ras-related protein Rab-24

Overview
Nameras-related protein Rab-24
Smed IDSMED30025800
Length (bp)896
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ras-related protein Rab-24 (SMED30025800) t-SNE clustered cells

Violin plots show distribution of expression levels for ras-related protein Rab-24 (SMED30025800) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ras-related protein Rab-24 (SMED30025800) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ras-related protein Rab-24 (SMED30025800) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025800

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30025800SMESG000031513.1 dd_Smed_v4_2486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30025800SMESG000031513.1 dd_Smed_v4_2486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30025800SMESG000031513.1 dd_Smed_v4_2486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30025800SMESG000031513.1 dd_Smed_v4_2486_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ras-related protein Rab-24 vs. Ensembl Human
Match: RAB24 (RAB24, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9765])

HSP 1 Score: 185.267 bits (469), Expect = 1.240e-57
Identity = 92/200 (46.00%), Postives = 138/200 (69.00%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            +  +VDVKVV+LGKE+ GKT+LVER+++D F +  YQ TIGAA+ A+ + +  ++ + +GIWDTAGSERY++M+++YYR AKAAI+CYDL DS S++R  +WVKELR+ E  C +Y+CG K DL++ D  +R V  + V ++A ++ A++FETSSKT + +D LFQ +  +      F      K ++L  +P   F  C
Sbjct:    2 SGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAK-VMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSC 200          
BLAST of ras-related protein Rab-24 vs. Ensembl Human
Match: RAB24 (RAB24, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9765])

HSP 1 Score: 185.267 bits (469), Expect = 1.240e-57
Identity = 92/200 (46.00%), Postives = 138/200 (69.00%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            +  +VDVKVV+LGKE+ GKT+LVER+++D F +  YQ TIGAA+ A+ + +  ++ + +GIWDTAGSERY++M+++YYR AKAAI+CYDL DS S++R  +WVKELR+ E  C +Y+CG K DL++ D  +R V  + V ++A ++ A++FETSSKT + +D LFQ +  +      F      K ++L  +P   F  C
Sbjct:    2 SGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAK-VMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSC 200          
BLAST of ras-related protein Rab-24 vs. Ensembl Human
Match: RAB24 (RAB24, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9765])

HSP 1 Score: 139.813 bits (351), Expect = 2.479e-40
Identity = 71/162 (43.83%), Postives = 108/162 (66.67%), Query Frame = 3
Query:  315 TIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            TIGAA+ A+ + +  ++ + +GIWDTAGSERY++M+++YYR AKAAI+CYDL DS S++R  +WVKELR+ E  C +Y+CG K DL++ D  +R V  + V ++A ++ A++FETSSKT + +D LFQ +  +      F      K ++L  +P   F  C
Sbjct:   11 TIGAAFVAK-VMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSC 171          
BLAST of ras-related protein Rab-24 vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 111.694 bits (278), Expect = 6.015e-29
Identity = 74/199 (37.19%), Postives = 109/199 (54.77%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSEN-PDFLSDATRKN--IEL-ENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q     +  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ ++ ++ R   WVKEL R   P  ++ + G K DL    +++RAV       +A        ETS+KTA  ++ +F  I   + +N P   + A  +N  ++L EN P S  +CC
Sbjct:   23 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADL----ASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCC 214          
BLAST of ras-related protein Rab-24 vs. Ensembl Human
Match: RAB5C (RAB5C, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9785])

HSP 1 Score: 111.694 bits (278), Expect = 6.015e-29
Identity = 74/199 (37.19%), Postives = 109/199 (54.77%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSEN-PDFLSDATRKN--IEL-ENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q     +  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ ++ ++ R   WVKEL R   P  ++ + G K DL    +++RAV       +A        ETS+KTA  ++ +F  I   + +N P   + A  +N  ++L EN P S  +CC
Sbjct:   23 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADL----ASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCC 214          
BLAST of ras-related protein Rab-24 vs. Ensembl Celegans
Match: rab-5 (RAB family [Source:UniProtKB/TrEMBL;Acc:P91857])

HSP 1 Score: 103.219 bits (256), Expect = 2.662e-26
Identity = 70/197 (35.53%), Postives = 104/197 (52.79%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFK--CC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q     +  I   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  S+++   WVKEL R   P  ++ + G K D+    +N+R V     N +A+       ETS+KT+  ++ +F  I   +   P          +++ NQP+   K  CC
Sbjct:   21 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLDDATIKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQESFQKAKNWVKELQRQASPNIVMALAGNKADV----ANKRTVEYEEANAYAEDNALLFMETSAKTSMNVNDIFMAIAKKLPIGP--AQGEPTGTVDM-NQPQQQQKGSCC 207          
BLAST of ras-related protein Rab-24 vs. Ensembl Celegans
Match: rab-6.1 (Ras-related protein Rab-6.1 [Source:UniProtKB/Swiss-Prot;Acc:P34213])

HSP 1 Score: 98.2117 bits (243), Expect = 1.602e-24
Identity = 60/190 (31.58%), Postives = 108/190 (56.84%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEP-ECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDAT--RKNIELENQPK 782
            K+V LG++  GKT+++ RF+YD+F  T YQ TIG  + ++ +   +++ I + +WDTAG ER++S+   Y R +  A++ YD+ ++ S+ +   WV ++RN    + ++ + G K DL    +++R VS     + A+ L+    ETS+K    +  LF+ I   +   P  + + T  + NI + N PK
Sbjct:   13 KLVFLGEQSVGKTSIITRFMYDSFDNT-YQATIGIDFLSKTMY-LEDRTIRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDITNANSFHQTTKWVDDVRNERGCDVIIVLVGNKTDL----ADKRQVSTEDGEKKARDLNVMFIETSAKAGYNVKQLFRKIATAL---PGIVQEETPEQPNIVIMNPPK 193          
BLAST of ras-related protein Rab-24 vs. Ensembl Celegans
Match: rab-6.2 (Ras-related protein Rab-6.2 [Source:UniProtKB/Swiss-Prot;Acc:Q22782])

HSP 1 Score: 95.5153 bits (236), Expect = 1.622e-23
Identity = 53/164 (32.32%), Postives = 94/164 (57.32%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTE-PECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICN 710
            K+V LG++  GKT+L+ RF+YD+F  T YQ TIG  + ++ +   +++ + + +WDTAG ER++S+   Y R +  A++ YD+ +S S+ +   W+ ++R     + ++ + G K DL    S++R V+       AK L+    ETS+K    +  LF+ I  
Sbjct:   12 KLVFLGEQSVGKTSLITRFMYDSFDNT-YQATIGIDFLSKTMY-LEDRTVRLQLWDTAGQERFRSLIPSYIRDSTVAVVVYDITNSNSFHQTSKWIDDVRTERGSDVIIMLVGNKTDL----SDKRQVTTDEGERKAKELNVMFIETSAKAGYNVKQLFRRIAG 169          
BLAST of ras-related protein Rab-24 vs. Ensembl Celegans
Match: 4R79.2 (pep chromosome:WBcel235:IV:17480396:17482329:-1 gene:WBGene00007067.1 transcript:4R79.2b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:4R79.2)

HSP 1 Score: 97.0561 bits (240), Expect = 3.674e-23
Identity = 59/195 (30.26%), Postives = 97/195 (49.74%), Query Frame = 3
Query:  183 DITMKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPD-FLSDATRKNI 761
            +I  + T P    KVV +G    GKT  + RF ++ F    +  TIG  +  + +K   N+ I + +WDTAG ER++S+TK Y+RKA   +L +D+    S+  +  W+  +R   +   ++ + G K DL   D  + AV      + A       FETS+ T  GID+  + +  N+    D  L +A + +I
Sbjct:  107 EIEEEVTQPDRIFKVVFVGDSAVGKTCFLHRFCHNRFK-PLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQERFRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVRAGVDDATVMCLVGNKMDLFGSDIARSAVYR-AAEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLEEALKLDI 299          
BLAST of ras-related protein Rab-24 vs. Ensembl Celegans
Match: 4R79.2 (pep chromosome:WBcel235:IV:17480396:17483332:-1 gene:WBGene00007067.1 transcript:4R79.2a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:4R79.2)

HSP 1 Score: 97.0561 bits (240), Expect = 1.147e-22
Identity = 59/195 (30.26%), Postives = 97/195 (49.74%), Query Frame = 3
Query:  183 DITMKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPD-FLSDATRKNI 761
            +I  + T P    KVV +G    GKT  + RF ++ F    +  TIG  +  + +K   N+ I + +WDTAG ER++S+TK Y+RKA   +L +D+    S+  +  W+  +R   +   ++ + G K DL   D  + AV      + A       FETS+ T  GID+  + +  N+    D  L +A + +I
Sbjct:  191 EIEEEVTQPDRIFKVVFVGDSAVGKTCFLHRFCHNRFK-PLFNATIGVDFTVKTMKIPPNRAIAMQLWDTAGQERFRSITKQYFRKADGVVLMFDVTSEQSFLNVRNWIDSVRAGVDDATVMCLVGNKMDLFGSDIARSAVYR-AAEKLAVEFKIPFFETSAYTGFGIDTCMRQMAENLQRREDNHLEEALKLDI 383          
BLAST of ras-related protein Rab-24 vs. Ensembl Fly
Match: Rab21 (gene:FBgn0039966 transcript:FBtr0299903)

HSP 1 Score: 111.694 bits (278), Expect = 3.166e-29
Identity = 59/168 (35.12%), Postives = 99/168 (58.93%), Query Frame = 3
Query:  207 PKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTE-PECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTIC 707
            P ++ K V+LG+   GKT+LV R++ D F+   +  T+ A++ +R++     +   + IWDTAG ER+ ++  +YYR +  A+L YD+ D  S++++  WV+ELR     E  L I G K DL      QRAV+     ++A+++ A+  ETS+K  EG+  LF+ + 
Sbjct:   10 PTLNFKAVLLGEGCVGKTSLVLRYMEDRFN-AQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDL----EEQRAVTHDEALQYARTVGAQYVETSAKENEGVAELFELLT 172          
BLAST of ras-related protein Rab-24 vs. Ensembl Fly
Match: Rab21 (gene:FBgn0039966 transcript:FBtr0336924)

