Lipid phosphate phosphohydrolase 2

Overview
NameLipid phosphate phosphohydrolase 2
Smed IDSMED30025789
Length (bp)1057
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lipid phosphate phosphohydrolase 2 (SMED30025789) t-SNE clustered cells

Violin plots show distribution of expression levels for Lipid phosphate phosphohydrolase 2 (SMED30025789) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lipid phosphate phosphohydrolase 2 (SMED30025789) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lipid phosphate phosphohydrolase 2 (SMED30025789) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025789

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30025789SMESG000062942.1 Contig5804GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30025789SMESG000062942.1 dd_Smed_v4_7399_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Human
Match: PLPP1 (phospholipid phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:9228])

HSP 1 Score: 67.781 bits (164), Expect = 2.835e-12
Identity = 66/222 (29.73%), Postives = 119/222 (53.60%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL-SNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + GV+ ND++I YP+K     Y L+  +    +I+++I+  ++  + + L SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+ +   C+ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+AV+IYVG  R+  Y +H +D+L   + G L AI+
Sbjct:   33 PFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATI-YKA--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYY--ICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Human
Match: PLPP1 (phospholipid phosphatase 1 [Source:HGNC Symbol;Acc:HGNC:9228])

HSP 1 Score: 67.3958 bits (163), Expect = 4.843e-12
Identity = 66/223 (29.60%), Postives = 115/223 (51.57%), Query Frame = 2
Query:  230 FPPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            +P + G +  D +I+YP H  +++  VL+ +    P   I++ ET   Y     SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+ +   C+ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+AV+IYVG  R+  Y +H +D+L   + G L AI+
Sbjct:   33 YPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSVYCNLLHSNSFIRNNYIATI-YKA--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYY--ICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAIL 242          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Human
Match: PLPP2 (phospholipid phosphatase 2 [Source:HGNC Symbol;Acc:HGNC:9230])

HSP 1 Score: 63.1586 bits (152), Expect = 1.188e-10
Identity = 62/224 (27.68%), Postives = 99/224 (44.20%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSK---GFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRL-KKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G Y  D +I YP++     + LM  V     +++V    +   +T  L +R +         F  ++   Y   G  L     +  +T   K+ +GRL PNFLA+C     DP  S+          + C+ +   + + R SF   H++  +  +  L LY+  RL  KW  L  P   V   L+A A+YVG  R+  Y +H +D+L   L G L A +
Sbjct:   31 PYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSD---------FNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVC-----DPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRP--TVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAAL 238          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Human
Match: PLPP2 (phospholipid phosphatase 2 [Source:HGNC Symbol;Acc:HGNC:9230])

HSP 1 Score: 61.2326 bits (147), Expect = 5.666e-10
Identity = 62/224 (27.68%), Postives = 99/224 (44.20%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSK---GFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRL-KKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G Y  D +I YP++     + LM  V     +++V    +   +T  L +R +         F  ++   Y   G  L     +  +T   K+ +GRL PNFLA+C     DP  S+          + C+ +   + + R SF   H++  +  +  L LY+  RL  KW  L  P   V   L+A A+YVG  R+  Y +H +D+L   L G L A +
Sbjct:   52 PYKRGFYCGDDSIRYPYRPDTITHGLMAGVTITATVILVSAGEAYLVYTDRLYSRSD---------FNNYVAAVYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPNFLAVC-----DPDWSRVNCSVYVQLEKVCRGNPADVTEARLSFYSGHSSFGMYCMVFLALYVQARLCWKWARLLRP--TVQFFLVAFALYVGYTRVSDYKHHWSDVLVGLLQGALVAAL 259          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Human
Match: PLPP3 (phospholipid phosphatase 3 [Source:HGNC Symbol;Acc:HGNC:9229])

