K+VY+LF+DE RS+ Y+ EYQ  FL
Sbjct:    4 QMAATKVPEV---RDITRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGLILEMIKDGHIAGRAVLIAGQPGTGKTAIAMGIAQSLGSDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTDMETIYDLGSKMIESLSKEKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVSEWREEGKAEIIPGVLFIDEVHMLDIECFSFLNRALESDLSPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIIATSPYTEKETRQILKIRCEEEDVELSDEAHTVLTRIGQETSLRYAIQLISTAGLVCRKRRGTEVQVEDIKRVYSLFLDESRSSQYMKEYQDSFL 451          
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Match: ruvbl1 (RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:103040048])

HSP 1 Score: 380.563 bits (976), Expect = 1.291e-127
Identity = 201/455 (44.18%), Postives = 292/455 (64.18%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI +HSH++GLGL D    + ++ G+VGQ  AR A GII+E+I+   +AGR +L+AG PGTGKTA+A+ MAQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     V+  LKT +      L   + ES+ KE+++ GD+I I+  SG V R GR  T A ++D      ++V  P+G++ K KE++  V LH++DV N+R QG       +  L      EI  ++R +I+  V  + ++G AELVPGVLF+DEVHMLD+ECF++L+RA+ES +AP++V A+NRG   IRGT+   SPHGIP DLLDR++II T+ YT  E+ QI+KIR + E +  S DAL+ L  IG +T+LRY++QL+T ANL+ R +  + V    ++++  LF D K S   L +  ++F+
Sbjct:    3 IEEVKSTTKTQRIASHSHVKGLGLDDAGNAKQTASGLVGQEAAREACGIIVELIRSKKMAGRAVLLAGPPGTGKTALALAMAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTGKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDL--EAEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRGEINKVVNRYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVVFASNRGNCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEDALSHLGEIGTKTTLRYAVQLLTPANLLARVQGKEGVEREQVEEINELFYDAKSSAKILQDQHTKFM 455          
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Match: ENSAMXT00000037950.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001109.1:67005:74787:-1 gene:ENSAMXG00000034735.1 transcript:ENSAMXT00000037950.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 1.561e-8
Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPR 214
            +   R+ITR+ERIGAHSHIRGLGL D LEPR
Sbjct:   15 VPEVRDITRIERIGAHSHIRGLGLDDALEPR 45          
BLAST of RuvB-like helicase vs. Ensembl Sea Lamprey
Match: ruvbl1 (RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:317679])

HSP 1 Score: 204.912 bits (520), Expect = 1.002e-62
Identity = 110/252 (43.65%), Postives = 157/252 (62.30%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG 862
            I   R  T+ +RI  HSH++GLGL +    + ++ G+VGQ   R A GII+E+I+   +AGR +L+AG PGTGKTA+A+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV+EL   + + P  G G     V+  LKT +      L   + ES+ KEK++ GD+I I+  SG V R GR  T A ++D      ++V  P+G++ K KEV+  V LH++DV N+R QG
Sbjct:    3 IEEVRSTTKTQRIAVHSHVKGLGLDEAGFAKANAAGLVGQEMGREACGIIVELIRSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPMVGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVMELSPCETENPMGGYGKTISHVIISLKTAKGTKQLKLDPSIYESLQKEKVEVGDVIYIEANSGAVKRQGRCDTFATEFDL--EAEEYVPLPKGDVHKKKEVIQDVTLHDLDVANARPQG 252          
BLAST of RuvB-like helicase vs. Ensembl Yeast
Match: RVB2 (ATP-dependent DNA helicase, also known as reptin; member of the AAA+ and RuvB protein families, similar to Rvb1p; conserved component of multiple complexes including the INO80 complex, the Swr1 complex, and the R2TP complex (Rvb1-Rvb2-Tah1-Pih1); involved in multiple processes such as chromatin remodeling, box C/D snoRNP assembly, and RNA polymerase II assembly [Source:SGD;Acc:S000006156])

