TRAF-4

Overview
NameTRAF-4
Smed IDSMED30025805
Length (bp)3615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TRAF-4 (SMED30025805) t-SNE clustered cells

Violin plots show distribution of expression levels for TRAF-4 (SMED30025805) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TRAF-4 (SMED30025805) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TRAF-4 (SMED30025805) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30025805h1SMcG0019359 SmedASXL_007315SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025805h1SMcG0019359 SmedASXL_012725SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X1 cellSMED30025805h1SMcG0019359 SmedASXL_012726SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TRAF-4 vs. Ensembl Human
Match: TRAF2 (TNF receptor associated factor 2 [Source:HGNC Symbol;Acc:HGNC:12032])

HSP 1 Score: 48.1358 bits (113), Expect = 6.594e-6
Identity = 23/86 (26.74%), Postives = 42/86 (48.84%), Query Frame = 1
Query:  307 LCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKK----IIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCL 552
            LC+ C  +L    Q +CG R+C  C+ + +++  + C     E I +    I++ ++   D AA + +  +P  CP   CT+   L
Sbjct:   33 LCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTL 118          
BLAST of TRAF-4 vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 52.373 bits (124), Expect = 3.285e-6
Identity = 38/138 (27.54%), Postives = 57/138 (41.30%), Query Frame = 1
Query:  259 MKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGC--CQAKYNASDIQCHLTED 666
            ++ Y    +P       C IC   L  A Q  CG RFC  CI   +      CP +++     I+ +N +  D  A + +  + VKCP   C     L     H++ H + C F L  C  CQ  +    +  H+ ED
Sbjct:   53 IQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNE-----ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMEL----RHLEDHQVHCEFALVNCPQCQRPFQKCQVNTHIIED 181          
BLAST of TRAF-4 vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.436e-20
Identity = 56/169 (33.14%), Postives = 90/169 (53.25%), Query Frame = 1
Query:  253 KLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKK-IIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHML---DCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVKIDLKNSQKNEI 747
            +L+  Y+F +      +L C +C  +LVNA Q+ CGCRFC KCI  +++  N  CPG + EC ++ +   +NI  DY  N++++ + VKCP  +C     L++I  H++   +   +CPF + GC Q K    D+  HL      H  LI   I+N++ D       E+
Sbjct:    8 RLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEV 176          
BLAST of TRAF-4 vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.218e-17
Identity = 58/171 (33.92%), Postives = 90/171 (52.63%), Query Frame = 1
Query:  226 IEDKYKAVWKLMKKYSF-NINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSG----IPVKCPIGSCTYTDCLINISTHM---KSHMLDCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVK 714
            I  K   V +L+ KY+   ++   N DLLC +CNK++ +A ++ CGC +CY CI+ +++ N+  CPG+  EC +   D  N++ D   N RLS     I VKCP   C YT  L+ +  H+       ++CP V  GC +      ++  HLT+    H  LI  + N +K
Sbjct:    2 IPSKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKE---DYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELK 169          
BLAST of TRAF-4 vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 51.9878 bits (123), Expect = 3.370e-6
Identity = 34/126 (26.98%), Postives = 52/126 (41.27%), Query Frame = 1
Query:  217 MNSIEDKYKAVWKLMKKYSFNIN-PYDNRDLL---------CAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECI----KKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCL 552
            M S+ DK+K + +     S +   P  +R +L         C  C  +L    Q +CG RFC  C K   ++   PC     E I      ++       D AA + + G+P KCP   C++   L
Sbjct:    1 MVSLADKWKGMARQSLPSSVDSTLPGISRQVLSVSMEPKYQCQQCKGVLRKPFQAQCGHRFCVFCFKQLTSSGPIPCEACRAEGIFEMEHSMLSITEAFPDNAARREIDGLPAKCPNDGCSWNGTL 126          
BLAST of TRAF-4 vs. Ensembl Nematostella
Match: EDO29581 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T383])

