B box-type domain-containing protein

Overview
NameB box-type domain-containing protein
Smed IDSMED30025791
Length (bp)2428
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of B box-type domain-containing protein (SMED30025791) t-SNE clustered cells

Violin plots show distribution of expression levels for B box-type domain-containing protein (SMED30025791) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of B box-type domain-containing protein (SMED30025791) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for B box-type domain-containing protein (SMED30025791) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025791

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30025791SMESG000078465.1 SmedASXL_013226SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30025791SMESG000078465.1 dd_Smed_v4_11048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30025791SMESG000078465.1 dd_Smed_v4_11048_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30025791SMESG000078465.1 dd_Smed_v6_11048_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30025791SMESG000078465.1 Contig53925newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30025791SMESG000078465.1 Contig53925uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30025791SMESG000078465.1 dd_Smed_v4_11048_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of B box-type domain-containing protein vs. Ensembl Human
Match: ZBBX (zinc finger B-box domain containing [Source:HGNC Symbol;Acc:HGNC:26245])

HSP 1 Score: 107.842 bits (268), Expect = 2.452e-23
Identity = 96/319 (30.09%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTIS------AIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPIST----LNNRVSIPSPLFKA--PDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPS---LTYAEQLLLRKHR 1036
            +L  EN++ME +LQ+ +    KEKEDR S+  +  W +G  G L+N    +S         S  K++LK+LK++    V  T + K          E   PK      +NG       + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T +      L N + +     K   PD         +    +  ++ K K  +L+ S+++      K         SLL EG ++EE S Q FQE ++ WR G     K  NL     ++ S E         +  + +        L+Y E+L L+KHR
Sbjct:    5 QLEFENQEMEKKLQEFRSTRNKEKEDRESS--EYYWKSGKVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKM-----ANSSECEKPK------ING-------KVCGQCENKAALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPD---EPKEENNSTKETSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQNLHA--AVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHR 298          
BLAST of B box-type domain-containing protein vs. Ensembl Human
Match: ZBBX (zinc finger B-box domain containing [Source:HGNC Symbol;Acc:HGNC:26245])

HSP 1 Score: 107.842 bits (268), Expect = 2.452e-23
Identity = 96/319 (30.09%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTIS------AIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPIST----LNNRVSIPSPLFKA--PDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPS---LTYAEQLLLRKHR 1036
            +L  EN++ME +LQ+ +    KEKEDR S+  +  W +G  G L+N    +S         S  K++LK+LK++    V  T + K          E   PK      +NG       + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T +      L N + +     K   PD         +    +  ++ K K  +L+ S+++      K         SLL EG ++EE S Q FQE ++ WR G     K  NL     ++ S E         +  + +        L+Y E+L L+KHR
Sbjct:    5 QLEFENQEMEKKLQEFRSTRNKEKEDRESS--EYYWKSGKVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKM-----ANSSECEKPK------ING-------KVCGQCENKAALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPD---EPKEENNSTKETSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQNLHA--AVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHR 298          
BLAST of B box-type domain-containing protein vs. Ensembl Human
Match: ZBBX (zinc finger B-box domain containing [Source:HGNC Symbol;Acc:HGNC:26245])

HSP 1 Score: 107.457 bits (267), Expect = 2.761e-23
Identity = 96/319 (30.09%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTIS------AIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPIST----LNNRVSIPSPLFKA--PDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPS---LTYAEQLLLRKHR 1036
            +L  EN++ME +LQ+ +    KEKEDR S+  +  W +G  G L+N    +S         S  K++LK+LK++    V  T + K          E   PK      +NG       + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T +      L N + +     K   PD         +    +  ++ K K  +L+ S+++      K         SLL EG ++EE S Q FQE ++ WR G     K  NL     ++ S E         +  + +        L+Y E+L L+KHR
Sbjct:   34 QLEFENQEMEKKLQEFRSTRNKEKEDRESS--EYYWKSGKVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKM-----ANSSECEKPK------ING-------KVCGQCENKAALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPD---EPKEENNSTKETSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQNLHA--AVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHR 327          
BLAST of B box-type domain-containing protein vs. Ensembl Human
Match: ZBBX (zinc finger B-box domain containing [Source:HGNC Symbol;Acc:HGNC:26245])

HSP 1 Score: 107.457 bits (267), Expect = 3.388e-23
Identity = 96/319 (30.09%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTIS------AIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPIST----LNNRVSIPSPLFKA--PDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQF---TPSLTYAEQLLLRKHR 1036
            +L  EN++ME +LQ+ +    KEKEDR S+  +  W +G  G L+N    +S         S  K++LK+LK++    V  T + K          E   PK      +NG       + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T +      L N + +     K   PD         +    +  ++ K K  +L+ S+++      K         SLL EG ++EE S Q FQE ++ WR G     K  NL     ++ S E         +  + +        L+Y E+L L+KHR
Sbjct:   34 QLEFENQEMEKKLQEFRSTRNKEKEDRESS--EYYWKSGKVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKM-----ANSSECEKPK------ING-------KVCGQCENKAALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPD---EPKEENNSTKETSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQNLHA--AVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHR 327          
BLAST of B box-type domain-containing protein vs. Ensembl Human
Match: ZBBX (zinc finger B-box domain containing [Source:HGNC Symbol;Acc:HGNC:26245])