HSP 1 Score: 111.694 bits (278), Expect = 3.166e-29
Identity = 59/168 (35.12%), Postives = 99/168 (58.93%), Query Frame = 3
Query:  207 PKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTE-PECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTIC 707
            P ++ K V+LG+   GKT+LV R++ D F+   +  T+ A++ +R++     +   + IWDTAG ER+ ++  +YYR +  A+L YD+ D  S++++  WV+ELR     E  L I G K DL      QRAV+     ++A+++ A+  ETS+K  EG+  LF+ + 
Sbjct:   10 PTLNFKAVLLGEGCVGKTSLVLRYMEDRFN-AQHLSTLQASFVSRKMSLEDGRRAQLNIWDTAGQERFHALGPIYYRGSDGALLVYDITDRDSFQKVKSWVRELRQMRGTEIALIIVGNKTDL----EEQRAVTHDEALQYARTVGAQYVETSAKENEGVAELFELLT 172          
BLAST of ras-related protein Rab-24 vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0330670)

HSP 1 Score: 101.679 bits (252), Expect = 1.712e-25
Identity = 71/197 (36.04%), Postives = 104/197 (52.79%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDAT--RKNIELENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+  + I   ++  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  S++R   WVKEL +   P  ++ + G K DL    SN R V      ++A+       ETS+KT   ++ +F  I   + +N    +  T  R      N+P  T  CC
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAFLTQTI-CIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL----SNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETNRP--TNNCC 218          
BLAST of ras-related protein Rab-24 vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077796)

HSP 1 Score: 101.679 bits (252), Expect = 1.712e-25
Identity = 71/197 (36.04%), Postives = 104/197 (52.79%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDAT--RKNIELENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+  + I   ++  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  S++R   WVKEL +   P  ++ + G K DL    SN R V      ++A+       ETS+KT   ++ +F  I   + +N    +  T  R      N+P  T  CC
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAFLTQTI-CIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL----SNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETNRP--TNNCC 218          
BLAST of ras-related protein Rab-24 vs. Ensembl Fly
Match: Rab5 (gene:FBgn0014010 transcript:FBtr0077793)

HSP 1 Score: 101.679 bits (252), Expect = 1.712e-25
Identity = 71/197 (36.04%), Postives = 104/197 (52.79%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDAT--RKNIELENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+  + I   ++  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  S++R   WVKEL +   P  ++ + G K DL    SN R V      ++A+       ETS+KT   ++ +F  I   + +N    +  T  R      N+P  T  CC
Sbjct:   31 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAFLTQTI-CIEDTVVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDIQNQDSFQRAKTWVKELHKQASPNIVIALAGNKADL----SNIRVVEFDEAKQYAEENGLLFMETSAKTGMNVNDIFLAIAKKLPKNDGANNQGTSIRPTGTETNRP--TNNCC 218          
BLAST of ras-related protein Rab-24 vs. Ensembl Zebrafish
Match: rab24 (RAB24, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-050706-110])

HSP 1 Score: 190.274 bits (482), Expect = 9.407e-60
Identity = 95/204 (46.57%), Postives = 136/204 (66.67%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENP-DFLSDATRKNIELENQPKSTFKCC*WN 809
            T  +VD KVV+LGKE  GKT+LVER+++  F +  YQ TIGAA+ A+ + N   + I +GIWDTAGSERY++M+++YYR A+AAI+CYDL DS S+ R  +WVKEL+N E  C +Y+CG K DLI+ D + R V  + V +FA  + A+ FETSSKT + +D +FQ +  + S    +F+ +   K ++L  +  S F  C  N
Sbjct:    2 TAMRVDAKVVMLGKESVGKTSLVERYVHRRFLVGPYQNTIGAAFVAKAL-NVGEKVITLGIWDTAGSERYEAMSRIYYRGARAAIVCYDLTDSSSFGRARFWVKELQNCEEHCKIYLCGTKSDLIEADRSTRQVDYHDVQDFADEIGAQHFETSSKTGKNVDEVFQKVAEDFSSCALEFMQE--EKGVDLGQKKDSYFDNCCHN 202          
BLAST of ras-related protein Rab-24 vs. Ensembl Zebrafish
Match: rab22a (RAB22A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-161])

HSP 1 Score: 109.768 bits (273), Expect = 9.992e-29
Identity = 71/199 (35.68%), Postives = 111/199 (55.78%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFK---CC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + ++  +N+     IWDTAG ER++++  MYYR + AAI+ YD+    S++ L  WVKELR +  P  ++ I G K DL    S+ R VSE    ++A S+ A   ETS+K A  I+ +F  I   +    D    +  K  +L  QP  + +   CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVCRFVEDSFD-PNINPTIGASFMTKTVQ-YQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEESFQTLKNWVKELRQHGPPNIVVAIAGNKCDL----SDAREVSEKDAKDYADSIHAIFIETSAKNAININEVFTQISERIPV-LDAEGGSAVKGFKLRRQPSVSTRERTCC 196          
BLAST of ras-related protein Rab-24 vs. Ensembl Zebrafish
Match: rab22a (RAB22A, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-041114-161])

HSP 1 Score: 109.768 bits (273), Expect = 9.992e-29
Identity = 71/199 (35.68%), Postives = 111/199 (55.78%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFK---CC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + ++  +N+     IWDTAG ER++++  MYYR + AAI+ YD+    S++ L  WVKELR +  P  ++ I G K DL    S+ R VSE    ++A S+ A   ETS+K A  I+ +F  I   +    D    +  K  +L  QP  + +   CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVCRFVEDSFD-PNINPTIGASFMTKTVQ-YQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEESFQTLKNWVKELRQHGPPNIVVAIAGNKCDL----SDAREVSEKDAKDYADSIHAIFIETSAKNAININEVFTQISERIPV-LDAEGGSAVKGFKLRRQPSVSTRERTCC 196          
BLAST of ras-related protein Rab-24 vs. Ensembl Zebrafish
Match: LO018490.1 (RAB31, member RAS oncogene family [Source:NCBI gene;Acc:568800])

HSP 1 Score: 108.997 bits (271), Expect = 1.820e-28
Identity = 71/187 (37.97%), Postives = 104/187 (55.61%), Query Frame = 3
Query:  252 GKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVS--ENPDFLSDATRKNIELENQ-PKSTFKCC 800
            GK+++V RF+ D+F   +  PTIGA++  + +  S N+     IWDTAG ER+ S+  MYYR + AA++ YD+    S++ L  WVKEL+   PE  ++ I G K DL     + R V      EFA+S+ A   ETS++ A  I+ LFQ I   +   EN D  S     + +L  Q P +T +CC
Sbjct:   19 GKSSIVCRFVQDHFD-HNISPTIGASFLTKTVP-SGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDL----GDIREVPTKEAKEFAESIAAIFMETSARNAVNIEELFQKISRQIPPLENTDADS---HDSFKLTRQPPPATKRCC 196          
BLAST of ras-related protein Rab-24 vs. Ensembl Zebrafish
Match: rab5b (RAB5B, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-040426-2593])

HSP 1 Score: 104.375 bits (259), Expect = 2.063e-26
Identity = 70/202 (34.65%), Postives = 108/202 (53.47%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFL---YDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNV----SENPDFLSDATRKNIELEN-QPKSTFKCC 800
            K+V+LG    GK++LV RF+   +D F  T    TIGAA+ A+ +    +  +   IWDTAG ERY S+  MYYR A+AAI+ +D+    +++R   WVKEL R   P  ++ + G K DL    +++R V       +A+       ETS+KTA  ++ LF  I   +    ++NP     A  + + L++   +ST  CC
Sbjct:   22 KLVLLGDMAVGKSSLVLRFVKGQFDEFQET----TIGAAFLAQSV-CLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFERAKAWVKELQRQASPNIVIALAGNKADL----ADKRLVEYEEAQTYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKTDTQNPTHA--ARHRGVNLQDPDAQSTRSCC 212          
BLAST of ras-related protein Rab-24 vs. Ensembl Xenopus
Match: rab24 (RAB24, member RAS oncogene family [Source:NCBI gene;Acc:548925])

HSP 1 Score: 184.882 bits (468), Expect = 1.771e-57
Identity = 90/201 (44.78%), Postives = 133/201 (66.17%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKST-FKCC 800
            +  +VDVKVV+LGKE  GKT+LVER+++  F    YQ TIGAA+ A+ +   + + + +GIWDTAGSERY++M+++YYR AKAAI+CYDL D+ S++R+ +WV EL+N E  C +YICG K DL++ D + R V  + V ++A+ + A V ETSSKT + +D LFQ +  +             K ++L  +  ST + CC
Sbjct:    2 SGQRVDVKVVMLGKESVGKTSLVERYVHHRFLQGPYQNTIGAAFVAKTMY-VEGRSLTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDASSFERVKFWVNELQNFEEHCRIYICGTKSDLLENDKSLRQVDFHDVQDYAEEIKAHVCETSSKTGQSVDELFQKVAEDYVNFNSMQGPTEAKGVDLNQKQNSTLYSCC 201          
BLAST of ras-related protein Rab-24 vs. Ensembl Xenopus
Match: ncapd2 (non-SMC condensin I complex subunit D2 [Source:Xenbase;Acc:XB-GENE-5854776])

HSP 1 Score: 117.087 bits (292), Expect = 2.181e-31
Identity = 72/197 (36.55%), Postives = 112/197 (56.85%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQP-KSTFKCC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + +  S N+     IWDTAG ER+ S+  MYYR + AA++ YD+    ++  L  WVKEL+   PE  ++ I G K DL    S+ R V+     E+A+S+ A V ETS+K A  ++ LFQ I   +    D   + +   ++L  Q  +ST +CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVSRFVQDHFD-HNISPTIGASFMTKTVP-SGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDL----SDTREVTMKDAREYAESIGAIVVETSAKNAINVEELFQGISRRIPP-LDPHENGSNGAMKLGRQSFQSTTRCC 194          
BLAST of ras-related protein Rab-24 vs. Ensembl Xenopus
Match: ncapd2 (non-SMC condensin I complex subunit D2 [Source:Xenbase;Acc:XB-GENE-5854776])