HSP 1 Score: 60.077 bits (144), Expect = 3.565e-11
Identity = 27/83 (32.53%), Postives = 43/83 (51.81%), Query Frame = -3
Query: 2603 SSHHGIDYILISHNLFDYILISNYLIDFILIYNYLIDFILISDNFIDYILVFDNFIDYIRISDNFIDYILISNNFVEFIVIGN 2851
            ++H  IDYI  +H    YI  ++  ID+I   +  ID+I  +   IDYI      IDYI  +   IDYI  ++  +++I   +
Sbjct:    2 TAHTTIDYICTAHTTIHYICTAHTTIDYICTAHTTIDYICTAHTIIDYICTVHTTIDYICTAHTTIDYICTAHTTIDYICTAH 84          

HSP 2 Score: 52.7582 bits (125), Expect = 1.299e-8
Identity = 23/80 (28.75%), Postives = 38/80 (47.50%), Query Frame = -3
Query: 2585 LISHNLFDYILISNYLIDFILIYNYLIDFILISDNFIDYILVFDNFIDYIRISDNFIDYILISNNFVEFIVIGNNFFDFL 2824
              +H   DYI  ++  I +I   +  ID+I  +   IDYI      IDYI      IDYI  ++  +++I   +   D++
Sbjct:    1 CTAHTTIDYICTAHTTIHYICTAHTTIDYICTAHTTIDYICTAHTIIDYICTVHTTIDYICTAHTTIDYICTAHTTIDYI 80          
BLAST of TRAF-4 vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 50.0618 bits (118), Expect = 4.647e-6
Identity = 47/159 (29.56%), Postives = 70/159 (44.03%), Query Frame = 1
Query:  214 RMNSIEDKYKAVWKL---MKKYSFNINPYDNRDLLCAICNKILVNAHQ-NECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINIS-THMKSHMLDCPFVLFGC---CQAKYNASDIQCHLTED 666
            ++N+ EDK   + K+   + K  F   P++ R  LC +C  I V+  Q  ECG R C  C KT   +    CP  S +   KI D      D A    ++ +P +C I       C + +  T M +H  +C +    C   C AK+     Q HL +D
Sbjct:   20 QVNNDEDKMPEIEKVERPLTKNYFKKPPFEERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPEPKCPKCSGDLDDKIPDV-----DQAFENDMNELPCRC-INH--EWGCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKD 170          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000067108.1 (SMESG000067108.1)

HSP 1 Score: 1103.58 bits (2853), Expect = 0.000e+0
Identity = 593/650 (91.23%), Postives = 595/650 (91.54%), Query Frame = 1
Query:  211 FRMNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETXXXXXXXXXXXXXXXXXXVVRXXXXXXXXXXXXXXVSQLQLEYEEFRSFQEIVAHYQFENTEFRKIDRKIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQIQLVSETFSR---------------------------------------------------IDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLTQAMDEMKNNIDQLRNFEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSYSQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDLQKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKKYLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAGNEKLKEDMAKVNDKIDNDIQSMQKHLENNLIDHKKEIEEMKCAELEK 2007
             +MNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTE+NSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETKINKLELENEEFKKLNEKVVRLELENEELMKLNKMVSQLQLEYEEFRSFQEIVAHYQFENTEFRKID KIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQIQLVSETFSR                                                   IDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLTQAMDEMKNNIDQLR FEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSYSQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDLQKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKKYLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAGNEKLKEDMAKVNDKIDNDIQSM KHLENNLIDHKKEIEEMKCAELEK
Sbjct:   10 LKMNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTEENSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETKINKLELENEEFKKLNEKVVRLELENEELMKLNKMVSQLQLEYEEFRSFQEIVAHYQFENTEFRKIDGKIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQIQLVSETFSRIDEKVEQIQLVSETFSRIDEKVEQIQLVSETFSKIDEKVEQIQLVSEKLSKIDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLTQAMDEMKNNIDQLRKFEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSYSQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDLQKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKKYLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAGNEKLKEDMAKVNDKIDNDIQSMLKHLENNLIDHKKEIEEMKCAELEK 659          