HSP 1 Score: 56.9954 bits (136), Expect = 1.347e-8
Identity = 64/227 (28.19%), Postives = 106/227 (46.70%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQF---KGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA--IIFF 898
            P   G Y ND++I YP K   ++     ++C A  IVI I+          ++  F ++  L + +      ++   Y   G  L     +   T   K  +GRL P+FL++C  + S    S+G+I N+   C+   + + + R SF   H + ++  +  L+LYL  R   W   +    L+   LI +A Y G  R+  + +HP+D+LA F  G L A  I+FF
Sbjct:   61 PYHRGFYCNDESIKYPLKTGETIND--AVLC-AVGIVIAILAI--------ITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYR--CRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARF-TWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFF 273          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Celegans
Match: plpp-1.3 (PhosphoLipid PhosPhatase homolog [Source:UniProtKB/TrEMBL;Acc:Q19403])

HSP 1 Score: 48.1358 bits (113), Expect = 4.904e-6
Identity = 58/231 (25.11%), Postives = 105/231 (45.45%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHK-HSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTS--DPLPSKGFIDNFGRFCQS-SSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXX---GSLRIITYWNHPTDILASFLIGTLTAIIFFYQ 904
            P E  +   D +I  P K +++ L  L+ I   +P +++ ++E +I +F    SNR  K        +  +++  Y  C   ++          FLK  VGRL P+F ++C  + S  D    + FID+    C + +   I   R SFP  HTA        + +YL  R+ + T ++  + +  +L+ + A++       R+   W+ PTD+L   ++  +  I  FY 
Sbjct:   63 PYERAMPCGDISIQQPFKENTVGLKHLLVITLGSPFLIVALVE-AILHFKSKGSNRLAKFFSATTITYLKYLL-MYAACTFAME----------FLKCYVGRLRPHFFSVCKPDWSKVDCTDKQSFIDSSDLVCTNPNPRKIRTARTSFPSGHTAAAFHVFLFVYIYLR-RMAENTGIKEIITIRNILVPSYALWTVFCAVTRVTDNWHFPTDVLGGVILAVVFIIPAFYS 280          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Fly
Match: wun (gene:FBgn0016078 transcript:FBtr0306111)

HSP 1 Score: 70.0922 bits (170), Expect = 4.776e-13
Identity = 66/234 (28.21%), Postives = 113/234 (48.29%), Query Frame = 2
Query:  233 PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIET--SIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQ--------SSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFY 901
            P + G + +D+++ +P H  ++  ++L  I    P  VI I+E   S      D  N  ++  +   ++    +I  Y   GI+    + + L T   K+ +GRL P+F+A+C    +D       I N G++ Q        SS+  + + R SFP  H++ T  A+  L LYL  R+  W   +    L+  L I VA Y    R+  Y +H +D+LA  LIG+++A++  Y
Sbjct:  113 PYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAI-NAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARM-TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALVVSY 344          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Fly
Match: wun (gene:FBgn0016078 transcript:FBtr0088553)

HSP 1 Score: 68.9366 bits (167), Expect = 6.213e-13
Identity = 65/231 (28.14%), Postives = 112/231 (48.48%), Query Frame = 2
Query:  233 PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIET--SIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQ--------SSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G + +D+++ +P H  ++  ++L  I    P  VI I+E   S      D  N  ++  +   ++    +I  Y   GI+    + + L T   K+ +GRL P+F+A+C    +D       I N G++ Q        SS+  + + R SFP  H++ T  A+  L LYL  R+  W   +    L+  L I VA Y    R+  Y +H +D+LA  LIG+++A++
Sbjct:   34 PYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAI-NAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARM-TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALV 262          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Fly
Match: wun (gene:FBgn0016078 transcript:FBtr0088552)

HSP 1 Score: 68.1662 bits (165), Expect = 1.885e-12
Identity = 65/231 (28.14%), Postives = 112/231 (48.48%), Query Frame = 2
Query:  233 PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIET--SIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQ--------SSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G + +D+++ +P H  ++  ++L  I    P  VI I+E   S      D  N  ++  +   ++    +I  Y   GI+    + + L T   K+ +GRL P+F+A+C    +D       I N G++ Q        SS+  + + R SFP  H++ T  A+  L LYL  R+  W   +    L+  L I VA Y    R+  Y +H +D+LA  LIG+++A++
Sbjct:  113 PYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAI-NAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARM-TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALV 341          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Fly
Match: CG11426 (gene:FBgn0037166 transcript:FBtr0078506)