HSP 1 Score: 107.457 bits (267), Expect = 3.388e-23
Identity = 96/319 (30.09%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTIS------AIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPIST----LNNRVSIPSPLFKA--PDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQF---TPSLTYAEQLLLRKHR 1036
            +L  EN++ME +LQ+ +    KEKEDR S+  +  W +G  G L+N    +S         S  K++LK+LK++    V  T + K          E   PK      +NG       + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T +      L N + +     K   PD         +    +  ++ K K  +L+ S+++      K         SLL EG ++EE S Q FQE ++ WR G     K  NL     ++ S E         +  + +        L+Y E+L L+KHR
Sbjct:   34 QLEFENQEMEKKLQEFRSTRNKEKEDRESS--EYYWKSGKVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKM-----ANSSECEKPK------ING-------KVCGQCENKAALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPD---EPKEENNSTKETSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQNLHA--AVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHR 327          
BLAST of B box-type domain-containing protein vs. Ensembl Zebrafish
Match: zbbx (zinc finger, B-box domain containing [Source:ZFIN;Acc:ZDB-GENE-061207-76])

HSP 1 Score: 103.99 bits (258), Expect = 1.805e-23
Identity = 98/347 (28.24%), Postives = 161/347 (46.40%), Query Frame = 2
Query:   77 MNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGK-------KIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPI-STLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEP-AENSKENLSPMV-----------------NGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTP-SLTYAEQLLLRKHR 1036
            M L    L++ +  + +L    K+ME RL++L+  M +EKE+R   G  S W +G PG L    P+   +   K       K+++++LK E +P+  +               E +    G+N +L   GK      CGQCE   A + C EC EDYC  CF  FH KGAL++HR  P+ + L   VS    L +     +   +  ++ +S ++ ++ +       + + +P AEN      P V                 +GSLL  G ++EE S + FQEA+  WR            Q+ +++    ET +  + + L+   ++F   +L+Y E+LLL+KHR
Sbjct:   16 MKLNVRNLRELRMETVQLDQHAKEMESRLEELRQRMNQEKEEREKMG-ASRWHSGQPGVL---APSFQNVRMNKENRLSPGKMKIRVLKDEPVPAAQKQVM-----------AEPVAKAHGVNRKLKLKGK-----VCGQCEVQLAGLMCVECGEDYCAGCFVRFHQKGALKRHRLVPVQAELQTPVSTRDVLGRLQQQVHGVENQLAQGASPKSTDETDDAEERSATGSLQPMAENQIYRTQPEVLFMNDGVDVEEDEEEEEDGSLL-RGSFDEEESARSFQEALKEWRE---------RGQRPVSV---METQTEKRSQQLIH--VEFNEDALSYMEKLLLKKHR 327          
BLAST of B box-type domain-containing protein vs. Ensembl Zebrafish
Match: zbbx (zinc finger, B-box domain containing [Source:ZFIN;Acc:ZDB-GENE-061207-76])

HSP 1 Score: 103.99 bits (258), Expect = 1.805e-23
Identity = 98/347 (28.24%), Postives = 161/347 (46.40%), Query Frame = 2
Query:   77 MNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGK-------KIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPI-STLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEP-AENSKENLSPMV-----------------NGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTP-SLTYAEQLLLRKHR 1036
            M L    L++ +  + +L    K+ME RL++L+  M +EKE+R   G  S W +G PG L    P+   +   K       K+++++LK E +P+  +               E +    G+N +L   GK      CGQCE   A + C EC EDYC  CF  FH KGAL++HR  P+ + L   VS    L +     +   +  ++ +S ++ ++ +       + + +P AEN      P V                 +GSLL  G ++EE S + FQEA+  WR            Q+ +++    ET +  + + L+   ++F   +L+Y E+LLL+KHR
Sbjct:   16 MKLNVRNLRELRMETVQLDQHAKEMESRLEELRQRMNQEKEEREKMG-ASRWHSGQPGVL---APSFQNVRMNKENRLSPGKMKIRVLKDEPVPAAQKQVM-----------AEPVAKAHGVNRKLKLKGK-----VCGQCEVQLAGLMCVECGEDYCAGCFVRFHQKGALKRHRLVPVQAELQTPVSTRDVLGRLQQQVHGVENQLAQGASPKSTDETDDAEERSATGSLQPMAENQIYRTQPEVLFMNDGVDVEEDEEEEEDGSLL-RGSFDEEESARSFQEALKEWRE---------RGQRPVSV---METQTEKRSQQLIH--VEFNEDALSYMEKLLLKKHR 327          
BLAST of B box-type domain-containing protein vs. Ensembl Xenopus
Match: fanci (FA complementation group I [Source:Xenbase;Acc:XB-GENE-981363])

HSP 1 Score: 114.39 bits (285), Expect = 1.980e-25
Identity = 95/329 (28.88%), Postives = 157/329 (47.72%), Query Frame = 2
Query:   77 MNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETL-PSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGK-NMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNR-VSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADL-----IQFTP-SLTYAEQLLLRKHR 1036
            + LKA  +++ +  + +L ++N+ ME +L+QL  +M KEKE+R+ +    +W +G  G     K  +  + SG+ I+LK+LK     P + +  S   NV+                    G  +  +  ++CGQCE   A + C EC EDYCP C+A  H KGAL+ HR+ PI     R VS  S    + + K+   S     +      +K +V        KE   +   N     N   L +G +NEE S + F + +  WR G        N +K  +++ +T+   N++ + ++  L     ++F   SLTY E+L+L+KHR
Sbjct:   17 VKLKAKNIQELRVENMQLEMQNQDMEEKLKQLLESMSKEKEERVQSKG-YHWKSGQAGNQSQDKENMVKVSSGR-IKLKILKDSMPEPEMQKVDSKMDNVI--------------------GPDRPKVKGKACGQCEAKSALLMCLECGEDYCPACYAKIHQKGALKLHRTRPIQKKTQREVSQQSRERNSNEPKDKPTSGNKVSTGFTAFNEKQEV--------KEQVPSVAVNRDASGNRESLLQGTFNEEESAKSFNDVLMEWRRGQQ------NPKKHCSLQAATDCTGNSESQTVMTVLTKPFKVEFAENSLTYMEKLMLKKHR 309          
BLAST of B box-type domain-containing protein vs. Ensembl Mouse
Match: Zbbx (zinc finger, B-box domain containing [Source:MGI Symbol;Acc:MGI:2674085])