HSP 2 Score: 814.683 bits (2103), Expect = 0.000e+0
Identity = 455/513 (88.69%), Postives = 464/513 (90.45%), Query Frame = 2
Query: 2015 DSLKKTASQCQADIEIVTSNLNDVHRDLLLLSSDYDATKSTNSASMEKFQESQLEIQLFIDNNIKKHIKSFESFTTINDSVQRLKNELSKLRVDFSLSYKNLISDIDNVKSDLNTQKSMDSKLQLQIANSNAEIALISKNFISNQLSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKEIISDHDKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNQDKINKIIVNQDKINKIIGNQDIIKKIMGNQDIINTMVR*L*H*FQGNLAMYFRENSNRSVIENSMICCHHKMTPTRNR*PTRIGLN**MIV*DEVAKEFHSLSKRFLNLRTECVNIKADIASQLAPKKPLQYREWSLGNFSKKLQKSKLDEEFCVMSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRLTISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGNSRFISNDSLLFRFIVKPS 3553
            DSLKKTASQCQADIEIVTSNLNDVHRDLLLLSSDYD+TKSTNSASMEKFQESQLEIQLFIDNN+KKHIKSFESFTTIND VQRLKNELSKLRVDFSLSYKNLISD+DNVKSDL TQKSMDSKLQLQIANSNAEIALISKNFISNQLSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKEIISDHDKFNKIIGNQDIINKIIGNPDIINKIIENQDIINKIIGNQDKINKIIVNQDKIN IIGNQDIIKKIMGNQDIINTM               F++  NR    N ++   +     +                DEVAKEFHSLSKRFLNLRTECVNIKADIASQLAPKKPLQYREWSLGNFSKKLQKSKLDEEFCVMSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRLTISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGNSRFISNDSLLFRFIVKPS
Sbjct:  662 DSLKKTASQCQADIEIVTSNLNDVHRDLLLLSSDYDSTKSTNSASMEKFQESQLEIQLFIDNNVKKHIKSFESFTTINDFVQRLKNELSKLRVDFSLSYKNLISDMDNVKSDLKTQKSMDSKLQLQIANSNAEIALISKNFISNQLSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKEIISDHDKFNKIIGNQDIINKIIGNPDIINKIIENQDIINKIIGNQDKINKIIVNQDKINNIIGNQDIIKKIMGNQDIINTMGE-------------FQQVCNRKF--NDLLSSQNDANKKQ----------------DEVAKEFHSLSKRFLNLRTECVNIKADIASQLAPKKPLQYREWSLGNFSKKLQKSKLDEEFCVMSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRLTISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGNSRFISNDSLLFRFIVKPS 1143          

HSP 3 Score: 55.4546 bits (132), Expect = 3.104e-7
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 1
Query: 2893 GEFQQVCNRKFNDLLSSQNDANKKQ 2967
            GEFQQVCNRKFNDLLSSQNDANKKQ
Sbjct:  938 GEFQQVCNRKFNDLLSSQNDANKKQ 962          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000067108.1 (SMESG000067108.1)