HSP 1 Score: 64.6994 bits (156), Expect = 2.367e-11
Identity = 64/238 (26.89%), Postives = 114/238 (47.90%), Query Frame = 2
Query:  224 FEF---PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQ----SMIFTFLITLFLKHRVGRLSPNFLALCILN------TSDPLPSKGFIDNFGRFCQS-SSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            +EF   P   G + +D++ISYP   ++++  +L  IV   PA+V+V++E        D+S     V +LG       +   Y+  G         ++ TF  T   K+ +GRL P+FLA+C          SDP+    +++N+    +  +   + Q R SFP  H++    A+  + LYL  ++  W   +     V   ++ VA Y    R++ +W+H +D+L+  L+G   A+I
Sbjct:   55 YEFAVDPVRRGFFCDDESISYPFQDNTITPVMLGLIVGLLPALVMVVVEYVSHLRAGDISA---TVDLLG-----WRVSTWYVELGRQSTYFCFGLLLTFDATEVGKYTIGRLRPHFLAVCQPQIADGSMCSDPVNLHRYMENYDCAGEGFTVEDVRQARLSFPSGHSSLAFYAMIYVALYLQRKI-TWRGSKLSRHFVQFAVVMVAWYTALSRVMDHWHHWSDVLSGSLLGVAGALI 283          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Fly
Match: wun2 (gene:FBgn0041087 transcript:FBtr0339380)

HSP 1 Score: 55.4546 bits (132), Expect = 1.582e-8
Identity = 56/230 (24.35%), Postives = 107/230 (46.52%), Query Frame = 2
Query:  245 GVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSI-----LGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCI------LNTSDPLPSKGFIDNFGRFCQS---SSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            G + +D ++ +P++ S     ++ ++C A  + ++++    +     L + F K ++     L   +    ++  Y   GI +  +    L T   K+ +GRL P+F  LC          SDP+ +  +I+ F   C +   +S  +   R SFP  H +    ++  L++YLH R+ +W  L+    L+  LL+  A Y    R+  Y +H +D+LA   IG   A++
Sbjct:   14 GFFCDDSSLRHPYRDSTMPSWILYLMCGALPLTVMLVVEFFRGQDKRLHSPFPKSTMCSGYHLCHLELPTWLVECYHRMGIFIFGLGVEQLSTNIAKYSIGRLRPHFYTLCQPVMKDGTTCSDPINAARYIEEFT--CAAVDITSKQLKDMRLSFPSGHASFACYSMLYLVIYLHRRM-QWKQLRMLCHLLQFLLLMFAWYTALTRVSDYKHHWSDVLAGSGIGLTYAVV 240          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Zebrafish
Match: plpp1a (phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-080225-26])

HSP 1 Score: 62.3882 bits (150), Expect = 1.506e-10
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  245 GVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQ-YFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG-FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA--IIFF 898
            G + ND +I YP+K     Y L+  V     ++ +II   +  Y     SN F    +   ++     IG+++F     QS+      T   K+ +GRL P+FL +C  + S    + G +I++F   C    + + +GR SF   H++ ++  +  L LYL  R++ +W  L  P   +   LIA ++Y G  R+  Y +H +D+L   + G + A  ++FF
Sbjct:   42 GFFCNDDSIKYPYKEDTISYQLLGGVMIPVTLLTMIIGECLSVYLNRIKSNSFCNGYVACVYK----AIGTFVFGAAISQSL------TDIAKYSIGRLRPHFLDVCKPDWSKINCTAGAYIEDF--VCTGKESVVNEGRLSFYSGHSSFSMYCMLFLALYLQARMQAEWARLLRP--TLQFFLIAASVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLVVFF 250          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Zebrafish
Match: plpp1a (phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-080225-26])