HSP 1 Score: 613.224 bits (1580), Expect = 0.000e+0
Identity = 284/451 (62.97%), Postives = 367/451 (81.37%), Query Frame = 2
Query:  101 MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTD 1453
            M+    D     ++  +  I AHSHI GLGL ++L+PR +S+GMVGQL+ARRAAG+IL+M+++G +AGR +L+AG P TGKTA+AMG++Q+LG D PFT+IA SEIFSLE+SKTE+LTQAFRKSIG++IKE+TE+IEGEVVE+QIDR  TG G K GK+ +KTT+MET+++LG KMI+ + KEK+ +GD+I IDK SG++T+LGRSF ++RDYDA GA T+FVQCPEGE++K K VVHTV+LHEIDVINSR QG +ALF+GDTGEI+SEVRDQI+ KVAEW+EEG+AE+VPGVLFIDEVHMLD+ECFSF+NRA+E + AP+++MATNRGV+K RGT  +SPHG+P DLLDR +II+T  Y + EI  IL IR +EE+VE SSDAL LLT  G+ETSLRYS  LI+ A  +  KRK   V V D+K+ Y LF+D  RS  Y+ E +S+++ D
Sbjct:    1 MSIQTSDPNETSDLKSLSLIAAHSHITGLGLDENLQPRPTSEGMVGQLQARRAAGVILKMVQNGTIAGRAVLVAGPPSTGKTALAMGVSQSLGKDVPFTAIAGSEIFSLELSKTEALTQAFRKSIGIKIKEETELIEGEVVEIQIDRSITG-GHKQGKLTIKTTDMETIYELGNKMIDGLTKEKVLAGDVISIDKASGKITKLGRSFARSRDYDAMGADTRFVQCPEGELQKRKTVVHTVSLHEIDVINSRTQGFLALFTGDTGEIRSEVRDQINTKVAEWKEEGKAEIVPGVLFIDEVHMLDIECFSFINRALEDEFAPIVMMATNRGVSKTRGTNYKSPHGLPLDLLDRSIIITTKSYNEQEIKTILSIRAQEEEVELSSDALDLLTKTGVETSLRYSSNLISVAQQIAMKRKNNTVEVEDVKRAYLLFLDSARSVKYVQENESQYIDD 450          
BLAST of RuvB-like helicase vs. Ensembl Yeast
Match: RVB1 (ATP-dependent DNA helicase, also known as pontin; member of the AAA+ and RuvB-like protein families; similar to Rvb2p; conserved component of multiple complexes including the INO80 complex, the Swr1 complex, and the R2TP complex (Rvb1-Rvb2-Tah1-Pih1); involved in multiple processes such as chromatin remodeling, box C/D snoRNP assembly, and RNA polymerase II assembly [Source:SGD;Acc:S000002598])

HSP 1 Score: 370.933 bits (951), Expect = 9.653e-125
Identity = 196/444 (44.14%), Postives = 292/444 (65.77%), Query Frame = 2
Query:  155 RIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG---VIA----LFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            R  AH+HI+GLGL +    +    G VGQ++AR A G+I+++IK   ++GR IL+AG P TGKTA+A+ ++Q LGP  PF  +  SE++S+E+ KTE+L + FR++IGLRIKE  EV EGEV EL     + P  G G     V+  LK+ +      L   + ES+ +EK+  GD+I I+  +G V R+GRS   A ++D      ++V  P+GE+ K KE+V  V LH++DV N+R QG   VI+    L      EI  ++R +++  VA++ ++G AEL+PGVLFIDEV+MLD+E F++LN+A+ES++APV+V+A+NRG+T +RGT+   SPHG+P DL+DRLLI+ T+PY KDEI  I++ R   E ++  S AL LL ++G ETSLRY++QL+    ++ +    +E+ V D+ +   LF+D KRST  L E  + +L
Sbjct:   23 RTAAHTHIKGLGLDESGVAKRVEGGFVGQIEAREACGVIVDLIKAKKMSGRAILLAGGPSTGKTALALAISQELGPKVPFCPLVGSELYSVEVKKTETLMENFRRAIGLRIKETKEVYEGEVTELTPEDAENPLGGYGKTISHVIVGLKSAKGTKTLRLDPTIYESIQREKVSIGDVIYIEANTGAVKRVGRSDAYATEFDL--ETEEYVPLPKGEVHKKKEIVQDVTLHDLDVANARPQGGQDVISMMGQLLKPKKTEITEKLRQEVNKVVAKYIDQGVAELIPGVLFIDEVNMLDIEIFTYLNKALESNIAPVVVLASNRGMTTVRGTEDVISPHGVPPDLIDRLLIVRTLPYDKDEIRTIIERRATVERLQVESSALDLLATMGTETSLRYALQLLAPCGILAQTSNRKEIVVNDVNEAKLLFLDAKRSTKIL-ETSANYL 463          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO40477 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S760])