HSP 1 Score: 110.153 bits (274), Expect = 1.502e-28
Identity = 68/185 (36.76%), Postives = 105/185 (56.76%), Query Frame = 3
Query:  252 GKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQP-KSTFKCC 800
            GK+++V RF+ D+F   +  PTIGA++  + +  S N+     IWDTAG ER+ S+  MYYR + AA++ YD+    ++  L  WVKEL+   PE  ++ I G K DL    S+ R V+     E+A+S+ A V ETS+K A  ++ LFQ I   +    D   + +   ++L  Q  +ST +CC
Sbjct:   29 GKSSIVSRFVQDHFD-HNISPTIGASFMTKTVP-SGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDTFHTLKKWVKELKEHGPENIVMAIAGNKCDL----SDTREVTMKDAREYAESIGAIVVETSAKNAINVEELFQGISRRIPP-LDPHENGSNGAMKLGRQSFQSTTRCC 206          
BLAST of ras-related protein Rab-24 vs. Ensembl Xenopus
Match: rab21 (RAB21, member RAS oncogene family [Source:NCBI gene;Acc:549073])

HSP 1 Score: 108.227 bits (269), Expect = 1.013e-27
Identity = 71/207 (34.30%), Postives = 113/207 (54.59%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNT-EPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSE----------NPDFLSDATRKNIEL---ENQPKSTFKCC 800
            KVV+LG+   GKT+LV R+  + F+   +  T+ A++  +++ N   + + + IWDTAG ER+ ++  +YYR +  AIL YD+ D  S++++  WVKELR     E  L I G K DL      +R VS      +A+S+ AK + TS+K  +GI+ LF  +C  + E          N    S  +R+ +++   E Q +ST  CC
Sbjct:   19 KVVLLGEGCVGKTSLVLRYCENKFN-DKHITTLQASFLTKKL-NIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNEICLCIVGNKVDL----EKERHVSVQEAETYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQTDERAKGNGPSQSGTSRRGVQIVDDEPQAQSTGGCC 219          
BLAST of ras-related protein Rab-24 vs. Ensembl Xenopus
Match: rab5d (RAB5D, member RAS oncogene family [Source:NCBI gene;Acc:594964])

HSP 1 Score: 103.99 bits (258), Expect = 3.767e-26
Identity = 71/202 (35.15%), Postives = 106/202 (52.48%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFL---YDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNV----SENPDFLSDATRKNIE-LENQPKSTFKCC 800
            K+V+LG    GK++LV RF+   +D F  T    TIGAA+ A+ +    +  +   IWDTAG ERY S+  MYYR A+AAI+ +D+    ++ R   WVKEL R   P  ++ + G K DL    + +R V       +A+       ETS+KTA  ++ LF  I   +    ++NP   +     N++  E QP+S   CC
Sbjct:   21 KLVLLGDMAVGKSSLVLRFVKGQFDEFQET----TIGAAFLAQSV-CLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVFDITKPETFDRAKAWVKELQRQASPNIVIALAGNKSDL----AEKRMVEYEEAQAYAEDTGLLFMETSAKTAMNVNELFLAIAKKMPKSDAQNPTHAARNRGVNVQGSEQQPRSG--CC 211          
BLAST of ras-related protein Rab-24 vs. Ensembl Mouse
Match: Rab24 (RAB24, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105065])

HSP 1 Score: 181.03 bits (458), Expect = 4.823e-56
Identity = 91/200 (45.50%), Postives = 136/200 (68.00%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            +  +VDVKVV+LGKE+ GKT+LVER+++D F +  YQ TIGAA+ A+ +    ++ + +GIWDTAGSERY++M+++YYR AKAAI+CYDL DS S++R  +WVKELR+ E  C +Y+CG K DL++ D  +R V  + V ++A ++ A++FETSSKT + +D LFQ +  +      F      K ++L  +    F  C
Sbjct:    2 SGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAK-VMCVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLSQKANPYFYSC 200          
BLAST of ras-related protein Rab-24 vs. Ensembl Mouse
Match: Rab31 (RAB31, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:1914603])

HSP 1 Score: 112.464 bits (280), Expect = 1.102e-29
Identity = 73/198 (36.87%), Postives = 110/198 (55.56%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSE-NPDFLSDATRKNIELENQP-KSTFKCC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + +    N+     IWDTAG ER+ S+  MYYR + AA++ YD+    S+  L  WVKEL+   PE  ++ I G K DL    S+ R V      E+A+S+ A V ETS+K A  I+ LFQ I   +    P    +     I+L NQ  +++ +CC
Sbjct:    6 ELKVCLLGDTGVGKSSIVCRFVQDHFD-HNISPTIGASFMTKTVP-CGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDL----SDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLGPQ--ENGNSGGIKLGNQSLQASRRCC 195          
BLAST of ras-related protein Rab-24 vs. Ensembl Mouse
Match: Rab22a (RAB22A, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105072])

HSP 1 Score: 107.071 bits (266), Expect = 1.004e-27
Identity = 67/196 (34.18%), Postives = 107/196 (54.59%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + ++  +N+     IWDTAG ER++++  MYYR + AAI+ YD+    ++  L  WV+ELR +  P  ++ I G K DL    ++ R V E    ++A S+ A   ETS+K A  I+ LF  I   +    D    +  K  +L  QP    + C
Sbjct:    5 ELKVCLLGDTGVGKSSIVWRFVEDSFD-PNINPTIGASFMTKTVQ-YQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEETFSTLKNWVRELRQHGPPSIVVAIAGNKCDL----TDVREVMERDAKDYADSIHAIFVETSAKNAININELFIEISRRIPST-DANPASGGKGFKLRRQPSEPKRSC 193          
BLAST of ras-related protein Rab-24 vs. Ensembl Mouse
Match: Rab5c (RAB5C, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:105306])

HSP 1 Score: 107.457 bits (267), Expect = 1.508e-27
Identity = 72/199 (36.18%), Postives = 108/199 (54.27%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSEN-PDFLSDAT--RKNIEL-ENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q     +  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ ++ ++ R   WVKEL R   P  ++ + G K DL    +++RAV       +A        ETS+KTA  ++ +F  I   + +N P   + A    + ++L E+ P S  +CC
Sbjct:   23 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADL----ASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNAAGAPGRTRGVDLQESNPASRSQCC 214          
BLAST of ras-related protein Rab-24 vs. Ensembl Mouse
Match: Rab21 (RAB21, member RAS oncogene family [Source:MGI Symbol;Acc:MGI:894308])

HSP 1 Score: 107.457 bits (267), Expect = 1.872e-27
Identity = 70/207 (33.82%), Postives = 113/207 (54.59%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNT-EPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSE----------NPDFLSDATRKNIEL---ENQPKSTFKCC 800
            KVV+LG+   GKT+LV R+  + F+   +  T+ A++  +++ N   + + + IWDTAG ER+ ++  +YYR +  AIL YD+ D  S++++  WVKELR     E  L I G K DL      +R VS      +A+S+ AK + TS+K  +GI+ LF  +C  + E          N    + A R+ +++   E Q +S+  CC
Sbjct:   19 KVVLLGEGCVGKTSLVLRYCENKFN-DKHITTLQASFLTKKL-NIGGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDVTDEDSFQKVKNWVKELRKMLGNEICLCIVGNKIDL----EKERHVSIQEAESYAESVGAKHYHTSAKQNKGIEELFLDLCKRMIETAQVDERAKGNGSSQAGAARRGVQIIDDEPQAQSSGGCC 219          
BLAST of ras-related protein Rab-24 vs. UniProt/SwissProt
Match: sp|Q969Q5|RAB24_HUMAN (Ras-related protein Rab-24 OS=Homo sapiens OX=9606 GN=RAB24 PE=1 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 5.954e-57
Identity = 92/200 (46.00%), Postives = 138/200 (69.00%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            +  +VDVKVV+LGKE+ GKT+LVER+++D F +  YQ TIGAA+ A+ + +  ++ + +GIWDTAGSERY++M+++YYR AKAAI+CYDL DS S++R  +WVKELR+ E  C +Y+CG K DL++ D  +R V  + V ++A ++ A++FETSSKT + +D LFQ +  +      F      K ++L  +P   F  C
Sbjct:    2 SGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAK-VMSVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLGQKPNPYFYSC 200          
BLAST of ras-related protein Rab-24 vs. UniProt/SwissProt
Match: sp|P35290|RAB24_MOUSE (Ras-related protein Rab-24 OS=Mus musculus OX=10090 GN=Rab24 PE=1 SV=2)

HSP 1 Score: 181.03 bits (458), Expect = 3.373e-55
Identity = 91/200 (45.50%), Postives = 136/200 (68.00%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            +  +VDVKVV+LGKE+ GKT+LVER+++D F +  YQ TIGAA+ A+ +    ++ + +GIWDTAGSERY++M+++YYR AKAAI+CYDL DS S++R  +WVKELR+ E  C +Y+CG K DL++ D  +R V  + V ++A ++ A++FETSSKT + +D LFQ +  +      F      K ++L  +    F  C
Sbjct:    2 SGQRVDVKVVMLGKEYVGKTSLVERYVHDRFLVGPYQNTIGAAFVAK-VMCVGDRTVTLGIWDTAGSERYEAMSRIYYRGAKAAIVCYDLTDSSSFERAKFWVKELRSLEEGCQIYLCGTKSDLLEEDRRRRRVDFHDVQDYADNIKAQLFETSSKTGQSVDELFQKVAEDYVSVAAFQVMTEDKGVDLSQKANPYFYSC 200          
BLAST of ras-related protein Rab-24 vs. UniProt/SwissProt
Match: sp|Q55FU9|RAB24_DICDI (Ras-related protein Rab-24 OS=Dictyostelium discoideum OX=44689 GN=rab24 PE=3 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 1.123e-41
Identity = 82/206 (39.81%), Postives = 121/206 (58.74%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTIC------NNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            T  K+D+KVV+LG    GKT +V R+    F  T    TIG A+ ++++   + + +++GIWDTAG+ERYQ++   YYR+A AAI+CYDL +  S++++ +W +EL   EPE  +YI G K DLIQ   + +AV E  V + A+   A +FETSS+T E +  LFQTI        N   NP   + +   N+  + Q K    CC
Sbjct:    2 TKTKIDLKVVLLGYASVGKTCIVTRYTSGQFGDT--HTTIGGAFSSKRVVVGETE-VLLGIWDTAGTERYQAVNVSYYRRANAAIVCYDLTNRESWEKVTFWAEELTQNEPEIEIYIVGTKLDLIQ-QGDIKAVPEEEVKQTARRYKAHIFETSSRTGENVSLLFQTIAEDFCKRTNNGTNPVNSNPSNVVNVNTQTQKKKG-GCC 202          
BLAST of ras-related protein Rab-24 vs. UniProt/SwissProt
Match: sp|P36586|YPT5_SCHPO (GTP-binding protein ypt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ypt5 PE=1 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 3.919e-29
Identity = 67/174 (38.51%), Postives = 100/174 (57.47%), Query Frame = 3
Query:  201 TPPK----VDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECL-LYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTIC 707
            T PK    ++ K+V+LG    GK++LV RF+ D F     + TIGAA+  + +   +N  + + IWDTAG ERY+S+  MYYR A  AI+ YD+  + S ++   W+KEL+   PE + + + G K DL Q    +RAV +     +A   +   FETS+KTAE ++ LF  I 
Sbjct:    5 TAPKNVVTINQKLVLLGDSAVGKSSLVLRFVKDQFD-DYRESTIGAAFLTQTLPIDENTSVKLEIWDTAGQERYKSLAPMYYRNANCAIVVYDITQAASLEKAKSWIKELQRQAPEGIVIALAGNKLDLAQ---ERRAVEKADAEAYAAEANLLFFETSAKTAENVNELFTAIA 174          
BLAST of ras-related protein Rab-24 vs. UniProt/SwissProt
Match: sp|Q6GQP4|RAB31_RAT (Ras-related protein Rab-31 OS=Rattus norvegicus OX=10116 GN=Rab31 PE=1 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 5.029e-29
Identity = 73/197 (37.06%), Postives = 109/197 (55.33%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQP-KSTFKCC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + +    N+     IWDTAG ER+ S+  MYYR + AA++ YD+    S+  L  WVKEL+   PE  ++ I G K DL    S+ R V      E+A+S+ A V ETS+K A  I+ LFQ I   +    D   +     I+L NQ  ++  +CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVCRFVQDHFD-HNISPTIGASFMTKTVP-CGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDL----SDIREVPLKDAKEYAESIGALVVETSAKNAINIEELFQGISRQIPP-LDPHENGNSGGIKLGNQSLQAGRRCC 194          
BLAST of ras-related protein Rab-24 vs. TrEMBL
Match: A0A267G8K3 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000306g1 PE=4 SV=1)