HSP 1 Score: 62.003 bits (149), Expect = 1.601e-10
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  245 GVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQ-YFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG-FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA--IIFF 898
            G + ND +I YP+K     Y L+  V     ++ +II   +  Y     SN F    +   ++     IG+++F     QS+      T   K+ +GRL P+FL +C  + S    + G +I++F   C    + + +GR SF   H++ ++  +  L LYL  R++ +W  L  P   +   LIA ++Y G  R+  Y +H +D+L   + G + A  ++FF
Sbjct:   37 GFFCNDDSIKYPYKEDTISYQLLGGVMIPVTLLTMIIGECLSVYLNRIKSNSFCNGYVACVYK----AIGTFVFGAAISQSL------TDIAKYSIGRLRPHFLDVCKPDWSKINCTAGAYIEDF--VCTGKESVVNEGRLSFYSGHSSFSMYCMLFLALYLQARMQAEWARLLRP--TLQFFLIAASVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLVVFF 245          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Zebrafish
Match: plpp1a (phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-GENE-080225-26])

HSP 1 Score: 62.003 bits (149), Expect = 1.645e-10
Identity = 63/227 (27.75%), Postives = 111/227 (48.90%), Query Frame = 2
Query:  233 PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG-FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA--IIFF 898
            P + G + ND++I YP H  +++  VL  +    P   ++I E    Y     SN F    +   ++     IG+++F     QS+      T   K+ +GRL P+FL +C  + S    + G +I++F   C    + + +GR SF   H++ ++  +  L LYL  R++ +W  L  P   +   LIA ++Y G  R+  Y +H +D+L   + G + A  ++FF
Sbjct:   34 PYQRGFFCNDESIRYPFHSSTVTSTVLYTVGFTLPICSMIIGECLSVYLNRIKSNSFCNGYVACVYK----AIGTFVFGAAISQSL------TDIAKYSIGRLRPHFLDVCKPDWSKINCTAGAYIEDF--VCTGKESVVNEGRLSFYSGHSSFSMYCMLFLALYLQARMQAEWARLLRP--TLQFFLIAASVYTGLSRVSDYKHHWSDVLTGLIQGAIVALLVVFF 246          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Zebrafish
Match: LO018102.1 (phospholipid phosphatase 1-like [Source:NCBI gene;Acc:794598])

HSP 1 Score: 61.6178 bits (148), Expect = 2.329e-10
Identity = 77/266 (28.95%), Postives = 127/266 (47.74%), Query Frame = 2
Query:  161 RLLVDVTXXXXXXXXXXXXXXFEFPPELGVYENDKTISYPHKH-SLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKK-WTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFYQYS-LGNISCAIGFNSE 949
            R+ VDV+  LLA L   +++I   P + G + +D +I YP K  ++S  +LM I+     ++IV  E    Y     S  +  V+ + +       +GS++F     QS+      T   K+ +GRL P+FL +C  + S      G+I+NF   C        +GR SF   H++ ++  +  L LYL  R++  W  L  P   +   LIA ++YVG  R+  Y +H +D+L   + G   A+   +  S L N+ C    + E
Sbjct:    9 RVCVDVSCVLLAGLPFAVLNIQHRPFKRGFFCSDDSIRYPFKEDTISYQLLMGIMIPLALLLIVFGECFSIYLRSRASFSYEYVACVYK------AVGSFVFGAAVSQSL------TDIAKYTIGRLRPHFLTVCKPHWSLIDCKAGYIENFT--CTGDPTLTNEGRLSFYSGHSSFSMYCMLFLALYLQSRMRAGWARLVRP--TLQFSLIAASLYVGLSRVSDYKHHWSDVLTGLIQGAAVALFTVFCVSDLFNVKCVSDKDEE 258          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Zebrafish
Match: plpp2b (phospholipid phosphatase 2b [Source:ZFIN;Acc:ZDB-GENE-030131-7425])