HSP 1 Score: 69.707 bits (169), Expect = 5.096e-13
Identity = 55/183 (30.05%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAID------SGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIEL---NGSGKNMSNRS-CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRST---PISTLNNRVSIPSPLF 634
            +L +EN++ME +L++ +    K KE+  ++G   +W +G    L N     S         S  K++LK+LK+E                       I +P   ++ ++    GS    + R  CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T   P S + + + I +  F
Sbjct:   34 QLELENQKMEKKLREFQSTWNKGKEELTTSG--YHWKSGNVSKLRNLSRMTSQSKGNPTKLSAGKVKLKLLKEE-----------------------IQVPAKQLSYKMAHSTGSENPKTKRKVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIAAHQF 191          
BLAST of B box-type domain-containing protein vs. Ensembl Mouse
Match: Zbbx (zinc finger, B-box domain containing [Source:MGI Symbol;Acc:MGI:2674085])

HSP 1 Score: 72.4034 bits (176), Expect = 1.676e-12
Identity = 63/205 (30.73%), Postives = 96/205 (46.83%), Query Frame = 2
Query:  467 CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRST---PISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGI-------DLSTKLPNLQKTLTIEHS----TETLSNNQEKNLLADLIQFT-PSLTYAEQLLLRKHR 1036
            CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T   P S + + + I +  F   +  N  N       +S   ++K K  +  +S     A    E  +P     ++ E  ++EE S Q F+EA+  WR G        ++  K P+  +   ++ +    TE ++           I+FT  SL+Y E L L+K+R
Sbjct:   17 CGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIAAHQFIKEE--NPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCK--VMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPDSVEECEVQTNLKMWTEPIN-----------IEFTEDSLSYMETLWLKKYR 206          
BLAST of B box-type domain-containing protein vs. Ensembl Mouse
Match: Zbbx (zinc finger, B-box domain containing [Source:MGI Symbol;Acc:MGI:2674085])

HSP 1 Score: 71.633 bits (174), Expect = 1.945e-12
Identity = 63/207 (30.43%), Postives = 97/207 (46.86%), Query Frame = 2
Query:  461 RSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRST---PISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGI-------DLSTKLPNLQKTLTIEHS----TETLSNNQEKNLLADLIQFT-PSLTYAEQLLLRKHR 1036
            + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T   P S + + + I +  F   +  N  N       +S   ++K K  +  +S     A    E  +P     ++ E  ++EE S Q F+EA+  WR G        ++  K P+  +   ++ +    TE ++           I+FT  SL+Y E L L+K+R
Sbjct:   15 KVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIAAHQFIKEE--NPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCK--VMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPDSVEECEVQTNLKMWTEPIN-----------IEFTEDSLSYMETLWLKKYR 206          
BLAST of B box-type domain-containing protein vs. Ensembl Mouse
Match: Zbbx (zinc finger, B-box domain containing [Source:MGI Symbol;Acc:MGI:2674085])

HSP 1 Score: 70.4774 bits (171), Expect = 2.349e-12
Identity = 65/206 (31.55%), Postives = 97/206 (47.09%), Query Frame = 2
Query:  461 RSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRST---PISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNL--QKTLTIEHSTETLSNNQEKNLLADL--------IQFT-PSLTYAEQLLLRKHR 1036
            + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T   P S + + + I +  F   +  N  N       +S   ++K K  +  +S     A    E  +P     ++ E  ++EE S Q F+EA+  WR G     K   +  +K + I      L + +E  +  +L        I+FT  SL+Y E L L+K+R
Sbjct:   15 KVCGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIAAHQFIKEE--NPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCK--VMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPVFI-----FLDSVEECEVQTNLKMWTEPINIEFTEDSLSYMETLWLKKYR 211          
BLAST of B box-type domain-containing protein vs. Ensembl Mouse
Match: Zbbx (zinc finger, B-box domain containing [Source:MGI Symbol;Acc:MGI:2674085])

HSP 1 Score: 71.633 bits (174), Expect = 2.354e-12
Identity = 65/204 (31.86%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  467 CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRST---PISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNL--QKTLTIEHSTETLSNNQEKNLLADL--------IQFT-PSLTYAEQLLLRKHR 1036
            CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T   P S + + + I +  F   +  N  N       +S   ++K K  +  +S     A    E  +P     ++ E  ++EE S Q F+EA+  WR G     K   +  +K + I      L + +E  +  +L        I+FT  SL+Y E L L+K+R
Sbjct:   17 CGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIAAHQFIKEE--NPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCK--VMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPVFI-----FLDSVEECEVQTNLKMWTEPINIEFTEDSLSYMETLWLKKYR 211          
BLAST of B box-type domain-containing protein vs. UniProt/SwissProt
Match: sp|A8MT70|ZBBX_HUMAN (Zinc finger B-box domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBBX PE=2 SV=3)