HSP 1 Score: 1103.58 bits (2853), Expect = 0.000e+0
Identity = 596/655 (90.99%), Postives = 599/655 (91.45%), Query Frame = 1
Query:  202 IRLF--RMNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETXXXXXXXXXXXXXXXXXXVVRXXXXXXXXXXXXXXVSQLQLEYEEFRSFQEIVAHYQFENTEFRKIDRKIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQIQLVSETFSR---------------------------------------------------IDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLTQAMDEMKNNIDQLRNFEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSYSQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDLQKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKKYLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAGNEKLKEDMAKVNDKIDNDIQSMQKHLENNLIDHKKEIEEMKCAELEK 2007
            IR+F  +MNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTE+NSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETKINKLELENEEFKKLNEKVVRLELENEELMKLNKMVSQLQLEYEEFRSFQEIVAHYQFENTEFRKID KIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQIQLVSETFSR                                                   IDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLTQAMDEMKNNIDQLR FEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSYSQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDLQKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKKYLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAGNEKLKEDMAKVNDKIDNDIQSM KHLENNLIDHKKEIEEMKCAELEK
Sbjct:   26 IRIFDVKMNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTEENSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETKINKLELENEEFKKLNEKVVRLELENEELMKLNKMVSQLQLEYEEFRSFQEIVAHYQFENTEFRKIDGKIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQIQLVSETFSRIDEKVEQIQLVSETFSRIDEKVEQIQLVSETFSKIDEKVEQIQLVSEKLSKIDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLTQAMDEMKNNIDQLRKFEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSYSQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDLQKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKKYLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAGNEKLKEDMAKVNDKIDNDIQSMLKHLENNLIDHKKEIEEMKCAELEK 680          

HSP 2 Score: 814.298 bits (2102), Expect = 0.000e+0
Identity = 455/513 (88.69%), Postives = 464/513 (90.45%), Query Frame = 2
Query: 2015 DSLKKTASQCQADIEIVTSNLNDVHRDLLLLSSDYDATKSTNSASMEKFQESQLEIQLFIDNNIKKHIKSFESFTTINDSVQRLKNELSKLRVDFSLSYKNLISDIDNVKSDLNTQKSMDSKLQLQIANSNAEIALISKNFISNQLSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKEIISDHDKFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNQDKINKIIVNQDKINKIIGNQDIIKKIMGNQDIINTMVR*L*H*FQGNLAMYFRENSNRSVIENSMICCHHKMTPTRNR*PTRIGLN**MIV*DEVAKEFHSLSKRFLNLRTECVNIKADIASQLAPKKPLQYREWSLGNFSKKLQKSKLDEEFCVMSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRLTISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGNSRFISNDSLLFRFIVKPS 3553
            DSLKKTASQCQADIEIVTSNLNDVHRDLLLLSSDYD+TKSTNSASMEKFQESQLEIQLFIDNN+KKHIKSFESFTTIND VQRLKNELSKLRVDFSLSYKNLISD+DNVKSDL TQKSMDSKLQLQIANSNAEIALISKNFISNQLSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKEIISDHDKFNKIIGNQDIINKIIGNPDIINKIIENQDIINKIIGNQDKINKIIVNQDKIN IIGNQDIIKKIMGNQDIINTM               F++  NR    N ++   +     +                DEVAKEFHSLSKRFLNLRTECVNIKADIASQLAPKKPLQYREWSLGNFSKKLQKSKLDEEFCVMSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRLTISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGNSRFISNDSLLFRFIVKPS
Sbjct:  683 DSLKKTASQCQADIEIVTSNLNDVHRDLLLLSSDYDSTKSTNSASMEKFQESQLEIQLFIDNNVKKHIKSFESFTTINDFVQRLKNELSKLRVDFSLSYKNLISDMDNVKSDLKTQKSMDSKLQLQIANSNAEIALISKNFISNQLSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKEIISDHDKFNKIIGNQDIINKIIGNPDIINKIIENQDIINKIIGNQDKINKIIVNQDKINNIIGNQDIIKKIMGNQDIINTMGE-------------FQQVCNRKF--NDLLSSQNDANKKQ----------------DEVAKEFHSLSKRFLNLRTECVNIKADIASQLAPKKPLQYREWSLGNFSKKLQKSKLDEEFCVMSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRLTISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGNSRFISNDSLLFRFIVKPS 1164          