HSP 1 Score: 213.001 bits (541), Expect = 6.746e-65
Identity = 99/179 (55.31%), Postives = 131/179 (73.18%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNF-SITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSD 743
            +VD+KVV+LGKE+ GKTALVERFL++ F +  +YQ TIGAAYG+R+I  S N P+V+GIWDTAGSERY+SM ++YYR A AA++CYD+ D+VS +R  +W +EL+  E  C LY CGCK+DL + D   R V E  V  FA+S+  + FETSSKT E ID LF+ I ++ S  P  LS+
Sbjct:    3 RVDIKVVLLGKEYVGKTALVERFLHERFVTGHTYQSTIGAAYGSRRINTSNNLPVVLGIWDTAGSERYESMARIYYRGAGAAVICYDITDAVSLERAKFWTRELQKYEDRCKLYFCGCKRDLAEADPTCRQVGEEEVVVFAESIGGRAFETSSKTGENIDRLFRQIADDFSAEPSLLSN 181          
BLAST of ras-related protein Rab-24 vs. TrEMBL
Match: A0A1I8G0V7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 213.386 bits (542), Expect = 7.725e-65
Identity = 99/179 (55.31%), Postives = 131/179 (73.18%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNF-SITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSD 743
            +VD+KVV+LGKE+ GKTALVERFL++ F +  +YQ TIGAAYG+R+I  S N P+V+GIWDTAGSERY+SM ++YYR A AA++CYD+ D+VS +R  +W +EL+  E  C LY CGCK+DL + D   R V E  V  FA+S+  + FETSSKT E ID LF+ I ++ S  P  LS+
Sbjct:   20 RVDIKVVLLGKEYVGKTALVERFLHERFVTGHTYQSTIGAAYGSRRINTSNNLPVVLGIWDTAGSERYESMARIYYRGAGAAVICYDITDAVSLERAKFWTRELQKYEDRCKLYFCGCKRDLAEADPTCRQVGEEEVVVFAESIGGRAFETSSKTGENIDRLFRQIADDFSAEPSLLSN 198          
BLAST of ras-related protein Rab-24 vs. TrEMBL
Match: A0A1S3IJZ8 (ras-related protein Rab-24 OS=Lingula unguis OX=7574 GN=LOC106164465 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 3.684e-61
Identity = 97/201 (48.26%), Postives = 142/201 (70.65%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITS-YQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            +  +VD+K+V+LGKEF GKT+LVERFL+D F   + YQ TIGAA+GA++I+    + +++GIWDTAGSERY++M+++YYR AKAAI+CYD+ DS S+ R+ +WVKELRN E  C +Y+CG KKDL+  + N R V  ++V ++A  + AKVFETS+KT E I +LF  I  + + +P       +  + L+ +P    +CC
Sbjct:    2 SGSRVDMKIVLLGKEFGGKTSLVERFLHDRFHGEAPYQATIGAAFGAKRIE-VVGKSLILGIWDTAGSERYEAMSRIYYRGAKAAIVCYDMTDSESFARVCFWVKELRNNEENCKIYLCGTKKDLVDENKNNRKVDYHMVTDYADEIRAKVFETSAKTGENIRNLFLKIAEDYTMDPVNKQQQEKDTLNLQ-EPTKKKRCC 200          
BLAST of ras-related protein Rab-24 vs. TrEMBL
Match: A0A023GFU7 (Uncharacterized protein OS=Amblyomma triste OX=251400 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 2.745e-60
Identity = 100/198 (50.51%), Postives = 132/198 (66.67%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNF-SITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
             VD+KVV+LGKE+ GKT+LVER+LYD F + T YQ TIGAAYGA+QI   +N+ I +GIWDTAGSERY++M+++YYR A AAI+C+DL D  SY++  +WV ELR  E +C +++CG K DLI  +   RA+S + V E+A  + AK+FETSSKT EGI  LF  I  +  E      +    N  LE        CC
Sbjct:    3 HVDLKVVLLGKEYGGKTSLVERYLYDRFDASTPYQNTIGAAYGAKQIA-VRNRRITLGIWDTAGSERYEAMSRIYYRGAGAAIVCFDLTDRESYQKAKFWVSELRKHEEKCQIFLCGTKNDLITEEGRHRAISYHDVLEYADEIGAKMFETSSKTGEGIAELFWQIARDYIEAMAAPRNKPGANFRLEEPASQGGGCC 199          
BLAST of ras-related protein Rab-24 vs. TrEMBL
Match: G3ML32 (Uncharacterized protein OS=Amblyomma maculatum OX=34609 PE=2 SV=1)

HSP 1 Score: 199.904 bits (507), Expect = 3.027e-60
Identity = 100/198 (50.51%), Postives = 132/198 (66.67%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNF-SITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
             VD+KVV+LGKE+ GKT+LVER+LYD F + T YQ TIGAAYGA+QI   +N+ I +GIWDTAGSERY++M+++YYR A AAI+C+DL D  SY++  +WV ELR  E +C +++CG K DLI  +   RA+S + V E+A  + AK+FETSSKT EGI  LF  I  +  E      +    N  LE        CC
Sbjct:    3 HVDLKVVLLGKEYGGKTSLVERYLYDRFDASTPYQNTIGAAYGAKQIA-VRNRRITLGIWDTAGSERYEAMSRIYYRGAGAAIVCFDLTDRESYQKAKFWVSELRKHEEKCQIFLCGTKNDLITEEGRHRAISYHDVLEYADEIGAKMFETSSKTGEGIAELFWQIAKDYIEAMAAPRNKPGANFRLEEPASQGGGCC 199          
BLAST of ras-related protein Rab-24 vs. Ensembl Cavefish
Match: rab24 (RAB24, member RAS oncogene family [Source:NCBI gene;Acc:103030328])

HSP 1 Score: 189.119 bits (479), Expect = 2.407e-59
Identity = 96/203 (47.29%), Postives = 132/203 (65.02%), Query Frame = 3
Query:  201 TPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC*WN 809
            T  +VD KVV+LGKE  GKT+LVER+++  F +  YQ TIGAA+ A+ I N  ++ I +GIWDTAGSERY++M+++YYR A+AAI+CYDL DS S+ R  +WVKEL+  E  C +Y+CG K DLI+ D + R V  + V +FA  + A+ FETSSKT   +D LF  +  + S N  F      K ++L  +  S F  C  N
Sbjct:    2 TAMRVDAKVVMLGKESVGKTSLVERYVHHRFLVGPYQNTIGAAFVAKPI-NVGDKVITLGIWDTAGSERYEAMSRIYYRGARAAIVCYDLTDSSSFLRARFWVKELQTFEEHCKIYLCGTKNDLIKADRSARQVDYHDVTDFADEIGAQHFETSSKTGNNVDELFMKVAEDFS-NSAFELMPEEKGVDLGQKKDSYFYSCCHN 202          
BLAST of ras-related protein Rab-24 vs. Ensembl Cavefish
Match: RAB31 (RAB31, member RAS oncogene family [Source:NCBI gene;Acc:103041402])

HSP 1 Score: 112.849 bits (281), Expect = 5.413e-30
Identity = 69/196 (35.20%), Postives = 105/196 (53.57%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + +    N+     IWDTAG ER+ S+  MYYR + AA++ YD+    S++ L  WVKEL+   PE  ++ I G K DL     + R V      EFA+S+ A   ETS++ A  ++ LFQ I   +    D   D+          P S+ +CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVCRFVQDHFD-HNISPTIGASFLTKTVP-CGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDL----GDIREVPTKEAKEFAESIAAIFIETSARNAVNVEELFQKISRQIPPLEDADVDSNESFKITRQPPASSRRCC 194          
BLAST of ras-related protein Rab-24 vs. Ensembl Cavefish
Match: rab22a (RAB22A, member RAS oncogene family [Source:NCBI gene;Acc:103029059])