HSP 1 Score: 387.882 bits (995), Expect = 5.570e-131
Identity = 197/454 (43.39%), Postives = 295/454 (64.98%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFS-------GDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI AHSHI+GLGL ++      + G+VGQ  AR  +G+I+++I+   +AGR +L+AG PGTGKTA+A+ +AQ LGP  PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     VV  LKT +      L   + ES+ KEK+++GD+I I+  SG V R GRS T A ++D    +  +V  P+G++ K KE+V  V LH++D+ N+R QG   + S           EI  ++R +I+  V ++ ++G AELVPGVLF+DEVHMLD+ECF++L+RA+ES ++P+++ ATNRG   IRGT+  +PHGIP DLLDR++I+ T+PY++DE+ QI+KIR + E ++   ++L LL   G +T+LRY++QL+T ANL+ R      +   D++++  LF D K S   L E   +++
Sbjct:    3 IEEVKSTTKTQRIAAHSHIKGLGLDENGFAHPMASGLVGQETAREGSGVIVDLIRSKKMAGRAVLLAGPPGTGKTALALAIAQELGPKVPFCPMVGSEVYSTEVKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTVSHVVIGLKTAKGTKQLKLDPSIYESLQKEKVEAGDVIYIEANSGAVKRQGRSDTFATEFDLEAEE--YVPLPKGDVHKKKELVQDVTLHDLDIANARPQGGQDILSMMEQLTRSKKTEITDKLRKEINKVVNKYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESTISPIVIFATNRGNCTIRGTEISAPHGIPLDLLDRVMIVRTLPYSQDEMMQIIKIRAQIEGIQVDDESLELLGETGTKTTLRYAVQLLTPANLLARINGRDTINKGDVEEINELFYDAKSSAKLLAEQADKYM 454          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO39842 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8Z2])

HSP 1 Score: 355.91 bits (912), Expect = 3.564e-117
Identity = 170/269 (63.20%), Postives = 201/269 (74.72%), Query Frame = 2
Query:  665 DIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVT 1471
            DII IDK +G++++LGRSFT+ARDYDA G QTKFVQCPEGE++K KEVVHTV LHEIDVINSR QG +ALF+GDTGEIKSEVR+QI++KVAEWREEG+A++VPGVLF+DEVHMLD+ECFSFLNRA+ESDMAPVL+MATNRG+TK                                        CEEEDVE S DA+ +LT I  ETSLRYSIQLIT A+LVCRKRKG EV + D+K+VY+LF DE RST +L EYQ EF+ +   E T
Sbjct:  315 DIITIDKATGKISKLGRSFTRARDYDAMGPQTKFVQCPEGELQKRKEVVHTVTLHEIDVINSRTQGFLALFAGDTGEIKSEVREQINSKVAEWREEGKADIVPGVLFVDEVHMLDIECFSFLNRALESDMAPVLIMATNRGITK----------------------------------------CEEEDVEMSDDAMMVLTKIAQETSLRYSIQLITAASLVCRKRKGTEVAMDDIKRVYSLFFDESRSTQFLKEYQQEFMFNEESETT 543          