HSP 1 Score: 61.2326 bits (147), Expect = 3.417e-10
Identity = 64/224 (28.57%), Postives = 107/224 (47.77%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL--SNRFNK-VSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P E G++  D++I YP K      V +  V     I+I+    +   ++  +  ++ FN+ VS + +      ++G+++F G   QS+      T   K+ +GR  PNFLA+C      P   KGF+ N    C  +   + + R SF   H++  +  +  L  Y+  RL  KW  L  P   +   L+A A+YVG  R+  Y +H +D++   L G L AI+
Sbjct:   33 PYERGIFCQDESIGYPVKTDTITNVTLAAVTITCTILIICSGEAYLVYSKKIHSNSSFNQYVSAIYK------VLGAFLFGGAVSQSL------TDLAKYTIGRPRPNFLAVCA-----PKVCKGFV-NLNN-CTGNPADVTEARLSFYSGHSSFAMYCMLFLAFYVQARLNAKWARLLRP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVMVGLLQGALIAIL 235          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Xenopus
Match: plpp1 (phospholipid phosphatase 1 [Source:NCBI gene;Acc:496488])

HSP 1 Score: 67.781 bits (164), Expect = 2.718e-12
Identity = 65/220 (29.55%), Postives = 108/220 (49.09%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSN----RFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGT 877
            P + G + ND ++ YP+K     Y L+  +     I+++I+  ++  F +DL +    R N V+ + +       IG++IF     QS+      T   K+ +GRL P+FL +C  N S    S G+I+ F   C+       + R SF   H++ ++  +  L LYL  RL+  W  L  P   +   LIAV++YVG  R+  Y +H +D+L   + G 
Sbjct:   33 PFQRGFFCNDDSLRYPYKEDTISYGLLGGIMIPFCIIVMILGETLSVFYNDLRSSAFIRNNYVATIYK------AIGTFIFGAAVSQSL------TDIAKYTIGRLRPHFLDVCKPNWSKINCSLGYIETF--VCEGDPTKSSEARLSFYSGHSSFSMYCMVFLALYLQSRLRADWARLLRP--TIQFALIAVSVYVGLSRVSDYKHHWSDVLTGLIQGA 236          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Xenopus
Match: plpp1 (phospholipid phosphatase 1 [Source:NCBI gene;Acc:496488])

HSP 1 Score: 63.1586 bits (152), Expect = 1.042e-10
Identity = 65/220 (29.55%), Postives = 105/220 (47.73%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSN----RFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGT 877
            P + G + +D +I YP   S     ++  V F   I  +I+  ++  F +DL +    R N V+ + +       IG++IF     QS+      T   K+ +GRL P+FL +C  N S    S G+I+ F   C+       + R SF   H++ ++  +  L LYL  RL+  W  L  P   +   LIAV++YVG  R+  Y +H +D+L   + G 
Sbjct:   34 PYQRGFFCDDDSIKYPFHDSTVTSTVLYAVGFTVPICSMILGETLSVFYNDLRSSAFIRNNYVATIYK------AIGTFIFGAAVSQSL------TDIAKYTIGRLRPHFLDVCKPNWSKINCSLGYIETF--VCEGDPTKSSEARLSFYSGHSSFSMYCMVFLALYLQSRLRADWARLLRP--TIQFALIAVSVYVGLSRVSDYKHHWSDVLTGLIQGA 237          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Xenopus
Match: bmp2k (BMP2 inducible kinase [Source:Xenbase;Acc:XB-GENE-492403])

HSP 1 Score: 61.2326 bits (147), Expect = 5.008e-10
Identity = 59/219 (26.94%), Postives = 103/219 (47.03%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRL-KKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA 886
            P + G Y ND++I YP++       LM  V  +  ++I+        F+  L +R    + +        ++G+Y+F     QS+      T   K+ +GR  PNF+A+C  + S  +   G++ +F   C+ +   +   R SF   H++  +  +  L LY+  RL  KW  L  P   +   L++ A+YVG  R+  Y +H +D+L   L G + A
Sbjct:   33 PYKRGFYCNDESIRYPYREDTITNGLMAGVTISCTVIIISSGEMYMVFSKRLYSRSECNNYIAALY---KVVGTYLFGAAISQSL------TDLAKYMIGRPRPNFIAVCDPDWS-TVNCSGYVTDFT--CRGNYANVTDSRLSFYSGHSSFGMYCMLFLSLYVQARLCGKWARLLRP--TIQFFLLSFALYVGYTRVSDYKHHWSDVLVGLLQGAIVA 237          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Xenopus
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:100491270])