HSP 3 Score: 55.4546 bits (132), Expect = 3.279e-7
Identity = 25/25 (100.00%), Postives = 25/25 (100.00%), Query Frame = 1
Query: 2893 GEFQQVCNRKFNDLLSSQNDANKKQ 2967
            GEFQQVCNRKFNDLLSSQNDANKKQ
Sbjct:  959 GEFQQVCNRKFNDLLSSQNDANKKQ 983          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000067208.1 (SMESG000067208.1)

HSP 1 Score: 142.895 bits (359), Expect = 7.369e-36
Identity = 64/166 (38.55%), Postives = 102/166 (61.45%), Query Frame = 1
Query:  226 IEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVKIDL 723
            +  K+  +W L+ KY+F +   + RDL+C IC ++L+NAHQ+ CGCR+CYKCI+ ++    K CPG  + C +++I   +IQ D+ AN ++S   VKCP   C + D L  + +H+KSH + CP+   GC +   N +DI  HL  ++  H NL+   I N++ D+
Sbjct:    1 MSSKHDNLWDLLVKYNFEVTGKNYRDLICVICKRLLINAHQSCCGCRYCYKCIEKYLEDKKKLCPGKGEGCNEQLISLFDIQVDHVANVKISKATVKCPDTICQFKDELRKMESHIKSHQIKCPYFEIGCSKVDINNADINNHLNIEHGNHANLLIDSIQNMRNDI 166          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000016849.1 (SMESG000016849.1)

HSP 1 Score: 130.954 bits (328), Expect = 1.281e-32
Identity = 69/183 (37.70%), Postives = 111/183 (60.66%), Query Frame = 1
Query:  244 AVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIID-KNNIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMK---SHMLDCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQ-FIEL 777
            + WK+M+KY F I+   N D  C ICN+++++A    CGCRFC  CIK ++  N+K CPG S +C KK+I+ +N+I  D   N R+S I VKCP+ +C + + +  I  H++      + CPF+ FGC   +    +++ HL+ D+  H  L+  +IN  + +++ S KNEI ++ K+ FI L
Sbjct:    4 STWKIMRKYKFEIDYPINNDFSCGICNELMIHASSAPCGCRFCADCIKNYLIGNDKFCPGKSKDCNKKMINYQNDILSDNPVNIRISRISVKCPMRNCQFRNEMSLIENHIRICDQRPISCPFLEFGCPANEMVKDEMKNHLSTDSYGHNKLLIGFINIFQSEIE-SIKNEIIEVKKEDFINL 185          
BLAST of TRAF-4 vs. Planmine SMEST
Match: SMESG000070155.1 (SMESG000070155.1)