HSP 2 Score: 288.886 bits (738), Expect = 3.072e-91
Identity = 140/176 (79.55%), Postives = 159/176 (90.34%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKE 649
            +   R+ITR+ERIGAHSHIRGLGL D LE R  SQGMVGQ+ ARRAAGIILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQ+LGPDTPFTSIA SEIFSLEMSKTE+LTQAFRKSIG+RIKE+TE+IEGEVVE+QIDRP TGTG+K GK+ LKTTEMET++DLG KMIES+ K+
Sbjct:    9 VQEVRDITRIERIGAHSHIRGLGLDDALEARQVSQGMVGQVTARRAAGIILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMSKTEALTQAFRKSIGVRIKEETEIIEGEVVEVQIDRPTTGTGAKVGKLTLKTTEMETIYDLGTKMIESLTKD 184          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO26041 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD16])

HSP 1 Score: 157.532 bits (397), Expect = 6.791e-47
Identity = 78/93 (83.87%), Postives = 83/93 (89.25%), Query Frame = 2
Query:  161 GAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSK 439
            GAHSHIRGLGL D LE R  SQGMVGQ+ ARRAAGIILEMIK+G +AGR +LIAGQPGTGKTAIAMGMAQ+LGPDTPFTSIA SEIFSLEM K
Sbjct:    1 GAHSHIRGLGLDDALEARQVSQGMVGQVTARRAAGIILEMIKEGKIAGRAVLIAGQPGTGKTAIAMGMAQSLGPDTPFTSIAGSEIFSLEMRK 93          
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Match: EDO27251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9S2])

HSP 1 Score: 115.546 bits (288), Expect = 9.250e-31
Identity = 55/85 (64.71%), Postives = 65/85 (76.47%), Query Frame = 2
Query: 1217 CEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVT 1471
            CEEEDVE S DA+ +LT I  ETSLRYSIQLIT A+LVCRKRKG EV + D+K+VY+LF DE RST +L EYQ EF+ +   E T
Sbjct:   31 CEEEDVEMSDDAMMVLTKIAQETSLRYSIQLITAASLVCRKRKGTEVAMDDIKRVYSLFFDESRSTQFLKEYQQEFMFNEESETT 115          
BLAST of RuvB-like helicase vs. Ensembl Medaka
Match: ruvbl2 (RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:101172354])

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 341/450 (75.78%), Postives = 405/450 (90.00%), Query Frame = 2
Query:   98 MMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            M    +P++   R+ITR+ERIGAHSHIRGLGL D LEPR  SQGMVGQL +RRAAGIILEMIKDG++AGR +LIAGQPGTGKTAIAMG+AQ+LGPDTPFT++A SEIFSLEMSKTE+L+QAFRK+IG+RIKE+TE+IEGEVVE+QIDRPATGTG+K GK+ LKTTEMET++DLG KMIES+ KEK+Q+GD+I IDK +G++++LGRSFT+ARDYDA GAQT+FVQCPEGE++K KEVVHTV+LHEIDVINSR QG +ALFSGDTGEIKSEVR+QI+AKV EWREEG+AE++PGVLFIDEVHMLD+ECFSFLNRA+ESD++PVL+MATNRG+T+IRGT  +SPHGIP DLLDRLLII+T PYT+ E  QILKIRCEEEDVE S +A T+LT IGMETSLRY+IQLI+TA LVCRKRKG EV V D+K+VY+LF+DE RS+ Y+ EYQ  FL
Sbjct:    1 MATTKVPEV---RDITRIERIGAHSHIRGLGLDDALEPRQVSQGMVGQLASRRAAGIILEMIKDGHIAGRAVLIAGQPGTGKTAIAMGIAQSLGPDTPFTALAGSEIFSLEMSKTEALSQAFRKAIGVRIKEETEIIEGEVVEIQIDRPATGTGAKVGKLTLKTTEMETIYDLGNKMIESLSKEKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGAQTQFVQCPEGELQKRKEVVHTVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVCEWREEGKAEIIPGVLFIDEVHMLDMECFSFLNRALESDLSPVLIMATNRGITRIRGTNYQSPHGIPIDLLDRLLIIATSPYTEKETRQILKIRCEEEDVELSEEAHTVLTRIGMETSLRYAIQLISTAGLVCRKRKGTEVQVEDIKRVYSLFLDEARSSQYMKEYQDSFL 447          
BLAST of RuvB-like helicase vs. Ensembl Medaka
Match: ruvbl1 (RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:101175391])