HSP 1 Score: 107.457 bits (267), Expect = 1.326e-22
Identity = 96/319 (30.09%), Postives = 142/319 (44.51%), Query Frame = 2
Query:  125 KLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTIS------AIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPIST----LNNRVSIPSPLFKA--PDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPS---LTYAEQLLLRKHR 1036
            +L  EN++ME +LQ+ +    KEKEDR S+  +  W +G  G L+N    +S         S  K++LK+LK++    V  T + K          E   PK      +NG       + CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T +      L N + +     K   PD         +    +  ++ K K  +L+ S+++      K         SLL EG ++EE S Q FQE ++ WR G     K  NL     ++ S E         +  + +        L+Y E+L L+KHR
Sbjct:   34 QLEFENQEMEKKLQEFRSTRNKEKEDRESS--EYYWKSGKVGKLVNQSYMMSQNKGNVVKFSAGKVKLKLLKEQIQEPVKPTVNYKM-----ANSSECEKPK------ING-------KVCGQCENKAALLVCLECGEDYCSGCFAKVHQKGALKLHRTTLLQAKSQILFNVLDVAHQFIKDVNPD---EPKEENNSTKETSKIQHKPKSVLLQRSSSEVEITTMKRAQRTKPRKSLLCEGSFDEEASAQSFQEVLSQWRTGNHDDNKKQNLHA--AVKDSLEECEVQTNLKIWREPLNIELKEDILSYMEKLWLKKHR 327          
BLAST of B box-type domain-containing protein vs. UniProt/SwissProt
Match: sp|Q0P5X5|ZBBX_MOUSE (Zinc finger B-box domain-containing protein 1 OS=Mus musculus OX=10090 GN=Zbbx PE=1 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 1.647e-11
Identity = 65/204 (31.86%), Postives = 96/204 (47.06%), Query Frame = 2
Query:  467 CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRST---PISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNL--QKTLTIEHSTETLSNNQEKNLLADL--------IQFT-PSLTYAEQLLLRKHR 1036
            CGQCE   A + C EC EDYC  CFA  H KGAL+ HR+T   P S + + + I +  F   +  N  N       +S   ++K K  +  +S     A    E  +P     ++ E  ++EE S Q F+EA+  WR G     K   +  +K + I      L + +E  +  +L        I+FT  SL+Y E L L+K+R
Sbjct:   17 CGQCENKAALLVCLECGEDYCSGCFAKMHQKGALKFHRTTLLQPKSQILSNILIAAHQFIKEE--NPPNEGNHPAEASSKSQQKPKALLQNSSEVGATASEGGEGENPRCK--VMWEMPFDEEASAQSFREALTQWRAGHQEENKEEEVHAKKPVFI-----FLDSVEECEVQTNLKMWTEPINIEFTEDSLSYMETLWLKKYR 211          
BLAST of B box-type domain-containing protein vs. TrEMBL
Match: K1QG02 (Zinc finger B-box domain containing protein 1 OS=Crassostrea gigas OX=29159 GN=CGI_10019098 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 2.756e-33
Identity = 113/348 (32.47%), Postives = 171/348 (49.14%), Query Frame = 2
Query:   68 DIKMNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNY------KPTISAIDSGKKIR-LKMLKQETLPSVVRTTSLKSNVLRDVADGEI-LLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNK----EPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRN----GIDLSTKLPNLQKTLTIEHSTETL-----SNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQL 1048
            DI   LK   +K  +  + KL  E+++ME RL +L+LAM KEKE+R   G    WS G  G L +Y      KP+ S+   G   + +K+LK   L    R +  +   +  +A  E+ L P+           + +    CGQCEE +AAV+C +C+E YCP CF AFHLKGAL+KHRS P+S    R  + SP    P      +       +  +   +  ++   ++ N+    +   NS E  S   +G  L  G YNE  S   FQ+A+ AWR     G + +++ P   + L +E   +T      S  + K      I+F+ +L+YAE+LLL+KHR   +
Sbjct:   14 DISFRLKQHNVKRARDETRKLETESRKMEERLAELRLAMNKEKEERERQGG-GYWSRGQTGNLNSYATDVLNKPSSSSSSKGSGKKKVKILKDTPLDIPERPS--QPGTMAYIAKQEVSLTPR-----------QKVKGPKCGQCEEKKAAVSCVQCSELYCPGCFTAFHLKGALKKHRSLPVSATGPRQCM-SPRPAPPVTNGNGDFDTHSSENFDSYPSEGAIHPTNSAINRVRFDDHGRNSPEGASGSFDGPSLFTGNYNEAESAASFQQALAAWRTGKSEGGEPASETPRQPQVLKVETPRQTAPVGIDSGTETKKPPPVEIKFSSNLSYAERLLLKKHRRTDV 346          
BLAST of B box-type domain-containing protein vs. TrEMBL
Match: A0A3S1B5M1 (B box-type domain-containing protein (Fragment) OS=Elysia chlorotica OX=188477 GN=EGW08_016700 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 5.206e-33
Identity = 115/367 (31.34%), Postives = 182/367 (49.59%), Query Frame = 2
Query:   68 DIKMNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTP--GALLNYKPTISAIDS------GKKIRLKMLKQETLPSVVRTT---SLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGI-----------------------DLSTKL---PNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPV 1057
            D+ M L+A  +++ +  +++L  +N++ME RL++LK  M KEKE+R   G    W  G    G+L  Y   + A  +      GKK ++K+L+ E +    R+    ++K    R +  G   +P+           K    R CGQCE+  A ++C +C+E YCP CFAAFH+KGAL++HRS PIS    RV + SP    P      +   S+ S S   +  + V     S+ ++P   ++   +P    SLL +G Y+E  S   FQ A+ AWR G                        + S +L   P     + ++ ST TL    E++ + + I+FT +L+YAE+LLL++HR  +LA V
Sbjct:   54 DMSMRLRAQNMRNARDQTKRLEEDNRKMEDRLRELKTVMTKEKEERERQGG-GFWGRGQAQVGSLTKYANEVLASKAERPPREGKKKKIKVLQDEPIEVPKRSAQPGTMKYIAQRKLPQGPGPVPRD----------KQKGPR-CGQCEDRVATLSCVQCSEIYCPGCFAAFHVKGALKQHRSVPISASGPRVCM-SP---HPSIDPQQSPRGSQASGSIVSQSASSVEGSGASSGRQPP-MAQAGAAPTAGRSLL-DGAYDESQSAASFQAALMAWREGPSSSPSNSSNSSSPSKDGERSARSNHSRRLVASPIKSPVIAVDESTGTL----EQSRVPE-IKFTSTLSYAERLLLKRHRRTELAEV 397          
BLAST of B box-type domain-containing protein vs. TrEMBL
Match: A0A267FB35 (B box-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012047g1 PE=4 SV=1)