HSP 1 Score: 131.339 bits (329), Expect = 3.240e-32
Identity = 67/168 (39.88%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  247 VWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCRFCYKCIKTFMATNNKPCPGNSDECIKKIIDKN-NIQEDYAANKRLSGIPVKCPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTEDNSAHYNLIFQYINNVKIDLKNSQKNEI 747
             W L+ K+ F  +   + DLLC+IC  IL  A QN CGCR+CY CI+ ++  N K CP N   C KK+I+ N +I  D+ ANK++  I VKCP   C ++D LI ++ HMKSH + CP+   GC +++ +  +I+ HLT +  +H NL+ + I N+  ++   ++N I
Sbjct:    9 AWNLLNKFDFVFDSNLSDDLLCSICKNILHIASQNICGCRYCYHCIEKYLNGNEKFCPKNIGNC-KKLINFNRDITIDHFANKKILSIKVKCPELFCQFSDSLIVMADHMKSHSIKCPYAEVGCIESRMDTHNIKDHLTNETYSHTNLLIESIRNLSNEINFLKENAI 175          
The following BLAST results are available for this feature:
BLAST of TRAF-4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
TRAF26.594e-626.74TNF receptor associated factor 2 [Source:HGNC Symb... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf63.285e-627.54TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TRAF-4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
I1ZID82.436e-2033.14TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1011.218e-1733.92TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TRAF-4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
traf2b3.370e-626.98TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO295813.565e-1132.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328494.647e-629.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TRAF-4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TRAF-4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067108.13.104e-791.23SMESG000067108.1[more]
SMESG000067108.13.279e-790.99SMESG000067108.1[more]
SMESG000067208.17.369e-3638.55SMESG000067208.1[more]
SMESG000016849.11.281e-3237.70SMESG000016849.1[more]
SMESG000070155.13.240e-3239.88SMESG000070155.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025805 ID=SMED30025805|Name=TRAF-4|organism=Schmidtea mediterranea sexual|type=transcript|length=3615bp
AATTGTAAAAAATCCAAAAAAATAATTTTGTAAATTCATATTAATGAAAA
TAATTACTGACAAATTACGAGTTATTTATGTTATTATTTATTCATTGCAA
ACAGGTGTAGTAATAATCACGGTTTGGTTGATTTTGACCCCCACAGCCAA
ACAAGGCTGCCAACGTCTGCTCTATACTTTCCCCACTGAAATTTATAAAA
AATTAGATTATTTAGGATGAATTCAATCGAGGATAAATATAAAGCAGTTT
GGAAATTGATGAAAAAATATTCTTTCAACATAAATCCATATGACAATCGA
GATTTACTCTGTGCAATTTGTAATAAGATTTTAGTAAATGCCCATCAGAA
TGAGTGTGGCTGTAGGTTTTGCTATAAATGCATAAAAACGTTTATGGCAA
CTAATAATAAACCTTGTCCTGGAAACTCCGATGAATGTATTAAAAAAATT
ATTGATAAAAACAACATACAAGAGGATTATGCTGCAAATAAAAGGTTATC
AGGAATCCCTGTGAAATGTCCGATTGGATCTTGCACCTACACAGATTGTT
TAATCAATATCAGCACCCACATGAAAAGCCATATGCTAGATTGCCCATTT
GTATTGTTCGGTTGTTGCCAAGCTAAGTATAACGCCAGTGATATCCAGTG
CCATTTGACCGAAGATAACTCAGCACACTATAATCTGATTTTCCAATACA
TTAACAATGTGAAAATCGATTTGAAAAATTCACAAAAAAATGAAATCAAT
AAAATAGGCAAACAATTTATTGAACTTTATGAAAACCAAGAAACAAAAAT