HSP 1 Score: 374.4 bits (960), Expect = 3.321e-125
Identity = 200/455 (43.96%), Postives = 291/455 (63.96%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+ +RI +HSH++GLGL +    + ++ G+VGQ  AR A GII+E+I+   +AGR IL+AG PGTGKTA+A+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV EL   + + P  G G     V+  LKT +      L   + ES+ KE+++ GD+I I+  SG V R GR  T A ++D      ++V  P+G++ K KE+V  V LH++DV N+R QG       +  L      EI  ++R +I+  V  + ++G AELVPGVLF+DEVHMLD+ECF++L+RA+ES +AP++V A+NRG   IRGT+   SPHGIP DLLDR++II T+ YT  E+ QI+KIR + E +  S DAL+ L  IG +T+LRY++QL+T  +L+ R +  + V    ++++  LF D K S   L + Q +F+
Sbjct:    3 IEEVKSTTKTQRIASHSHVKGLGLDEAGNAKQTACGLVGQEAAREACGIIVELIQAKKMAGRAILLAGPPGTGKTALALAIAQELGNKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISHVIIGLKTAKGTKQLKLDPSIYESLQKERVEVGDVIYIEANSGAVKRQGRCDTFATEFDL--EAEEYVPLPKGDVHKKKEIVQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLRAEINKVVNRYIDQGVAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVVFASNRGKCLIRGTEDISSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGISISEDALSHLAEIGTKTTLRYAVQLLTPGSLLGRVQGKETVEREQVEEINELFYDAKSSAKILQDQQHKFM 455          
BLAST of RuvB-like helicase vs. Planmine SMEST
Match: SMESG000033997.1 (SMESG000033997.1)

HSP 1 Score: 949.503 bits (2453), Expect = 0.000e+0
Identity = 466/466 (100.00%), Postives = 466/466 (100.00%), Query Frame = 2
Query:  101 MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN 1498
            MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN
Sbjct:    1 MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN 466          
BLAST of RuvB-like helicase vs. Planmine SMEST
Match: SMESG000018207.1 (SMESG000018207.1)

HSP 1 Score: 939.102 bits (2426), Expect = 0.000e+0
Identity = 466/480 (97.08%), Postives = 466/480 (97.08%), Query Frame = 2
Query:  101 MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRK--------------GQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN 1498
            MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRK              GQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN
Sbjct:    1 MNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPATGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKVVIWKYFIDLALIQGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFLTDAMEEVTGSGDEMVVN 480          
BLAST of RuvB-like helicase vs. Planmine SMEST
Match: SMESG000031725.1 (SMESG000031725.1)