HSP 1 Score: 146.362 bits (368), Expect = 2.350e-32
Identity = 118/379 (31.13%), Postives = 175/379 (46.17%), Query Frame = 2
Query:   86 KASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLP-KSGINIELNGSGKNMSNRS------------------------------------CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNN-RVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLE------KKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTL-----------------TIEHSTETLSNNQEKNLLADL-IQFTPSLTYAEQLLLRKHR 1036
            K +LL   K +++++  E K+ME+RLQ+LKLAM  E++ R  +GN   WS G  GAL NYK    ++ +G K               +  +     ++ + D  I LP ++     + G+  +++NR                                     CGQCE+  AAV C ECAE+YC +CFAAFHLKGALRKHRS P+S +N  R S+   L         S+SS          E      ++N V  L +    E + ++ E ++    G+LL  GE +E  + + F+ A+  WR+G     + P  +                    T  H T T  +N  + L + L I+FT SL+YAEQLLL+KHR
Sbjct:   15 KQALLHQTKQSTKQMEEETKKMEVRLQELKLAMENERQQRAVSGNPGFWSRGQAGALTNYK----SVSAGAKKPAPPSSGPPPAGSTKAAASSVRKVKLIKDEPINLPDRTAAAAAIPGTLAHLANRGAAVANEDSNVRKPTGGRTRGGGGGGGVSAAGGGAPRCGQCEDRAAAVLCPECAEEYCARCFAAFHLKGALRKHRSLPLSAVNTPRQSLGQNLSTGAPAAAASSSSGGGGGGDGVFEDTSRQTRRNMVRQLLHGDEGESSSSTSEAMASNGGGALLT-GEVDERQNAEEFRRALAEWRSGGGGEAQKPTAEPAAARKKPAGQQQRQQPRQQTSSHGTATEDDNGGR-LSSRLEIKFTSSLSYAEQLLLQKHR 387          
BLAST of B box-type domain-containing protein vs. TrEMBL
Match: A0A1I8FXC8 (B box-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 5.959e-32
Identity = 116/379 (30.61%), Postives = 176/379 (46.44%), Query Frame = 2
Query:   86 KASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLP-KSGINIELNGSGKNMSNRS------------------------------------CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNN-RVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLE------KKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTL-----------------TIEHSTETLSNNQEKNLLADL-IQFTPSLTYAEQLLLRKHR 1036
            K +LL   K +++++  E K+ME+RLQ+LKLAM  E++ R  +GN   WS G  GAL NYK    ++ +G K               +  +     ++ + D  I LP ++     + G+  ++++R                                     CGQCE+  AAV C ECAE+YC +CFAAFHLKGALRKHRS P+S +N  R S+   L         S++S          E      ++N V  L +    E + ++ E ++    G+LL  GE +E  + + F+ A+  WR+G    ++ P  +                    T  H T T  +N  + L + L I+FT SL+YAEQLLL+KHR
Sbjct:   10 KQALLHQTKQSTKQMEEETKKMEVRLQELKLAMENERQQRAVSGNPGFWSRGQAGALTNYK----SVSAGAKKPAPPSSGPPPAGSTKAAASSVRKVKLIKDEPINLPDRTAAAAAIPGTLAHLASRGAAVANEDSNVRKPTGGRTRGGGGGGGVSAAGGGAPRCGQCEDRTAAVLCPECAEEYCARCFAAFHLKGALRKHRSLPLSAVNTPRQSLGQNLSTGAPAAAASSNSGGGGGGDGVFEDTSRQTRRNMVRQLLHGDEGESSSSTSEAMASNGGGALLT-GEVDERQNAEEFRRALAEWRSGGGGESQKPTAEPAAARKKPAGQQQRQQPRQQTSSHGTATEDDNGAR-LSSRLEIKFTSSLSYAEQLLLQKHR 382          
BLAST of B box-type domain-containing protein vs. TrEMBL
Match: A0A267H3C5 (B box-type domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig021903g2 PE=4 SV=1)

HSP 1 Score: 144.821 bits (364), Expect = 7.307e-32
Identity = 116/379 (30.61%), Postives = 176/379 (46.44%), Query Frame = 2
Query:   86 KASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLP-KSGINIELNGSGKNMSNRS------------------------------------CGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNN-RVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLE------KKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTL-----------------TIEHSTETLSNNQEKNLLADL-IQFTPSLTYAEQLLLRKHR 1036
            K +LL   K +++++  E K+ME+RLQ+LKLAM  E++ R  +GN   WS G  GAL NYK    ++ +G K               +  +     ++ + D  I LP ++     + G+  ++++R                                     CGQCE+  AAV C ECAE+YC +CFAAFHLKGALRKHRS P+S +N  R S+   L         S++S          E      ++N V  L +    E + ++ E ++    G+LL  GE +E  + + F+ A+  WR+G    ++ P  +                    T  H T T  +N  + L + L I+FT SL+YAEQLLL+KHR
Sbjct:   15 KQALLHQTKQSTKQMEEETKKMEVRLQELKLAMENERQQRAVSGNPGFWSRGQAGALTNYK----SVSAGAKKPAPPSSGPPPAGSTKAAASSVRKVKLIKDEPINLPDRTAAAAAIPGTLAHLASRGAAVANEDSNVRKPTGGRTRGGGGGGGVSAAGGGAPRCGQCEDRTAAVLCPECAEEYCARCFAAFHLKGALRKHRSLPLSAVNTPRQSLGQNLSTGAPAAAASSNSGGGGGGDGVFEDTSRQTRRNMVRQLLHGDEGESSSSTSEAMASNGGGALLT-GEVDERQNAEEFRRALAEWRSGGGGESQKPTAEPAAARKKPAGQQQRQQPRQQTSSHGTATEDDNGAR-LSSRLEIKFTSSLSYAEQLLLQKHR 387          
BLAST of B box-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000056392.1 (zinc finger B-box domain containing [Source:NCBI gene;Acc:103030668])