HSP 1 Score: 110.538 bits (275), Expect = 5.524e-29
Identity = 68/199 (34.17%), Postives = 110/199 (55.28%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFK---CC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + ++  +N+     IWDTAG ER++++  MYYR + AAI+ YD+    S++ L  WVKELR +  P  ++ I G K DL    S+ R VSE    ++A S+ A   ETS+K A  ++ +F  I   +         +  +  +L  +P  T +   CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVWRFVEDSFD-PNINPTIGASFMTKTVQ-YQNELHKFLIWDTAGQERFRALAPMYYRGSAAAIIVYDITKEESFQTLKNWVKELRQHGPPNIVVAIAGNKCDL----SDAREVSEKDAKDYADSIHAIFVETSAKNAINVNEIFTEISQRIPVLDTGSGSSGVRGFKLRREPSETTRERSCC 197          
BLAST of ras-related protein Rab-24 vs. Ensembl Cavefish
Match: ENSAMXT00000046211.1 (ras-related protein Rab-5C [Source:NCBI gene;Acc:103035226])

HSP 1 Score: 105.531 bits (262), Expect = 5.376e-27
Identity = 65/170 (38.24%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSEN 725
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q     +  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ ++ ++ R   WVKEL R   P  ++ + G K DL    +N+RAV       +A        ETS+KTA  ++ +F  I   + +N
Sbjct:   18 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIIVYDITNTDTFTRAKNWVKELQRQASPNIVIALSGNKADL----ANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKN 180          
BLAST of ras-related protein Rab-24 vs. Ensembl Cavefish
Match: rab5c (RAB5C, member RAS oncogene family [Source:NCBI gene;Acc:103045387])

HSP 1 Score: 104.375 bits (259), Expect = 1.856e-26
Identity = 65/170 (38.24%), Postives = 94/170 (55.29%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSEN 725
            K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q     +  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ ++ ++ R   WVKEL R   P  ++ + G K DL    +N+RAV       +A        ETS+KTA  ++ +F  I   + +N
Sbjct:   24 KLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFTRAKNWVKELQRQASPNIVIALAGNKADL----ANKRAVDFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKN 186          
BLAST of ras-related protein Rab-24 vs. Ensembl Sea Lamprey
Match: RAB31 (RAB31, member RAS oncogene family [Source:HGNC Symbol;Acc:HGNC:9771])

HSP 1 Score: 112.079 bits (279), Expect = 2.136e-30
Identity = 70/196 (35.71%), Postives = 106/196 (54.08%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            ++KV +LG    GK+++V RF+ DNF   +  PTIGA++  + +    N+     IWDTAG ER++S+  MYYR + AA++ YD+    S++ L  WV+ELR   P+  ++ I G K DL     + R VS     ++A S+DA   ETS+K+A  I  +F  I   V       SD  R   +L    +   +CC
Sbjct:    5 ELKVCLLGDTGVGKSSIVCRFVQDNFD-PNINPTIGASFMTKTMPQG-NEVHKYLIWDTAGQERFRSLAPMYYRGSAAAVIVYDITKEESFQMLKSWVRELRQHGPQDIIVAIAGNKCDL----DDMREVSVQDARDYADSIDAIFIETSAKSAINICEIFARISERVPPGSQDSSD--RPGFQLRGAGQPARRCC 192          
BLAST of ras-related protein Rab-24 vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 110.538 bits (275), Expect = 1.247e-29
Identity = 70/194 (36.08%), Postives = 104/194 (53.61%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F     + TIGAA+   Q    ++  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  S+ R   WVKEL R   P  ++ + G K DL    +NQR V       +++       ETS+KTA  ++ +F  I   + +N D    +   N+ +E  P S  +CC
Sbjct:   23 KLVLLGESAVGKSSLVLRFVKGQFH-EFQESTIGAAF-LTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDSFARAKNWVKELQRQANPNIVIALAGNKTDL----ANQRTVDFEEAQGYSEDNGLLFMETSAKTAMNVNDVFLAIAKKLPKN-DQSMQSGNANLTVEPPPPSRSQCC 209          
BLAST of ras-related protein Rab-24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006546.1 (pep scaffold:Pmarinus_7.0:GL479918:153535:185586:-1 gene:ENSPMAG00000005897.1 transcript:ENSPMAT00000006546.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.76 bits (260), Expect = 6.074e-27
Identity = 69/207 (33.33%), Postives = 110/207 (53.14%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNT-EPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSE----------NPDFLSDATRKNIEL---ENQPKSTFKCC 800
            K V+LG+   GKT+LV R+  + F+   +  T+ A++  +++ N   + + + IWDTAG ER+ ++  +YYR +  AIL YD+ D  S++++  WVKELR     +  L I G K DL       R VS     E+A S+ AK F TS+K  +GI+ LF  +C  + E          N      +TR+ +++   E Q + +  CC
Sbjct:   48 KAVLLGEGCVGKTSLVLRYCENKFN-DKHITTLQASFLTKKL-NIAGKRVNLAIWDTAGQERFHALGPIYYRDSNGAILVYDITDEDSFQKVKNWVKELRKMLGNDICLCIVGNKIDL----EKDRHVSVEEAEEYATSVGAKHFHTSAKQNKGIEELFLDLCKRMLETAQSEESGKGNGASRGGSTRRGVQIVDDEPQQQGSGGCC 248          
BLAST of ras-related protein Rab-24 vs. Ensembl Sea Lamprey
Match: rab5c (RAB5C, member RAS oncogene family [Source:ZFIN;Acc:ZDB-GENE-031118-30])

HSP 1 Score: 103.219 bits (256), Expect = 7.230e-27
Identity = 65/194 (33.51%), Postives = 101/194 (52.06%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            K+V+LG+   GK++LV RF+   F     + TIGAA+   Q  +  +  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  S+ R   WVKEL R   P  ++ + G K DL    ++QR V       +A+       ETS+KTA  ++ +F  I   + +N           + ++   +++  CC
Sbjct:   23 KLVLLGESAVGKSSLVLRFVKGQFH-EFQESTIGAAF-LTQTVSLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNLDSFARAKTWVKELQRQANPTIVIALSGNKADL----ASQRMVEFEEAQGYAEENGLLFMETSAKTAMNVNEVFLAIAKKLPKNEQQNPGGKSNVVPIDPTSQTSSSCC 210          
BLAST of ras-related protein Rab-24 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000009.1 (pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1 gene:ENSPMAG00000000008.1 transcript:ENSPMAT00000000009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 2.194e-25
Identity = 72/209 (34.45%), Postives = 106/209 (50.72%), Query Frame = 3
Query:  192 MKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQ-PTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNV--SENPDFLSDATRKNIELENQPKSTFK--CC 800
            +  T   +  K+V+LG+   GK++LV RF+   F    YQ  TIGAA+   Q    ++  +   IWDTAG ERY S+  MYYR A+AAI+ YD+ +  ++ R   WVKEL R   P  ++ + G K DL    +++R V       +A        ETS+KTA  ++ +F  I   +  SE P   + A    + L   P S  +  CC
Sbjct:   18 LASTSKILQFKLVLLGESAVGKSSLVLRFVKGQFH--EYQESTIGAAF-LTQTVCLEDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNQDTFSRAKTWVKELQRQASPNIVIALAGNKADL----ASKRIVEFEEAQSYADDNGLLFMETSAKTAMNVNDIFLAIAKKLPRSEPPGTGTKA-HGMVSLGPGPDSHQRRTCC 218          
BLAST of ras-related protein Rab-24 vs. Ensembl Yeast
Match: YPT53 (Stress-induced Rab family GTPase; required for vacuolar protein sorting and endocytosis; involved in ionic stress tolerance; similar to Vps21p and Ypt52p; functional homolog of Vps21p; mammalian Rab5 homolog; YPT53 has a paralog, VPS21, that arose from the whole genome duplication [Source:SGD;Acc:S000005037])

HSP 1 Score: 107.842 bits (268), Expect = 1.055e-28
Identity = 62/173 (35.84%), Postives = 99/173 (57.23%), Query Frame = 3
Query:  207 PKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRN-TEPECLLYICGCKKDLIQFD--SNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNV 716
            P + +KVV+LG+   GK+++V RF+ D+F   S +PTIGAA+  ++I     + I   IWDTAG ER+  +  MYYR A+AA++ +D+ +  S+ +   WV+EL      + ++ + G K DL+  D  +  RA+    V    +  +   FE S+KT E I  +FQT+   V
Sbjct:    9 PTLTIKVVLLGESAVGKSSIVLRFVSDDFK-ESKEPTIGAAFLTKRITRD-GKVIKFEIWDTAGQERFAPLAPMYYRNAQAALVVFDVTNEGSFYKAQNWVEELHEKVGHDIVIALVGNKMDLLNNDDENENRAMKAPAVQNLCERENLLYFEASAKTGENIYQIFQTLGEKV 179          
BLAST of ras-related protein Rab-24 vs. Ensembl Yeast
Match: VPS21 (Endosomal Rab family GTPase; required for endocytic transport and sorting of vacuolar hydrolases; required for endosomal localization of the CORVET complex; required with YPT52 for MVB biogenesis and sorting; involved in autophagy and ionic stress tolerance; geranylgeranylation required for membrane association; protein abundance increases in response to DNA replication stress; mammalian Rab5 homolog; VPS21 has a paralog, YPT53, that arose from the whole genome duplication [Source:SGD;Acc:S000005615])

HSP 1 Score: 105.145 bits (261), Expect = 1.056e-27
Identity = 56/163 (34.36%), Postives = 100/163 (61.35%), Query Frame = 3
Query:  219 VKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTI 704
            +K+V+LG+   GK+++V RF+ ++F+  + +PTIGAA+  +++  ++   +   IWDTAG ER+ S+  MYYR A+AA++ YD+    S+ +  +WVKEL      + ++ + G K D++Q +  +R V+     + A+      FETS+KT E ++ +F  I
Sbjct:    8 IKLVLLGEAAVGKSSIVLRFVSNDFA-ENKEPTIGAAFLTQRVTINE-HTVKFEIWDTAGQERFASLAPMYYRNAQAALVVYDVTKPQSFIKARHWVKELHEQASKDIIIALVGNKIDMLQ-EGGERKVAREEGEKLAEEKGLLFFETSAKTGENVNDVFLGI 167          
BLAST of ras-related protein Rab-24 vs. Ensembl Yeast
Match: YPT6 (Rab family GTPase; required for endosome-to-Golgii, intra-Golgi retrograde, and retrograde Golgi-to-ER transport; temporarily at the Golgi, dissociating into the cytosol on arrival of the late Golgi GTPase Ypt32p; Golgi-localized form is GTP bound, while cytosolic form is GDP-bound; required for delivery of Atg9p to the phagophore assembly site during autophagy under heat stress, with Ypt6p for starvation induced autophagy and for the CVT pathway; homolog of mammalian Rab6 [Source:SGD;Acc:S000004252])