HSP 1 Score: 364.385 bits (934), Expect = 1.699e-121
Identity = 200/457 (43.76%), Postives = 290/457 (63.46%), Query Frame = 2
Query:  122 ITAAREITRMERIGAHSHIRGLGLSDDLE--PRISSQGMVGQLKARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFTSIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVEL---QIDRPATGTGSKTGKVV--LKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGRVTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVINSRAQG-------VIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEVHMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQ-TRSPHGIPFDLLDRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRYSIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL 1447
            I   +  T+  RI +HSH++GLGL ++    P ++S G+VGQ +AR AAG+I EMIK   +AGR +L+AG PGTGKTAIA+ +AQ LG   PF  +  SE++S E+ KTE L + FR++IGLRIKE  EV EGEV E+   Q D P++  G     V+  LKT +      +   + E++ KEK++ GD+I I+  SG V R GRS   + +YD      ++V  P+G+  K KEVV  V LH++DV N+  QG       +  L      EI  ++R  ID  V ++ ++G AELVPGVLFIDEVHMLD+ECF++L+RA+E  +AP+++ ATNRGV  ++GT+  +S HGIP DLLDR+LII T  Y KD   +ILKIR + E+V+ S +A   L SI  +T+LRY++QL+T A+ + +    + V +  + +   LF++ KRS   LN  + +++
Sbjct:    3 IEEVKSTTKTHRIASHSHVKGLGLDENGNSIPGVAS-GLVGQYEAREAAGVITEMIKAKKLAGRAVLLAGPPGTGKTAIALAIAQELGSKVPFCPMVGSEVYSSEIKKTEVLMENFRRAIGLRIKEVKEVYEGEVTEITPVQADNPSSSYGKTISHVMICLKTAKGTKSLKMDPLIYENLQKEKVEVGDVIYIEVSSGAVKRQGRSDVYSNEYDL--EADEYVPLPKGDAHKKKEVVQDVTLHDLDVANAYPQGGQDIASMMGQLMKQKKTEITDKLRRDIDKIVNKYIDQGTAELVPGVLFIDEVHMLDLECFTYLSRALEYSIAPIVIFATNRGVCSVKGTEDIKSSHGIPQDLLDRILIIKTKTYDKDACLEILKIRAQLENVKISHEASIKLASIADQTTLRYALQLLTPASKISKICSKETVTIEHVLEAEELFLNAKRSAQILNSEKEKYM 456          
The following BLAST results are available for this feature:
BLAST of RuvB-like helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RUVBL20.000e+075.56RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL20.000e+077.71RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL20.000e+077.71RuvB like AAA ATPase 2 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL16.805e-12643.08RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGN... [more]
RUVBL16.805e-12643.08RuvB like AAA ATPase 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ruvb-20.000e+059.00RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZ... [more]
ruvb-20.000e+059.00RuvB-like 2 [Source:UniProtKB/Swiss-Prot;Acc:Q9GZ... [more]
ruvb-15.409e-12144.98RuvB-like 1 [Source:UniProtKB/Swiss-Prot;Acc:O176... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
rept0.000e+071.97gene:FBgn0040075 transcript:FBtr0331852[more]
rept0.000e+071.97gene:FBgn0040075 transcript:FBtr0074988[more]
rept0.000e+071.97gene:FBgn0040075 transcript:FBtr0344993[more]
pont5.011e-11843.96gene:FBgn0040078 transcript:FBtr0082226[more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ruvbl20.000e+074.50RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:31767... [more]
ruvbl20.000e+075.28RuvB-like AAA ATPase 2 [Source:NCBI gene;Acc:31767... [more]
ruvbl16.560e-12544.18RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:31767... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ruvbl20.000e+075.38RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
ruvbl20.000e+076.00RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
ruvbl20.000e+074.83RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
ruvbl20.000e+077.19RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
ruvbl20.000e+077.14RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:44814... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ruvbl20.000e+075.56RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Ruvbl20.000e+075.56RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Ruvbl29.693e-12770.80RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
Ruvbl13.642e-12643.08RuvB-like protein 1 [Source:MGI Symbol;Acc:MGI:192... [more]
Ruvbl25.013e-11976.28RuvB-like protein 2 [Source:MGI Symbol;Acc:MGI:134... [more]
back to top
BLAST of RuvB-like helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DE27|RUVB2_XENLA0.000e+075.38RuvB-like 2 OS=Xenopus laevis OX=8355 GN=ruvbl2 PE... [more]