HSP 1 Score: 90.1225 bits (222), Expect = 8.175e-19
Identity = 93/327 (28.44%), Postives = 144/327 (44.04%), Query Frame = 2
Query:  137 ENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPI-STLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPM--VNGSL-----------LAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADL-IQFTP-SLTYAEQLLLRKHRNNQLAPVDMKY 1069
            ENK ME RLQ+L+  M +EKE+R  +G    W +    +    K     + +GK +++++LK+++LP   R    K    + V       P S     L G       + CGQCE   A + C EC EDYC  CFA FH KGAL+ HR   I + L   VS    L +   F+      +    S     K     +       EPA +++   + +  VN              L  G ++E  S++ FQ+A+N WR G     +         +  + E +    E+++   + I+F    L+Y E+LLL+KHR     P++  Y
Sbjct:   36 ENKDMENRLQELREIMRREKEEREKSG-ALRWKSAQASSGPRSKENRVKLSAGK-MKIRVLKEDSLPET-RKPPEKVPGPQPVDQ----TPGSSRKPRLKG-------KLCGQCEAKTAGLVCAECGEDYCVGCFARFHQKGALKHHRMISIQAELQTTVSSLDVLSR---FQK-QIGEERETPSQSTTSKVISPAVWRTHPAGEPACDTQTQKAQVLFVNEGDEIEDDEEDEGSLLNGCFDEVESSRSFQQALNEWRQGKQAEER--------RVPVTMEVMGTQAEESIQQPIHIEFREHGLSYMEKLLLKKHRRT---PIESYY 333          
BLAST of B box-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000050745.1 (zinc finger B-box domain containing [Source:NCBI gene;Acc:103030668])

HSP 1 Score: 82.0333 bits (201), Expect = 2.084e-15
Identity = 50/151 (33.11%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  137 ENKQMELRLQQLKLAMVKEKEDRLSNGN---KSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHR 580
            ENK ME RLQ+L+  M +EKE+R  +G    KS  ++  P +  N         S  K+++++LK+++LP   +               ++  P+       +     +  + CGQCE   A + C EC EDYC  CFA FH KGAL+ HR
Sbjct:   36 ENKDMENRLQELREIMRREKEEREKSGALRWKSAQASSGPRSKENR-----VKLSAGKMKIRVLKEDSLPETRK------------PPEKVPGPQPVDQTPGSSRKPRLKGKLCGQCEAKTAGLVCAECGEDYCVGCFARFHQKGALKHHR 169          
BLAST of B box-type domain-containing protein vs. Ensembl Nematostella
Match: EDO40638 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6L0])

HSP 1 Score: 98.9821 bits (245), Expect = 3.340e-23
Identity = 81/259 (31.27%), Postives = 122/259 (47.10%), Query Frame = 2
Query:  107 KKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGT---PGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNG 874
            K++T+E+L  E K+ME R++ LK  MVKEKEDR   G  + WS+G    P +  N K +    D G + ++K+L  E L     T + K   LR+            IN    G         CGQCE+ +A + C EC E YC  CF +FH KGALR H +  +   N          +AP                   E++++V +   ST++   +NS  +L     G+LL  G ++E+ S+  F +A+  WR+ 
Sbjct:   19 KQTTAEQLEQETKKMEERIRALKEQMVKEKEDREKIGG-TRWSSGKTINPQSAAN-KKSERKTDKGPR-KIKILTDEPLS----TYTSKKTALRE-----------SINETFTGP-------VCGQCEKAKATLACNECTESYCVSCFMSFHRKGALRAHTTRNLDQFNQGFHEEKQTSRAP-----------------KPEERSRVKLPHGSTSQ---QNS--SLEQKTGGALL-NGTFDEDESSASFAQALKEWRSA 229          
BLAST of B box-type domain-containing protein vs. Planmine SMEST
Match: SMESG000078465.1 (SMESG000078465.1)

HSP 1 Score: 1390.17 bits (3597), Expect = 0.000e+0
Identity = 749/753 (99.47%), Postives = 751/753 (99.73%), Query Frame = 2
Query:   77 MNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAEXXXXXXXXXXXXXXXXXXINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMSTRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSEIISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGKLTSEPSVLLNILANFSIYLPDNXXXXXXXXXXXXXXXXADVSLSNNKISYNFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPXXXXXXXXXXXLTKLNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDESEKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNSMDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYEDVYK 2335
            M + +SLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVSNSSQSRISSSRNLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAELLENQRLLQSNLLLETSLINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMSTRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSEIISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGKLTSEPSVLLNILANFSIYLPDNSNSSSLTQLSSKRPSSADVSLSNNKISYNFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPIDNEDDEIEEELTKLNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDESEKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNSMDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYEDVYK
Sbjct:    1 MYIFSSLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVSNSSQSRISSSRNLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAELLENQRLLQSNLLLETSLINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMSTRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSEIISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGKLTSEPSVLLNILANFSIYLPDNSNSSSLTQLSSKRPSSADVSLSNNKISYNFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPIDNEDDEIEEELTKLNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDESEKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNSMDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYEDVYK 753          
BLAST of B box-type domain-containing protein vs. Planmine SMEST
Match: SMESG000078465.1 (SMESG000078465.1)