HSP 1 Score: 103.99 bits (258), Expect = 3.077e-27
Identity = 65/192 (33.85%), Postives = 111/192 (57.81%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNT--EPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVF-ETSSKTAEGIDSLFQTICNNVSENPDFLS---DATRKNIELENQP 779
            K+V LG++  GKT+L+ RF+YD F    YQ TIG  + ++ +    ++ I + +WDTAG ER++S+   Y R ++ AI+ YD+    S++ +D W+++++N   +   +L I G K DL    S++R +S     + AK L AK+F ETS+K    + +LF+ I  ++ E  +  S   D+   N   +N+P
Sbjct:   12 KIVFLGEQGVGKTSLITRFMYDTFD-DHYQATIGIDFLSKTM-YLDDKTIRLQLWDTAGQERFRSLIPSYIRDSRVAIIVYDITKRKSFEYIDKWIEDVKNERGDENVILCIVGNKSDL----SDERQISTEEGEKKAKLLGAKIFMETSTKAGYNVKALFKKIAKSLPEFQNSESTPLDSENANSANQNKP 197          
BLAST of ras-related protein Rab-24 vs. Ensembl Yeast
Match: YPT52 (Endosomal Rab family GTPase; required for vacuolar protein sorting, endocytosis and multivesicular body (MVB) biogenesis and sorting; required for localization of the CORVET complex to endosomes; involved in autophagy and ionic stress tolerance; similar to Vps21p and Ypt53p; mammalian Rab5 homolog; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000001722])

HSP 1 Score: 103.219 bits (256), Expect = 1.026e-26
Identity = 66/186 (35.48%), Postives = 99/186 (53.23%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQI-------KNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRN--TEPECLLYICGCKKDLIQF--------DSNQ--------RAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTI 704
            K+V+LG    GK+++V RF+ D F     + TIGAA+ ++ I         +K+  I   IWDTAG ERY+S+  MYYR A AA++ YD+    S ++   WV EL+N   + + ++Y+ G K DL Q         DSN+        RA+S     ++A+       E S+KT EG+  +FQ I
Sbjct:    5 KLVLLGDSSVGKSSIVHRFVKDTFD-ELRESTIGAAFLSQSITIHPNDGNETKDVVIKFEIWDTAGQERYKSLAPMYYRNANAALVVYDITQEDSLQKARNWVDELKNKVGDDDLVIYLLGNKVDLCQETPSTETSPDSNEGGDEEQKVRAISTEEAKQYAQEQGLLFREVSAKTGEGVKEIFQDI 189          
BLAST of ras-related protein Rab-24 vs. Ensembl Yeast
Match: YPT32 (Rab family GTPase involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi; protein abundance increases in response to DNA replication stress; YPT32 has a paralog, YPT31, that arose from the whole genome duplication [Source:SGD;Acc:S000003178])

HSP 1 Score: 100.908 bits (250), Expect = 5.310e-26
Identity = 66/193 (34.20%), Postives = 99/193 (51.30%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQ----TICNNVSENPDFLSDATRKNIELENQPKS 785
            K+V++G    GK+ L+ RF  D F+I S + TIG  +  R I+  +N+ I   IWDTAG ERY+++T  YYR A  A++ YD+  S SY+  ++W+ ELR N +    + + G K DL       RAV       FA        ETS+  ++ +D  F+     I   VS++   LS +   N+     PK 
Sbjct:   15 KIVLIGDSGVGKSNLLSRFTTDEFNIES-KSTIGVEFATRTIE-VENKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDISKSSSYENCNHWLTELRENADDNVAVGLIGNKSDLAHL----RAVPTDEAKNFAMENQMLFTETSALNSDNVDKAFRELIVAIFQMVSKHQVDLSGSGTNNMGSNGAPKG 201          
BLAST of ras-related protein Rab-24 vs. Ensembl Nematostella
Match: EDO47577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLB7])

HSP 1 Score: 194.512 bits (493), Expect = 5.931e-62
Identity = 91/200 (45.50%), Postives = 135/200 (67.50%), Query Frame = 3
Query:  207 PKVDVKVVVLGKEFAGKTALVERFLYDNFSIT-SYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNI-ELENQPKSTFKCC 800
             KVDVKVV+LGKE++GKT+LVER+L+  F+    YQ TIGAA+GA ++    N+ + +GIWDTAGSERY++M+++YYR AK A++CYDL D  S+ R  +WV EL+  E  C +Y+CG K D++Q D   R V  ++  ++A  +  KVFETSSKT   +D +F  I  + ++  DF  +A   +I +L++ P+   +CC
Sbjct:    3 SKVDVKVVLLGKEYSGKTSLVERYLHHRFNDNCPYQNTIGAAFGANKV-TVGNKCVTLGIWDTAGSERYEAMSRIYYRGAKGAVVCYDLTDRTSFDRAKFWVNELKTYESNCKIYLCGTKCDIVQHDKKLRKVDYHMTTDYADEIGGKVFETSSKTGHNVDEVFYEIAQDYTKEEDFAKNAEEDHILQLQDSPQKHSQCC 201          
BLAST of ras-related protein Rab-24 vs. Ensembl Nematostella
Match: EDO42787 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0S1])

HSP 1 Score: 170.629 bits (431), Expect = 1.655e-52
Identity = 88/204 (43.14%), Postives = 128/204 (62.75%), Query Frame = 3
Query:  213 VDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNN--------VSENPDFLSDATRKNIELENQPKSTFKCC 800
            V+ KVV+LG+ F+GKT L+ER+L+D F  TS + TIGAAYG + +   +N  + +GIWDTAGSERY +M+++YYR AKAA++C+DL +  S+ R  YWV EL   E  C +Y+CG K DL++     RAV  +VV+++A  ++AK+FETSS T   ++ LF  + ++        V EN   LS      ++LE        CC
Sbjct:    7 VESKVVLLGRNFSGKTCLLERYLHDRFLGTS-EATIGAAYGTKTV-TVRNTRVTLGIWDTAGSERYDAMSRIYYRGAKAAVICFDLTEEESFLRAKYWVNELHTYESSCRIYLCGTKFDLVEGKKKSRAVDAWVVSQYADGINAKLFETSSMTGRDVERLFFCVADDCGKEEYPQVEENDKELS-----KVKLEEPKNKRRNCC 203          
BLAST of ras-related protein Rab-24 vs. Ensembl Nematostella
Match: EDO31322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY85])

HSP 1 Score: 146.362 bits (368), Expect = 1.509e-43
Identity = 75/168 (44.64%), Postives = 107/168 (63.69%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNN 713
            K  +KVV+LGK  +GKT LV R++   FS  +   TIGAA+  R+    + + + + IWDTAG+ERYQ+M+ MYYR A+AAILCYDL DS S+ +  +WV +L+  EPEC +Y+CG K DLI+     R V    V+ + + + A  FETSSK    +D +F+ I  +
Sbjct:    4 KTYLKVVLLGKVNSGKTCLVTRYITRAFSEET-PSTIGAAF-CRKDLYIQGKNLSLAIWDTAGAERYQAMSAMYYRSARAAILCYDLTDSTSFDKAKFWVDQLKAAEPECKIYLCGTKLDLIEEALQTREVQTRAVSSYGRDIGADTFETSSKRGTNVDKVFEKIAED 169          
BLAST of ras-related protein Rab-24 vs. Ensembl Nematostella
Match: EDO47608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLH9])

HSP 1 Score: 110.538 bits (275), Expect = 1.555e-30
Identity = 49/105 (46.67%), Postives = 76/105 (72.38%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTE 530
            ++KVV+LGK+  GK+ L+ R+L+D ++ +    TIGA YG+R +       + +GIWDTAGSE+Y +M+++YYR A AA++CYDL D+ S+ R+ YWV EL++ E
Sbjct:   10 EIKVVLLGKQNGGKSCLLIRYLHDKYNPSKVSTTIGAGYGSRSVLVDCTN-VTLGIWDTAGSEKYNAMSRVYYRGAVAALVCYDLTDATSFDRVRYWVNELKSHE 113          
BLAST of ras-related protein Rab-24 vs. Ensembl Nematostella
Match: EDO45000 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU11])

HSP 1 Score: 109.768 bits (273), Expect = 5.660e-29
Identity = 69/183 (37.70%), Postives = 100/183 (54.64%), Query Frame = 3
Query:  204 PP---KVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRL-DYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLD------------AKVFETSSKTAEGIDSLFQTI 704
            PP   K D+K+V+LG+   GKT+L++R++ D         TIGA++  +Q       P  + IWDTAG E+Y  ++  Y R A AAI+ YD+    S K L D  +  L+  EP CL+ I GCKKDL+  D+  R ++E    E AK  +               FETSSKT +G+D++F+ I
Sbjct:    4 PPGKKKADLKIVILGEASVGKTSLIQRYI-DRVFTEDKLSTIGASFFLKQW-----GPYNVAIWDTAGEEKYAGLSSFYCRGASAAIVAYDITKESSLKVLNDRHLHLLQAAEPNCLVVIVGCKKDLVTDDT--REITEAAGMELAKVQNELKSRSLLSLKRTPFFETSSKTGDGVDNVFEFI 178          
BLAST of ras-related protein Rab-24 vs. Ensembl Medaka
Match: rab24 (RAB24, member RAS oncogene family [Source:NCBI gene;Acc:101167315])

HSP 1 Score: 184.882 bits (468), Expect = 9.612e-58
Identity = 89/198 (44.95%), Postives = 140/198 (70.71%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENP-DFLSDATRKNIELENQPKSTFKCC 800
            +VD KVV+LGKE  GKT+LVER++++ F +  YQ TIGAA+ A+ I+  + + I +GIWDTAG+ERY++M+++YYR A+AAI+CYDL DS S++R  +WVKEL+N E  C +Y+CG K DLI+ D ++R +  +   +FA+ + A++FETSSKT + +D +FQ +  + +     ++++ T  N+ L+ +  S F  C
Sbjct:    5 RVDAKVVMLGKESVGKTSLVERYVHNRF-LHPYQNTIGAAFVAKPIQVGE-KVITLGIWDTAGAERYEAMSRIYYRGARAAIICYDLTDSSSFQRARFWVKELQNCEELCKIYLCGTKSDLIEADRSRRQIDFHDAQDFAEEIGAQLFETSSKTGKNVDEMFQKVAEDYNSTAFQYMTEDT--NVNLDQKKNSNFYSC 198          
BLAST of ras-related protein Rab-24 vs. Ensembl Medaka
Match: rab24 (RAB24, member RAS oncogene family [Source:NCBI gene;Acc:101167315])