HSP 1 Score: 53.1434 bits (126), Expect = 2.157e-7
Identity = 60/223 (26.91%), Postives = 103/223 (46.19%), Query Frame = 2
Query:  251 YENDKTISYP---HKHSLSLYVLMPIVCFAPAIVIVIIETSI---QYFTHDLSNRFNKVSILGRFQFKGHIIGSYI-FCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFID--NFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAI 889
            Y++  T  YP       +   +L+ +V   P +VI++ ET +   Q  T D  N+  K  + G   +   ++   + F GI+   +  T +     +   G L+P+FL +C  N +  L  + F         C  + + +++ R +FP    A +V A   L +Y+   +K K T L  P  ++ L L+ +A   G  R+  Y NH +D++A FLIG   AI
Sbjct:   46 YDSSYTKPYPGPDESSDIPPVLLLSLVTGVPVLVIIVGETVVFCLQVATRDFENQ-EKTLLTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYT-ALGCQQFTQFITDANACTGNPDLVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTRLAKP--VLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAI 264          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Xenopus
Match: PLPPR5 (phospholipid phosphatase related 5 [Source:NCBI gene;Acc:100491270])

HSP 1 Score: 53.1434 bits (126), Expect = 2.619e-7
Identity = 60/223 (26.91%), Postives = 103/223 (46.19%), Query Frame = 2
Query:  251 YENDKTISYP---HKHSLSLYVLMPIVCFAPAIVIVIIETSI---QYFTHDLSNRFNKVSILGRFQFKGHIIGSYI-FCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFID--NFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAI 889
            Y++  T  YP       +   +L+ +V   P +VI++ ET +   Q  T D  N+  K  + G   +   ++   + F GI+   +  T +     +   G L+P+FL +C  N +  L  + F         C  + + +++ R +FP    A +V A   L +Y+   +K K T L  P  ++ L L+ +A   G  R+  Y NH +D++A FLIG   AI
Sbjct:   44 YDSSYTKPYPGPDESSDIPPVLLLSLVTGVPVLVIIVGETVVFCLQVATRDFENQ-EKTLLTGDCCYINPLVRRTVRFLGIYTFGLFATDIFVNAGQVVTGNLAPHFLTVCKPNYT-ALGCQQFTQFITDANACTGNPDLVIKARRTFPSKDAALSVYAALYLAMYITSTIKAKGTRLAKP--VLCLGLMCLAFLTGINRVAEYRNHWSDVIAGFLIGISIAI 262          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Mouse
Match: Plpp1 (phospholipid phosphatase 1 [Source:MGI Symbol;Acc:MGI:108412])

HSP 1 Score: 67.3958 bits (163), Expect = 2.888e-12
Identity = 65/222 (29.28%), Postives = 111/222 (50.00%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQ-YFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G++ ND +I YP+K     Y L+  +     I+++ I  S+  YF    SN F     +    +K   +G+++F     QS+      T   K+ +G L P+FLA+C  + S    S G+I+++   CQ +   + +GR SF   H++ ++  +  + LYL  R+K  W  L  P  ++   LIA +IYVG  R+  Y +H +D+    + G   AI+
Sbjct:   33 PFQRGIFCNDDSIKYPYKEDTIPYALLGGIVIPFCIIVMSIGESLSVYFNVLHSNSFVGNPYIATI-YKA--VGAFLFGVSASQSL------TDIAKYTIGSLRPHFLAICNPDWSKINCSDGYIEDY--ICQGNEEKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--MLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Mouse
Match: Plpp2 (phospholipid phosphatase 2 [Source:MGI Symbol;Acc:MGI:1354945])