CAATAAACTTGAATTGGAAAATGAAGAATTTAAGAAACTAAATGAAAAAG
TAGTTCGTCTTGAATTAGAGAATGAAGAATTGATGAAACTGAATAAAATG
GTTTCACAACTTCAATTGGAGTATGAAGAATTTAGGAGTTTCCAGGAAAT
AGTGGCGCATTATCAATTCGAGAATACAGAATTTAGAAAAATCGATAGAA
AGATAGAACAGCTTCAGTTGAAATATGAAAAATTTACGGAAATCGCTGAA
AAAGTGGAACAAATTCAGTTGGAAAGTGAAACATTTAGGAAAATCAATGA
AAAAGTGGAACAGATTCAGTTGGTAAGTGAAACATTTAGTAGAATCGATG
AAAAAGTGGAACAGATTAAGCTAGAATGTGAGAAATTAAAACTAACTAAT
AATATCGCAAATAGTATTTCCACGAATGAACAAAATGAAATTCAAAAAAC
CTTTGAAAAATTGACTCAGGCTATGGATGAAATGAAAAATAATATTGACC
AATTAAGGAATTTTGAGAAACAAGACAATTCTTCAACAAAATCTGTATCA
CGTGAAAGTGAGAAAACACGCCAAAAATCTCCAGTTAATGGTCGGAAAAG
TGTAGGAAGAAGTTATTCTCAAAGCATTCCGTCTAATAGTAGAAAAATCC
ATGAAAATTATAAAGTCAAATATGAAATCATCTGTCAGCAAATGAGTGAC
TTGAAAAAAGAAATGAAAAGTTCACAAAGAGCTCAAAAAGATATGAAATA
TACATTAGGAGATTTGCAAAAGATGTTAGGAAATTCAAATTACTCTGATG
AAATTTCTCAGTTGAAGAAAAACTTGGAAAGATATAAAATGAAAATGTGT
GAAGAAGAATCAAACTCAAAGGTTATTAGTGATGAATTTCAAAAACTGAA
AAGAGATTTAAAGAAGTATTTATTTCAACCGGATGAATGCATTGAAAAAT
TCAAATTAATCAATATTGAGTTGACAGAAATTAAGCAGAACCGGGATAAG
ATAAAATTCCAGCTCGACAAAATCACCATTGAGAATCAGGTTATAAAGGA
TAAACTCTCGGCAGGAAATGAGAAACTGAAAGAAGATATGGCAAAAGTCA
ACGATAAAATCGATAATGATATTCAGTCAATGCAAAAACATTTGGAGAAT
AATCTCATCGATCACAAAAAAGAAATCGAAGAAATGAAATGTGCTGAATT
AGAAAAAAATCAATGATAGTTTAAAAAAAACCGCGAGTCAATGTCAAGCC
GATATCGAAATTGTTACTAGCAATCTCAATGATGTCCACCGGGATTTGTT
GCTGTTATCTAGCGATTATGACGCCACAAAATCAACCAATAGCGCGTCGA
TGGAAAAGTTTCAAGAGTCCCAATTGGAAATTCAATTATTTATCGATAAC
AACATTAAGAAACATATAAAATCATTCGAAAGTTTTACGACAATAAACGA
TTCTGTTCAGAGGTTAAAGAATGAACTTTCCAAATTGAGAGTAGATTTCA
GTTTATCCTACAAAAATCTTATATCGGATATCGATAATGTGAAATCAGAT
CTCAACACCCAGAAGTCCATGGACAGCAAGTTACAGCTGCAAATTGCCAA
CTCCAATGCAGAAATTGCACTGATTTCGAAAAACTTTATTAGCAATCAAT
TAAGTTCCAACAAATTGATGAAAAATCTCGAAGAAATCAATTTGTTTCGA
AGTAATCTGGAAACCTTACAAACCGAAATGAACAAAAATCGCGAAGAAAT
TAGATCATTGAAAATTTCTGGCGGAAAATTATCTGAGGAAATCAAAGAAA
TTATTTCCGATCACGATAAATTCAACAAAATTATTGGAAATCAAGATATA
ATCAATAAAATTATCGGAAATCCGGATATAATCAATAAAATTATCGAAAA
CCAGGATATAATCAATAAAATTATCGGAAATCAAGATAAAATCAATAAGA
TAATTGTAAATCAGGATAAAATCAATAAGATAATTGGAAATCAGGATATA
ATCAAAAAGATTATGGGAAATCAGGATATAATCAATACCATGGTGAGATG
ATTGTAGCATTAATTCCAGGGGAACTTAGCCATGTATTTCAGGGAGAATT
CCAACAGGTCTGTAATAGAAAATTCAATGATTTGTTGTCATCACAAAATG
ACGCCAACAAGAAACAGGTGACCAACTAGAATTGGATTAAATTGATAGAT
GATTGTTTAGGATGAGGTAGCCAAGGAATTCCATTCACTGTCTAAACGTT
TTCTCAACCTGAGAACCGAATGTGTCAATATAAAAGCCGACATAGCATCG
CAATTGGCGCCGAAGAAACCGCTTCAATATAGAGAATGGAGTCTGGGAAA
TTTTTCTAAAAAACTCCAGAAATCTAAACTCGATGAAGAATTCTGTGTGA
TGAGCGATTGGTTCCAATTGACCGGTTATAGGATGTCGTTTAAAATCTAT
CCAAACGGAGATGCGTTGTGCGCAAATAAATTCATGTCGGTTTTCTTTTT
CATTCAGAAGCTCCCGGAATTTGTCGAGGAGAAAAAGAAATATCGTTTGA
CGATTTCATTGGTGGATCGTTTAGACCAATCAAAGAGTTTCACCAAGGAA
TATGACTACTACAATTACATCAAACCAGAAATTAATCTGAGAAATTCCCA
CGAATTGGGCGCTTCTGATTTCATTTTATTGGATGAATTGCGCGGAAACT
CTCGATTCATTAGCAACGATTCTCTCTTATTCAGATTTATTGTAAAGCCG
TCTTAACTATGTTAATATGATGTCAATTGAATATAATTCTGTAAATATAA
GGATCAAATTTTTGA
back to top