HSP 1 Score: 180.259 bits (456), Expect = 3.352e-56
Identity = 83/168 (49.40%), Postives = 126/168 (75.00%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNN 713
            +VD KVV+LGKE  GKT+LVER++++ F +  YQ TIGAA+ A+ I+  + + I +GIWDTAG+ERY++M+++YYR A+AAI+CYDL DS S++R  +WVKEL+N E  C +Y+CG K DLI+ D ++R +  +   +FA+ + A++FETSSKT + +D +FQ +  +
Sbjct:    5 RVDAKVVMLGKESVGKTSLVERYVHNRF-LHPYQNTIGAAFVAKPIQVGE-KVITLGIWDTAGAERYEAMSRIYYRGARAAIICYDLTDSSSFQRARFWVKELQNCEELCKIYLCGTKSDLIEADRSRRQIDFHDAQDFAEEIGAQLFETSSKTGKNVDEMFQKVAED 170          
BLAST of ras-related protein Rab-24 vs. Ensembl Medaka
Match: rab24 (RAB24, member RAS oncogene family [Source:NCBI gene;Acc:101167315])

HSP 1 Score: 173.326 bits (438), Expect = 1.880e-53
Identity = 83/177 (46.89%), Postives = 126/177 (71.19%), Query Frame = 3
Query:  210 KVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLS 740
            +VD KVV+LGKE  GKT+LVER++++ F +  YQ TIGAA+ A+ I+  + + I +GIWDTAG+ERY++M+++YYR A+AAI+CYDL DS S++R  +WVKEL+N E  C +Y+CG K DLI+ D ++R +  +   +FA+ + A++FETSSKT + +          + +N +F S
Sbjct:    5 RVDAKVVMLGKESVGKTSLVERYVHNRF-LHPYQNTIGAAFVAKPIQVGE-KVITLGIWDTAGAERYEAMSRIYYRGARAAIICYDLTDSSSFQRARFWVKELQNCEELCKIYLCGTKSDLIEADRSRRQIDFHDAQDFAEEIGAQLFETSSKTGKNVGKFSLIAAVGLKKNSNFYS 179          
BLAST of ras-related protein Rab-24 vs. Ensembl Medaka
Match: RAB31 (RAB31, member RAS oncogene family [Source:NCBI gene;Acc:101173252])

HSP 1 Score: 115.931 bits (289), Expect = 4.150e-31
Identity = 75/199 (37.69%), Postives = 112/199 (56.28%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPE-CLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVS--ENPDFLSDATRKNIELENQP-KSTFKCC 800
            ++KV +LG    GK+++V RF+ D+F   +  PTIGA++  + +    N+     IWDTAG ER+ S+  MYYR + AA++ YD+    S++ L  WVKEL+   PE  ++ I G K DL     + R V      EFA+S+ A   ETS++ A  ++ LFQ I   +   ENP+  S+ + K   L  QP  ST +CC
Sbjct:    6 ELKVCLLGDTGVGKSSIVCRFVQDHFD-HNISPTIGASFLTKTVP-CGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKLDSFQTLKKWVKELKEHGPEDIVVAIAGNKNDL----GDIREVPMKEAKEFAESIAAIFIETSARNAVNVEELFQKISKQIPPLENPEADSNDSFK---LNRQPTPSTRRCC 195          
BLAST of ras-related protein Rab-24 vs. Ensembl Medaka
Match: rab22a (RAB22A, member RAS oncogene family [Source:NCBI gene;Acc:101174498])

HSP 1 Score: 113.62 bits (283), Expect = 3.042e-30
Identity = 71/196 (36.22%), Postives = 113/196 (57.65%), Query Frame = 3
Query:  216 DVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            ++KV +LG    GKT++V RF+ D+F   +  PTIGA++  + ++  +N+     IWDTAG ER++++  MYYR + AA++ YD+    S++ L  WVKELR +  P  ++ I G K DL    S+ R VSE    ++A+S+ A   ETS+K A  I+ +F  I   +    D    ++ K+I+L  Q   + K C
Sbjct:    5 ELKVCLLGDTGVGKTSIVWRFVEDSFD-PNINPTIGASFMTKTVQ-YQNELHKFLIWDTAGQERFRALAPMYYRGSAAAVIVYDITKEDSFQTLKNWVKELRQHGPPNIVVAIAGNKCDL----SDAREVSEKDAKDYAESIHAIFVETSAKNAININEVFTEISKRIPV-VDAAGGSSAKSIKLGRQVSESRKTC 193          
BLAST of ras-related protein Rab-24 vs. Planmine SMEST
Match: SMESG000031513.1 (SMESG000031513.1)

HSP 1 Score: 419.853 bits (1078), Expect = 2.014e-150
Identity = 202/203 (99.51%), Postives = 203/203 (100.00%), Query Frame = 3
Query:  192 MKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 800
            MKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSI+SYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC
Sbjct:    1 MKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSISSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTFKCC 203          
BLAST of ras-related protein Rab-24 vs. Planmine SMEST
Match: SMESG000069398.1 (SMESG000069398.1)

HSP 1 Score: 107.071 bits (266), Expect = 3.869e-28
Identity = 66/183 (36.07%), Postives = 107/183 (58.47%), Query Frame = 3
Query:  267 VERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELR-NTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNN---VSENPDFLSDATRKNIELEN-QPKSTFKCC 800
            + RF  DNF I +++ TIGAA+  + ++  +N+ + + IWDTAG ERY+S+  MYYR AKAAI+ YD+ +  ++K+  YW+KELR  ++   +L + G K DL     N + V   +   +A + +   FETS+KT   I  LF+ I  +   ++E P  +   +  +I L + QP++  K C
Sbjct:    1 MNRFANDNF-IENHETTIGAAFMVKSVE-LENRIVKLEIWDTAGQERYRSLAPMYYRDAKAAIIVYDVTNMSTFKKALYWIKELRLKSKTLSVLALVGNKIDL-----NDKEVDSSMATNYAITENVIFFETSAKTGFNIFKLFEQIAIDLPFINEIPSVILPPSPTSIRLSSVQPQAKRKWC 176          
BLAST of ras-related protein Rab-24 vs. Planmine SMEST
Match: SMESG000076068.1 (SMESG000076068.1)

HSP 1 Score: 105.916 bits (263), Expect = 2.431e-27
Identity = 58/167 (34.73%), Postives = 102/167 (61.08%), Query Frame = 3
Query:  219 VKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKEL-RNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTICNNV 716
            +K++++G    GK++L+ RF  D F+  SY  T+G  +  R IK ++++ + I IWDTAG+E+Y S+T  +YR +   I+ Y+L D  +++ + YW+KE+ R+T       + G K DL    S++RAVS     EFA+  + +  ETS+KT+E ++  F ++ + +
Sbjct:   11 LKIIIVGDPGVGKSSLLARFADDTFN-ESYIQTLGVDFKLRTIKINESK-VKIQIWDTAGTEKYASLTSSFYRGSHGIIIVYNLIDQNTFQNVSYWIKEVNRSTGVRNKRLLVGNKLDL----SDKRAVSTETAKEFAEQNEMQFIETSAKTSENVEEAFFSLVDTI 171          
BLAST of ras-related protein Rab-24 vs. Planmine SMEST
Match: SMESG000069399.1 (SMESG000069399.1)