HSP 1 Score: 61.2326 bits (147), Expect = 3.357e-10
Identity = 62/221 (28.05%), Postives = 101/221 (45.70%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRL-KKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G Y  D +I YP++     + LM  V     +++V +  +   +T  L +R N         F  ++   Y   G  L     +  +T   K+ +GRL P+FLA+C  + S  +   G++      C+ S   + + R SF   H++  +  +  L LY+  RL  KW  L  P   V   L+A AIYVG  R+  + +H +D+L   L G L A +
Sbjct:   31 PYKRGFYCGDDSIRYPYRPDTITHGLMAGVIITATVILVSLGEAYLVYTDRLYSRSN---------FNNYVAAIYKVLGTFLFGAAVSQSLTDLAKYMIGRLRPSFLAVCDPDWSQ-VNCSGYVQL--EVCRGSPANVTEARLSFYSGHSSFGMYCMLFLALYVQARLCWKWARLLRP--TVQFFLVAFAIYVGYTRVSDHKHHWSDVLVGLLQGALVACL 237          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Mouse
Match: Plpp3 (phospholipid phosphatase 3 [Source:MGI Symbol;Acc:MGI:1915166])

HSP 1 Score: 60.077 bits (144), Expect = 8.962e-10
Identity = 69/227 (30.40%), Postives = 109/227 (48.02%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIE--TSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIF-CGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA--IIFF 898
            P   G Y ND++I YP K  +S  +   ++C A  IVI I+   T   Y  + L  +    +           +G ++F C I   S  FT +     K  +GRL P+FL++C  + S    S+G+I N+   C+   + + + R SF   H + ++  +  L+LYL  R   W   +    L+   L+ +A Y G  R+  Y +HP+D+LA F  G L A  I+FF
Sbjct:   61 PYRRGFYCNDESIKYPLK--VSETINDAVLC-AVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAI---SQSFTDIA----KVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYR--CRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARF-TWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFF 274          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Mouse
Match: Plpp1 (phospholipid phosphatase 1 [Source:MGI Symbol;Acc:MGI:108412])

HSP 1 Score: 58.151 bits (139), Expect = 3.773e-9
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  230 FPPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            +P + G +  D ++ YP H  ++   +L  +    P   + I E+   YF    SN F     +    +K   +G+++F     QS+      T   K+ +G L P+FLA+C  + S    S G+I+++   CQ +   + +GR SF   H++ ++  +  + LYL  R+K  W  L  P  ++   LIA +IYVG  R+  Y +H +D+    + G   AI+
Sbjct:   33 YPFQRGFFCTDNSVKYPYHDSTIPSRILAILGLGLPIFSMSIGESLSVYFNVLHSNSFVGNPYIATI-YKA--VGAFLFGVSASQSL------TDIAKYTIGSLRPHFLAICNPDWSKINCSDGYIEDY--ICQGNEEKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--MLQFGLIAFSIYVGLSRVSDYKHHWSDVTVGLIQGAAMAIL 242          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Mouse
Match: Plppr5 (phospholipid phosphatase related 5 [Source:MGI Symbol;Acc:MGI:1923019])

HSP 1 Score: 53.1434 bits (126), Expect = 1.849e-7
Identity = 58/227 (25.55%), Postives = 106/227 (46.70%), Query Frame = 2
Query:  245 GVYENDKTISYPHKHSLSLYVLMPIVCFA-----PAIVIVIIETSI---QYFTHDLSNRFNKVSILGRFQFKGHIIGSYI-FCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFID--NFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAI 889
            G + +D     P+        + P++ ++     P +VI++ ET++   Q  T D  N+  K  + G   +   ++   + F GI+   +  T +     +   G L+P+FLALC  N +  L  + +    +    C  + + I++ R +FP    A +V A   L +Y+   +K K T L  P  ++ L L+ +A   G  R+  Y NH +D++A FL+G   A+
Sbjct:   42 GFFCHDSAYRKPYPGPEDSSAVPPVLLYSLAAGVPVLVIIVGETAVFCLQLATRDFENQ-EKTILTGDCCYINPLVRRTVRFLGIYAFGLFATDIFVNAGQVVTGNLAPHFLALCKPNYTA-LGCQQYTQFISGEEACTGNPDLIMRARKTFPSKEAALSVYAATYLTMYITSTIKAKGTRLAKP--VLCLGLMCLAFLTGLNRVAEYRNHWSDVIAGFLVGISIAV 264          
BLAST of Lipid phosphate phosphohydrolase 2 vs. UniProt/SwissProt
Match: sp|P60588|PLPP1_PIG (Phospholipid phosphatase 1 OS=Sus scrofa OX=9823 GN=PLPP1 PE=1 SV=2)