protein sequence of SMED30025805-orf-1

>SMED30025805-orf-1 ID=SMED30025805-orf-1|Name=SMED30025805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MSDWFQLTGYRMSFKIYPNGDALCANKFMSVFFFIQKLPEFVEEKKKYRL
TISLVDRLDQSKSFTKEYDYYNYIKPEINLRNSHELGASDFILLDELRGN
SRFISNDSLLFRFIVKPS*
back to top

protein sequence of SMED30025805-orf-2

>SMED30025805-orf-2 ID=SMED30025805-orf-2|Name=SMED30025805-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MEKFQESQLEIQLFIDNNIKKHIKSFESFTTINDSVQRLKNELSKLRVDF
SLSYKNLISDIDNVKSDLNTQKSMDSKLQLQIANSNAEIALISKNFISNQ
LSSNKLMKNLEEINLFRSNLETLQTEMNKNREEIRSLKISGGKLSEEIKE
IISDHDKFNKIIGNQDIINKIIGNPDIINKIIENQDIINKIIGNQDKINK
IIVNQDKINKIIGNQDIIKKIMGNQDIINTMVR*
back to top

protein sequence of SMED30025805-orf-3

>SMED30025805-orf-3 ID=SMED30025805-orf-3|Name=SMED30025805-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=600bp
MNSIEDKYKAVWKLMKKYSFNINPYDNRDLLCAICNKILVNAHQNECGCR
FCYKCIKTFMATNNKPCPGNSDECIKKIIDKNNIQEDYAANKRLSGIPVK
CPIGSCTYTDCLINISTHMKSHMLDCPFVLFGCCQAKYNASDIQCHLTED
NSAHYNLIFQYINNVKIDLKNSQKNEINKIGKQFIELYENQETKINKLEL
ENEEFKKLNEKVVRLELENEELMKLNKMVSQLQLEYEEFRSFQEIVAHYQ
FENTEFRKIDRKIEQLQLKYEKFTEIAEKVEQIQLESETFRKINEKVEQI
QLVSETFSRIDEKVEQIKLECEKLKLTNNIANSISTNEQNEIQKTFEKLT
QAMDEMKNNIDQLRNFEKQDNSSTKSVSRESEKTRQKSPVNGRKSVGRSY
SQSIPSNSRKIHENYKVKYEIICQQMSDLKKEMKSSQRAQKDMKYTLGDL
QKMLGNSNYSDEISQLKKNLERYKMKMCEEESNSKVISDEFQKLKRDLKK
YLFQPDECIEKFKLINIELTEIKQNRDKIKFQLDKITIENQVIKDKLSAG
NEKLKEDMAKVNDKIDNDIQSMQKHLENNLIDHKKEIEEMKCAELEKNQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR008974TRAF-like
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 339..369
NoneNo IPR availableCOILSCoilCoilcoord: 188..235
NoneNo IPR availableCOILSCoilCoilcoord: 456..476
NoneNo IPR availableCOILSCoilCoilcoord: 573..593
NoneNo IPR availableCOILSCoilCoilcoord: 263..283
NoneNo IPR availableCOILSCoilCoilcoord: 544..571
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 364..409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 390..409
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 364..389
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 28..74
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 15..138
e-value: 6.2E-12
score: 47.5
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 32..68
score: 9.391