HSP 1 Score: 101.679 bits (252), Expect = 3.994e-26
Identity = 58/166 (34.94%), Postives = 90/166 (54.22%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQ----RAVSEYVVNEFAKSLDAKVFETSSKTAEGIDSLFQTIC 707
            KVV+LG    GK++++ RFL +N  I +Y  TIGA Y   + +  +N  I++ IWDT G ER+ SM+++YYR A  AI+ YD+ +  S+ +   WV E         LY    +K +I   +N+    R +   V  ++A   +   +E S KT E +  LF+ IC
Sbjct:    9 KVVLLGMTGVGKSSIINRFL-NNTYIENYHATIGARYCPHK-ETFENNVIILEIWDTGGQERFDSMSQIYYRNADVAIVVYDVANEKSFGKAQKWVDE---------LYCVNNRKTMINLVANKIDNDRKIPTVVGQKYAVKENVNFYEVSGKTGENVHKLFRDIC 163          
BLAST of ras-related protein Rab-24 vs. Planmine SMEST
Match: SMESG000022720.1 (SMESG000022720.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.117e-25
Identity = 55/138 (39.86%), Postives = 81/138 (58.70%), Query Frame = 3
Query:  222 KVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGARQIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYKRLDYWVKELRNTEPECLL-YICGCKKDLIQFDSNQRAVSEYVVNEFAK 632
            KVV++G    GK++L+ RF+   FS  +  PTIG  Y  + +       + + IWDTAG ER++S+TK YYR A A IL YD+ D  S+  LD W+ ++ +   +CL  Y+ G K D      +QR +SEY+  EFA+
Sbjct:   13 KVVIVGNAGVGKSSLMLRFIKGMFS-PNLGPTIGVDYMVKNVLLRNGIKVTLQIWDTAGQERFRSVTKTYYRSAAALILVYDITDKFSFDCLDKWITDIDDFAEKCLCKYLIGNKTD----KQSQRQISEYMSKEFAR 145          
The following BLAST results are available for this feature:
BLAST of ras-related protein Rab-24 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB241.240e-5746.00RAB24, member RAS oncogene family [Source:HGNC Sym... [more]
RAB241.240e-5746.00RAB24, member RAS oncogene family [Source:HGNC Sym... [more]
RAB242.479e-4043.83RAB24, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C6.015e-2937.19RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
RAB5C6.015e-2937.19RAB5C, member RAS oncogene family [Source:HGNC Sym... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab-52.662e-2635.53RAB family [Source:UniProtKB/TrEMBL;Acc:P91857][more]
rab-6.11.602e-2431.58Ras-related protein Rab-6.1 [Source:UniProtKB/Swi... [more]
rab-6.21.622e-2332.32Ras-related protein Rab-6.2 [Source:UniProtKB/Swi... [more]
4R79.23.674e-2330.26pep chromosome:WBcel235:IV:17480396:17482329:-1 ge... [more]
4R79.21.147e-2230.26pep chromosome:WBcel235:IV:17480396:17483332:-1 ge... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab213.166e-2935.12gene:FBgn0039966 transcript:FBtr0299903[more]
Rab213.166e-2935.12gene:FBgn0039966 transcript:FBtr0336924[more]
Rab51.712e-2536.04gene:FBgn0014010 transcript:FBtr0330670[more]
Rab51.712e-2536.04gene:FBgn0014010 transcript:FBtr0077796[more]
Rab51.712e-2536.04gene:FBgn0014010 transcript:FBtr0077793[more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab249.407e-6046.57RAB24, member RAS oncogene family [Source:ZFIN;Acc... [more]
rab22a9.992e-2935.68RAB22A, member RAS oncogene family [Source:ZFIN;Ac... [more]
rab22a9.992e-2935.68RAB22A, member RAS oncogene family [Source:ZFIN;Ac... [more]
LO018490.11.820e-2837.97RAB31, member RAS oncogene family [Source:NCBI gen... [more]
rab5b2.063e-2634.65RAB5B, member RAS oncogene family [Source:ZFIN;Acc... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab241.771e-5744.78RAB24, member RAS oncogene family [Source:NCBI gen... [more]
ncapd22.181e-3136.55non-SMC condensin I complex subunit D2 [Source:Xen... [more]
ncapd21.502e-2836.76non-SMC condensin I complex subunit D2 [Source:Xen... [more]
rab211.013e-2734.30RAB21, member RAS oncogene family [Source:NCBI gen... [more]
rab5d3.767e-2635.15RAB5D, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rab244.823e-5645.50RAB24, member RAS oncogene family [Source:MGI Symb... [more]
Rab311.102e-2936.87RAB31, member RAS oncogene family [Source:MGI Symb... [more]
Rab22a1.004e-2734.18RAB22A, member RAS oncogene family [Source:MGI Sym... [more]
Rab5c1.508e-2736.18RAB5C, member RAS oncogene family [Source:MGI Symb... [more]
Rab211.872e-2733.82RAB21, member RAS oncogene family [Source:MGI Symb... [more]
back to top
BLAST of ras-related protein Rab-24 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q969Q5|RAB24_HUMAN5.954e-5746.00Ras-related protein Rab-24 OS=Homo sapiens OX=9606... [more]
sp|P35290|RAB24_MOUSE3.373e-5545.50Ras-related protein Rab-24 OS=Mus musculus OX=1009... [more]
sp|Q55FU9|RAB24_DICDI1.123e-4139.81Ras-related protein Rab-24 OS=Dictyostelium discoi... [more]
sp|P36586|YPT5_SCHPO3.919e-2938.51GTP-binding protein ypt5 OS=Schizosaccharomyces po... [more]
sp|Q6GQP4|RAB31_RAT5.029e-2937.06Ras-related protein Rab-31 OS=Rattus norvegicus OX... [more]
back to top
BLAST of ras-related protein Rab-24 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G8K36.746e-6555.31Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8G0V77.725e-6555.31Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3IJZ83.684e-6148.26ras-related protein Rab-24 OS=Lingula unguis OX=75... [more]
A0A023GFU72.745e-6050.51Uncharacterized protein OS=Amblyomma triste OX=251... [more]
G3ML323.027e-6050.51Uncharacterized protein OS=Amblyomma maculatum OX=... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab242.407e-5947.29RAB24, member RAS oncogene family [Source:NCBI gen... [more]
RAB315.413e-3035.20RAB31, member RAS oncogene family [Source:NCBI gen... [more]
rab22a5.524e-2934.17RAB22A, member RAS oncogene family [Source:NCBI ge... [more]
ENSAMXT00000046211.15.376e-2738.24ras-related protein Rab-5C [Source:NCBI gene;Acc:1... [more]
rab5c1.856e-2638.24RAB5C, member RAS oncogene family [Source:NCBI gen... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RAB312.136e-3035.71RAB31, member RAS oncogene family [Source:HGNC Sym... [more]
rab5c1.247e-2936.08RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000006546.16.074e-2733.33pep scaffold:Pmarinus_7.0:GL479918:153535:185586:-... [more]
rab5c7.230e-2733.51RAB5C, member RAS oncogene family [Source:ZFIN;Acc... [more]
ENSPMAT00000000009.12.194e-2534.45pep scaffold:Pmarinus_7.0:GL476426:408368:444599:1... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
YPT531.055e-2835.84Stress-induced Rab family GTPase; required for vac... [more]
VPS211.056e-2734.36Endosomal Rab family GTPase; required for endocyti... [more]
YPT63.077e-2733.85Rab family GTPase; required for endosome-to-Golgii... [more]
YPT521.026e-2635.48Endosomal Rab family GTPase; required for vacuolar... [more]
YPT325.310e-2634.20Rab family GTPase involved in the exocytic pathway... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO475775.931e-6245.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427871.655e-5243.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO313221.509e-4344.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO476081.555e-3046.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO450005.660e-2937.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab249.612e-5844.95RAB24, member RAS oncogene family [Source:NCBI gen... [more]
rab243.352e-5649.40RAB24, member RAS oncogene family [Source:NCBI gen... [more]
rab241.880e-5346.89RAB24, member RAS oncogene family [Source:NCBI gen... [more]
RAB314.150e-3137.69RAB31, member RAS oncogene family [Source:NCBI gen... [more]
rab22a3.042e-3036.22RAB22A, member RAS oncogene family [Source:NCBI ge... [more]
back to top
BLAST of ras-related protein Rab-24 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031513.12.014e-15099.51SMESG000031513.1[more]
SMESG000069398.13.869e-2836.07SMESG000069398.1[more]
SMESG000076068.12.431e-2734.73SMESG000076068.1[more]
SMESG000069399.13.994e-2634.94SMESG000069399.1[more]
SMESG000022720.12.117e-2539.86SMESG000022720.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025800 ID=SMED30025800|Name=ras-related protein Rab-24|organism=Schmidtea mediterranea sexual|type=transcript|length=896bp
GTTTAATTCATGACTATTTCGAGTTGTTTAAATACTATTAATTAAATATT
CTAAAGTTAAAGTTCCAATTTTTCTTTAATTTATTTTTTAAAATTTTTAA
TTAATTAAATATTTAAAGCTGCATTTTTAATTGATTTATAATTCCTTGGT
TTCAGTTAAAATTAAAAATTAGTAAAATATTAGATATTACAATGAAATGC
ACACCTCCTAAAGTGGATGTTAAAGTTGTTGTTCTTGGAAAAGAGTTTGC
CGGTAAAACTGCTCTTGTCGAAAGATTTTTGTATGATAATTTTTCAATTA
CATCATACCAACCAACTATAGGAGCTGCTTACGGAGCTCGACAAATAAAG
AATTCGAAAAATCAACCAATTGTAATTGGAATCTGGGATACAGCTGGCAG
TGAACGCTATCAGTCCATGACCAAGATGTATTACAGAAAAGCAAAAGCTG
CTATTTTATGCTATGACTTATGTGATTCGGTTAGCTATAAACGACTTGAT
TATTGGGTTAAAGAATTGAGAAATACTGAACCGGAATGCTTGCTATATAT
CTGCGGCTGCAAAAAGGACTTGATTCAGTTCGATTCTAATCAAAGAGCAG
TTAGTGAGTATGTAGTGAATGAATTCGCCAAAAGTCTTGATGCCAAAGTT
TTTGAGACGTCAAGTAAAACCGCAGAAGGAATTGACTCTCTTTTCCAGAC
GATTTGTAACAATGTGTCAGAAAATCCAGATTTCCTCAGCGATGCGACGA
GAAAGAATATTGAATTAGAAAATCAGCCCAAATCCACTTTCAAATGTTGT
TAATGGAATTAGATTTTTTTTACTACAATTTTTCGATAATTTTAATGCAG
AGCGTTCCATAGTTTATTGATTTAATAAAAATTTTGTAAATTTTGA
back to top

protein sequence of SMED30025800-orf-1

>SMED30025800-orf-1 ID=SMED30025800-orf-1|Name=SMED30025800-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=204bp
MKCTPPKVDVKVVVLGKEFAGKTALVERFLYDNFSITSYQPTIGAAYGAR
QIKNSKNQPIVIGIWDTAGSERYQSMTKMYYRKAKAAILCYDLCDSVSYK
RLDYWVKELRNTEPECLLYICGCKKDLIQFDSNQRAVSEYVVNEFAKSLD
AKVFETSSKTAEGIDSLFQTICNNVSENPDFLSDATRKNIELENQPKSTF
KCC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003924GTPase activity
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0005515protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR005225Small_GTP-bd_dom
IPR001806Small_GTPase
IPR027417P-loop_NTPase
Vocabulary: biological process
TermDefinition
GO:0007264small GTPase mediated signal transduction
GO:0006810transport
GO:0006914autophagy
GO:0015031protein transport
GO:0043312neutrophil degranulation
Vocabulary: cellular component
TermDefinition
GO:0005829cytosol
GO:0005737cytoplasm
GO:0005739mitochondrion
GO:0005776autophagosome
GO:0005886plasma membrane
GO:0016020membrane
GO:0030667secretory granule membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00449RASTRNSFRMNGcoord: 114..127
score: 30.03
coord: 153..175
score: 27.55
coord: 34..50
score: 27.23
coord: 10..31
score: 36.2
coord: 53..75
score: 36.48
NoneNo IPR availableSMARTSM00173ras_sub_4coord: 7..178
e-value: 1.6E-9
score: 20.7
NoneNo IPR availableSMARTSM00174rho_sub_3coord: 12..178
e-value: 4.4E-7
score: -27.4
NoneNo IPR availableSMARTSM00175rab_sub_5coord: 10..178
e-value: 4.1E-33
score: 126.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 5..201
e-value: 1.2E-50
score: 173.5
NoneNo IPR availablePANTHERPTHR24073FAMILY NOT NAMEDcoord: 11..186
NoneNo IPR availablePANTHERPTHR24073:SF471RAS-RELATED PROTEIN RAB-24coord: 11..186
NoneNo IPR availablePROSITEPS51419RABcoord: 5..203
score: 24.115
IPR001806Small GTPasePFAMPF00071Rascoord: 11..175
e-value: 2.7E-40
score: 137.6
IPR005225Small GTP-binding protein domainTIGRFAMTIGR00231TIGR00231coord: 9..171
e-value: 2.3E-26
score: 90.5
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 6..178