sp|Q9Y230|RUVB2_HUMAN0.000e+075.56RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2 PE=1... [more]
sp|Q9WTM5|RUVB2_MOUSE0.000e+075.56RuvB-like 2 OS=Mus musculus OX=10090 GN=Ruvbl2 PE=... [more]
sp|Q2TBU9|RUVB2_BOVIN0.000e+075.56RuvB-like 2 OS=Bos taurus OX=9913 GN=RUVBL2 PE=2 S... [more]
sp|P83571|RUVB2_DANRE0.000e+074.50RuvB-like 2 OS=Danio rerio OX=7955 GN=ruvbl2 PE=1 ... [more]
back to top
BLAST of RuvB-like helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7SN780.000e+076.45RuvB-like helicase OS=Brachionus plicatilis OX=101... [more]
A0A210QDU40.000e+075.43RuvB-like helicase OS=Mizuhopecten yessoensis OX=6... [more]
A0A151NKW10.000e+076.43RuvB-like helicase OS=Alligator mississippiensis O... [more]
A0A267FF670.000e+078.54RuvB-like helicase (Fragment) OS=Macrostomum ligna... [more]
A0A1I8IJU70.000e+078.54RuvB-like helicase OS=Macrostomum lignano OX=28230... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ruvbl20.000e+074.72RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:10302... [more]
ruvbl11.291e-12744.18RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:10304... [more]
ENSAMXT00000037950.11.561e-874.19pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ruvbl11.002e-6243.65RuvB-like AAA ATPase 1 [Source:NCBI gene;Acc:31767... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RVB20.000e+062.97ATP-dependent DNA helicase, also known as reptin; ... [more]
RVB19.653e-12544.14ATP-dependent DNA helicase, also known as pontin; ... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO404775.570e-13143.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398423.564e-11763.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260416.791e-4783.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272519.250e-3164.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RuvB-like helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ruvbl20.000e+075.78RuvB like AAA ATPase 2 [Source:NCBI gene;Acc:10117... [more]
ruvbl13.321e-12543.96RuvB like AAA ATPase 1 [Source:NCBI gene;Acc:10117... [more]
back to top
BLAST of RuvB-like helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000033997.10.000e+0100.00SMESG000033997.1[more]
SMESG000018207.10.000e+097.08SMESG000018207.1[more]
SMESG000031725.11.699e-12143.76SMESG000031725.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025807 ID=SMED30025807|Name=RuvB-like helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=1544bp
TTTAGTGTTTTATACATAATTATTAGGAGATAGACTGAAAGTGAAAAATT
CATTTGTTTATATAACGTAAAATTTGAATTGTTTCTAAGATATACAAATG
ATGAATCCTACTATTCCCGATATAACTGCCGCTCGCGAAATCACAAGAAT
GGAGAGAATTGGCGCTCATTCTCACATTAGAGGCTTAGGATTAAGTGATG
ATTTAGAACCCCGAATTTCATCTCAGGGAATGGTTGGTCAGTTAAAAGCG
AGAAGGGCTGCTGGTATAATACTAGAAATGATAAAGGATGGGAATGTTGC
TGGAAGAACAATACTTATTGCTGGTCAACCAGGAACTGGTAAAACTGCTA
TTGCTATGGGTATGGCACAAGCTTTAGGCCCAGATACTCCATTTACATCC
ATAGCAGCAAGTGAAATTTTTTCATTGGAAATGAGTAAAACCGAATCATT
GACACAAGCATTTCGGAAATCTATTGGTCTTAGAATAAAAGAAGACACTG
AAGTAATAGAAGGTGAAGTCGTAGAGCTTCAAATTGACAGGCCTGCAACA
GGAACTGGTTCTAAAACTGGAAAAGTTGTTTTGAAAACAACTGAAATGGA
GACAGTTTTTGATTTAGGACAGAAAATGATTGAATCAATGTTGAAAGAAA
AAATTCAATCAGGAGATATTATTATAATTGACAAGAAATCGGGACGAGTA
ACGCGATTAGGTAGATCGTTTACCAAAGCTAGAGATTACGATGCTTGTGG
AGCTCAAACAAAATTTGTGCAGTGCCCAGAAGGTGAAATTGAAAAGCACA
AAGAAGTTGTGCACACTGTCAATTTACATGAAATTGATGTTATCAATTCT
CGTGCTCAAGGTGTGATTGCTTTATTCAGTGGTGATACTGGAGAAATCAA
AAGTGAAGTAAGAGATCAAATTGATGCCAAAGTTGCAGAATGGAGAGAAG
AAGGCCGTGCAGAACTTGTACCTGGTGTATTGTTTATTGACGAAGTTCAT
ATGCTTGATGTTGAGTGTTTTTCGTTTTTAAATCGAGCAATTGAAAGTGA
CATGGCTCCCGTTCTTGTGATGGCTACTAATCGAGGTGTTACAAAGATAA
GAGGTACTCAAACTCGCAGTCCTCACGGTATTCCATTTGATTTACTTGAC
CGATTGCTTATAATTTCCACTGTGCCATATACAAAGGATGAAATTTATCA
AATTTTGAAAATTAGATGTGAGGAAGAAGATGTGGAATTTTCAAGCGATG
CTCTCACTTTGTTGACATCAATCGGAATGGAAACCTCTTTGAGATATTCT
ATTCAGCTTATTACTACAGCAAATCTTGTGTGTCGCAAACGAAAGGGCCA
AGAAGTCGGAGTTACAGATCTGAAGAAAGTTTATACGCTTTTTATGGATG
AGAAAAGATCCACGGCATATTTAAACGAATATCAAAGTGAATTCCTAACT
GATGCCATGGAGGAAGTTACGGGTTCAGGAGATGAAATGGTCGTTAATTA
AATTTTATTACAAATATATTTTTGTACTGATGAAAAAAAAAGAT
back to top