HSP 1 Score: 1352.81 bits (3500), Expect = 0.000e+0
Identity = 729/729 (100.00%), Postives = 729/729 (100.00%), Query Frame = 2
Query:  149 MELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVXXXXXXXXXXXXXLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAEXXXXXXXXXXXXXXXXXXINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMSTRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSEIISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGKLTSEPSVLLNILANFSIYLPDNXXXXXXXXXXXXXXXXADVSLSNNKISYNFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPXXXXXXXXXXXLTKLNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDESEKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNSMDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYEDVYK 2335
            MELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVSNSSQSRISSSRNLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAELLENQRLLQSNLLLETSLINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMSTRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSEIISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGKLTSEPSVLLNILANFSIYLPDNSNSSSLTQLSSKRPSSADVSLSNNKISYNFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPIDNEDDEIEEELTKLNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDESEKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNSMDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYEDVYK
Sbjct:    1 MELRLQQLKLAMVKEKEDRLSNGNKSNWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVLRDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDYCPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVSNSSQSRISSSRNLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEEVSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLADLIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAELLENQRLLQSNLLLETSLINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMSTRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSEIISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGKLTSEPSVLLNILANFSIYLPDNSNSSSLTQLSSKRPSSADVSLSNNKISYNFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPIDNEDDEIEEELTKLNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDESEKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNSMDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYEDVYK 729          
The following BLAST results are available for this feature:
BLAST of B box-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBBX2.452e-2330.09zinc finger B-box domain containing [Source:HGNC S... [more]
ZBBX2.452e-2330.09zinc finger B-box domain containing [Source:HGNC S... [more]
ZBBX2.761e-2330.09zinc finger B-box domain containing [Source:HGNC S... [more]
ZBBX3.388e-2330.09zinc finger B-box domain containing [Source:HGNC S... [more]
ZBBX3.388e-2330.09zinc finger B-box domain containing [Source:HGNC S... [more]
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
zbbx1.805e-2328.24zinc finger, B-box domain containing [Source:ZFIN;... [more]
zbbx1.805e-2328.24zinc finger, B-box domain containing [Source:ZFIN;... [more]
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
fanci1.980e-2528.88FA complementation group I [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zbbx5.096e-1330.05zinc finger, B-box domain containing [Source:MGI S... [more]
Zbbx1.676e-1230.73zinc finger, B-box domain containing [Source:MGI S... [more]
Zbbx1.945e-1230.43zinc finger, B-box domain containing [Source:MGI S... [more]
Zbbx2.349e-1231.55zinc finger, B-box domain containing [Source:MGI S... [more]
Zbbx2.354e-1231.86zinc finger, B-box domain containing [Source:MGI S... [more]
back to top
BLAST of B box-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|A8MT70|ZBBX_HUMAN1.326e-2230.09Zinc finger B-box domain-containing protein 1 OS=H... [more]
sp|Q0P5X5|ZBBX_MOUSE1.647e-1131.86Zinc finger B-box domain-containing protein 1 OS=M... [more]
back to top
BLAST of B box-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QG022.756e-3332.47Zinc finger B-box domain containing protein 1 OS=C... [more]
A0A3S1B5M15.206e-3331.34B box-type domain-containing protein (Fragment) OS... [more]
A0A267FB352.350e-3231.13B box-type domain-containing protein (Fragment) OS... [more]
A0A1I8FXC85.959e-3230.61B box-type domain-containing protein OS=Macrostomu... [more]
A0A267H3C57.307e-3230.61B box-type domain-containing protein (Fragment) OS... [more]
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000056392.18.175e-1928.44zinc finger B-box domain containing [Source:NCBI g... [more]
ENSAMXT00000050745.12.084e-1533.11zinc finger B-box domain containing [Source:NCBI g... [more]
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO406383.340e-2331.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of B box-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of B box-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078465.10.000e+099.47SMESG000078465.1[more]
SMESG000078465.10.000e+0100.00SMESG000078465.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025791 ID=SMED30025791|Name=B box-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2428bp
TTATGTTGATTGTTTATTTTGTATCTATAGCTATTACCGCGTAATTTGAT
TTATTTGAAAATTTTATGATATTAAAATGAACTTGAAAGCTTCTTTATTA
AAAGACAAAAAATCAACTTCTGAAAAATTAAGAATTGAAAATAAGCAAAT
GGAATTAAGGTTACAGCAACTAAAATTAGCTATGGTTAAGGAAAAGGAAG
ATAGATTATCTAATGGAAATAAATCAAATTGGTCTACTGGTACGCCAGGT
GCTTTATTAAATTATAAACCAACAATATCTGCTATTGATAGTGGTAAAAA
AATTCGCTTAAAAATGCTTAAACAAGAAACTTTACCTTCTGTTGTTCGAA
CTACTAGCTTGAAATCGAATGTCCTTCGAGATGTTGCAGATGGAGAGATT
CTATTACCGAAAAGTGGCATAAATATTGAATTGAACGGTTCGGGAAAAAA
TATGTCTAATCGAAGTTGTGGTCAATGTGAAGAAATCCAAGCTGCAGTAA
ACTGTAAAGAATGCGCAGAAGATTATTGCCCAAAATGTTTTGCTGCCTTT
CATTTAAAAGGAGCTCTAAGAAAACATCGATCAACTCCGATTTCAACTTT
AAATAATCGAGTTTCTATACCTTCTCCTCTATTCAAAGCTCCAGACTTTA
AAAATGTATCAAATAGTTCTCAATCAAGAATTTCGAGCAGTCGTAATTTA
GAAAAGAAAAATAAAGTAAATATATTAGAAAATTCTACAAATAAAGAACC
TGCTGAAAATTCTAAAGAAAATCTTTCACCTATGGTCAATGGTTCATTGC
TAGCAGAGGGAGAATATAATGAAGAAGTTTCTAATCAATATTTTCAAGAA
GCAATGAATGCTTGGCGAAATGGGATAGATTTGTCAACCAAACTTCCAAA
TCTTCAAAAAACATTGACAATCGAACATTCGACCGAAACTTTATCAAATA
ATCAAGAGAAAAATCTTTTAGCAGATTTAATTCAATTTACTCCGTCTTTG
ACTTATGCAGAACAATTACTGTTGAGGAAGCACCGAAATAACCAATTAGC
TCCAGTTGATATGAAGTATATTCTCGATCGTTTGGCCAAAACAAATGAAG
CGGAACTATTAGAAAATCAAAGGCTTCTCCAATCAAATTTACTCTTAGAA
ACATCTTTAATAAACAGCAATACAGAAAAGGTTTTGAAAACTGACCAATA
TCATGTCGATTTTGACAGTGTTAATAAGTTACTGAATGAGGCTGAACTAA
TAACTGGGCGGCATTCTGCAATGTCTACCAGAAATATTTTACAATCTCCA
TTTAAAATTGAAGAGATTCCGTCCTATAGTGAAAGGAAATCGAACAATAA
TCAGTTTCCGGAAAAACTTGAAGTTGATGAAATCGAACAAGTGCAAGAAA
ATATAAGATCCAACTTCTCATCCGAAATTATTAGTCAGAAGAATAATGGA
AATGAAGAAATGATCAGAGCTATTAGTGATCTTCAACGACCAAAATCAGT
CATTAACAGAAATAATTTTTACGATAAGCCATTATCTGCTAGGCGGAAGT
CAGCACGTCAACATAAAGGGGGGAAACTTACTTCAGAACCATCGGTTTTA
TTGAACATATTAGCCAATTTCAGTATTTATCTACCTGACAACTCAAACAG
TTCCTCTCTAACTCAGTTATCCAGCAAACGTCCTTCATCAGCAGATGTGT
CATTATCAAATAATAAAATAAGCTATAATTTTTACAAAATTACTCCCAAT
TCATGGAAACCAGCTCAAGCATGGTCAGATGAATTATTAGAAAGAAAATC
GATGGTAAAATATGAAGAAAATAGCCTTTCTCCGATAGATAATGAAGATG
ATGAAATTGAAGAAGAATTAACGAAATTGAATTTATTATCAAGTCAAGCA
AAAAAGAGTGCTGAAGAAAGTTTACCTTTTTCTGAAGGTATGCCATCAAA
TAAATCTTCTATCAATGACAAAAATGACCGTAACTTACTTAGCGATGTTG
ATGGAGATTATTATGATGACGAATCGGAGAAAAATGAAATATTCGGTCAA
ATGGATACTCTCGAGCGCGAGTTGACAGTATTATCAAAACAAGAACAAGC
TATTCAGCAAAACAATTATGATGAGATGCTTATCGACTCTTTGGATATTA
ATAATGATAATATATGCCTGAATTCTATGGATTCCGATAAATTTTGTTTT
GAGGACTCACTCGACTTTCAACAGAGGTATTCCAATAATTCGAACGTGAT
TCATGAGCATTGCAATGGTGGAGATGACGAAGAAATGCAGGTGGAATGTA
GCTCAAGATTTGATGATTATGAAGATGTCTATAAATTGAATTAAAATTTG
TTATTTACTTTTTTCTGATTTTATTTTTCTTGTCATATTAATAATATATC
AATGAATGGGCTTTTAAAATATATGTTT
back to top

protein sequence of SMED30025791-orf-1

>SMED30025791-orf-1 ID=SMED30025791-orf-1|Name=SMED30025791-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=756bp
MNLKASLLKDKKSTSEKLRIENKQMELRLQQLKLAMVKEKEDRLSNGNKS
NWSTGTPGALLNYKPTISAIDSGKKIRLKMLKQETLPSVVRTTSLKSNVL
RDVADGEILLPKSGINIELNGSGKNMSNRSCGQCEEIQAAVNCKECAEDY
CPKCFAAFHLKGALRKHRSTPISTLNNRVSIPSPLFKAPDFKNVSNSSQS
RISSSRNLEKKNKVNILENSTNKEPAENSKENLSPMVNGSLLAEGEYNEE
VSNQYFQEAMNAWRNGIDLSTKLPNLQKTLTIEHSTETLSNNQEKNLLAD
LIQFTPSLTYAEQLLLRKHRNNQLAPVDMKYILDRLAKTNEAELLENQRL
LQSNLLLETSLINSNTEKVLKTDQYHVDFDSVNKLLNEAELITGRHSAMS
TRNILQSPFKIEEIPSYSERKSNNNQFPEKLEVDEIEQVQENIRSNFSSE
IISQKNNGNEEMIRAISDLQRPKSVINRNNFYDKPLSARRKSARQHKGGK
LTSEPSVLLNILANFSIYLPDNSNSSSLTQLSSKRPSSADVSLSNNKISY
NFYKITPNSWKPAQAWSDELLERKSMVKYEENSLSPIDNEDDEIEEELTK
LNLLSSQAKKSAEESLPFSEGMPSNKSSINDKNDRNLLSDVDGDYYDDES
EKNEIFGQMDTLERELTVLSKQEQAIQQNNYDEMLIDSLDINNDNICLNS
MDSDKFCFEDSLDFQQRYSNNSNVIHEHCNGGDDEEMQVECSSRFDDYED
VYKLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR037688ZBBX
IPR011528NERD
IPR000315Znf_B-box
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 8..42
NoneNo IPR availableCOILSCoilCoilcoord: 659..679
NoneNo IPR availableCOILSCoilCoilcoord: 587..607
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 612..632
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 612..634
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 218..234
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 196..234
IPR037688Zinc finger B-box domain-containing proteinPANTHERPTHR28634FAMILY NOT NAMEDcoord: 2..327
IPR000315B-box-type zinc fingerPROSITEPS50119ZF_BBOXcoord: 126..172
score: 9.855