protein sequence of SMED30025807-orf-1

>SMED30025807-orf-1 ID=SMED30025807-orf-1|Name=SMED30025807-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=468bp
MMNPTIPDITAAREITRMERIGAHSHIRGLGLSDDLEPRISSQGMVGQLK
ARRAAGIILEMIKDGNVAGRTILIAGQPGTGKTAIAMGMAQALGPDTPFT
SIAASEIFSLEMSKTESLTQAFRKSIGLRIKEDTEVIEGEVVELQIDRPA
TGTGSKTGKVVLKTTEMETVFDLGQKMIESMLKEKIQSGDIIIIDKKSGR
VTRLGRSFTKARDYDACGAQTKFVQCPEGEIEKHKEVVHTVNLHEIDVIN
SRAQGVIALFSGDTGEIKSEVRDQIDAKVAEWREEGRAELVPGVLFIDEV
HMLDVECFSFLNRAIESDMAPVLVMATNRGVTKIRGTQTRSPHGIPFDLL
DRLLIISTVPYTKDEIYQILKIRCEEEDVEFSSDALTLLTSIGMETSLRY
SIQLITTANLVCRKRKGQEVGVTDLKKVYTLFMDEKRSTAYLNEYQSEFL
TDAMEEVTGSGDEMVVN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0031011Ino80 complex
GO:0035267NuA4 histone acetyltransferase complex
GO:0097255R2TP complex
GO:0005634nucleus
Vocabulary: molecular function
TermDefinition
GO:00431395'-3' DNA helicase activity
GO:0003678DNA helicase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
GO:0043141ATP-dependent 5'-3' DNA helicase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000429neoblast
PLANA:0002056medial muscle cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042487RUVBL2_DII
IPR041048RuvB-like_C
IPR037942RUVBL2
IPR027238RuvB-like
IPR003593AAA+_ATPase
IPR010339TIP49_P-loop
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0032508DNA duplex unwinding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 68..360
e-value: 7.5E-9
score: 45.4
IPR010339TIP49, P-loop domainPFAMPF06068TIP49coord: 20..363
e-value: 6.4E-158
score: 525.5
NoneNo IPR availableGENE3DG3DSA:1.10.8.60coord: 362..461
e-value: 8.6E-38
score: 130.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 23..356
e-value: 2.2E-120
score: 403.3
IPR042487RuvB-like helicase 2, domain IIGENE3DG3DSA:2.40.50.360coord: 125..249
e-value: 2.2E-120
score: 403.3
IPR041048RuvB-like, AAA-lid domainPFAMPF17856TIP49_Ccoord: 369..434
e-value: 3.0E-25
score: 88.1
IPR037942RuvB-like helicase 2PANTHERPTHR11093:SF2RUVB-LIKE 2coord: 9..456
IPR027238RuvB-likePANTHERPTHR11093RUVB-RELATED REPTIN AND PONTINcoord: 9..456
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 40..431