HSP 1 Score: 78.5666 bits (192), Expect = 3.071e-15
Identity = 69/222 (31.08%), Postives = 119/222 (53.60%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVII-ETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G++ ND++I YP+K     Y L+  +    +I+++I+ ET   YF    SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+N+   C+ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+AV+IYVG  R+  Y +H +D+L   + G L AI+
Sbjct:   33 PFQRGLFCNDESIKYPYKEDTIPYPLLGGIIIPFSIIVMIVGETLSVYFNLLHSNSFIRNNYIATI-YKA--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIENY--ICRGNAQKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAIV 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. UniProt/SwissProt
Match: sp|O88956|PLPP1_CAVPO (Phospholipid phosphatase 1 OS=Cavia porcellus OX=10141 GN=PLPP1 PE=1 SV=1)

HSP 1 Score: 77.0258 bits (188), Expect = 9.204e-15
Identity = 66/222 (29.73%), Postives = 119/222 (53.60%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL-SNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G++ ND++I YP+K     Y L+  +    +IV++II  ++  + + L SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL++C  + S    S G+I+ +   C+ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+A +IYVG  RI  Y +H +D+L   + G + AI+
Sbjct:   33 PFQRGIFCNDESIKYPYKEDTIPYALLGGIMIPFSIVVMIIGETLSVYCNLLHSNSFIRNNYIATI-YKS--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLSVCDPDWSKVNCSDGYIEYY--VCRGNAEKVKEGRLSFYSGHSSFSMYCMVFVALYLQARMKGDWARLLRP--TLQFGLVAASIYVGLSRISDYKHHWSDVLTGLIQGAIVAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. UniProt/SwissProt
Match: sp|O08564|PLPP1_RAT (Phospholipid phosphatase 1 OS=Rattus norvegicus OX=10116 GN=Plpp1 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 3.604e-14
Identity = 68/222 (30.63%), Postives = 115/222 (51.80%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVII-ETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + GV+  D++I YP++     Y L+  +     I+++I  ET   YF    SN F     +    +K   +G+++F     QS+      T   K+ +GRL P+FLA+C  + S    S G+I+NF   CQ +   + +GR SF   H++ ++  +  + LYL  R+K  W  L  P  ++   L+A++IYVG  R+  Y +H +D+L   + G + AI+
Sbjct:   33 PFQRGVFCTDESIKYPYREDTIPYALLGGIVIPFCIIVMITGETLSVYFNVLHSNSFVSNHYIATI-YKA--VGAFLFGASASQSL------TDIAKYSIGRLRPHFLAVCNPDWSKINCSDGYIENF--VCQGNEQKVREGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--MLQFGLVALSIYVGLSRVSDYKHHWSDVLIGLIQGAVVAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. UniProt/SwissProt
Match: sp|O14494|PLPP1_HUMAN (Phospholipid phosphatase 1 OS=Homo sapiens OX=9606 GN=PLPP1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.361e-11
Identity = 66/222 (29.73%), Postives = 119/222 (53.60%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL-SNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + GV+ ND++I YP+K     Y L+  +    +I+++I+  ++  + + L SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+ +   C+ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+AV+IYVG  R+  Y +H +D+L   + G L AI+
Sbjct:   33 PFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLLHSNSFIRNNYIATI-YKA--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIEYY--ICRGNAERVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGALVAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. UniProt/SwissProt
Match: sp|Q9V576|WUN_DROME (Putative phosphatidate phosphatase OS=Drosophila melanogaster OX=7227 GN=wun PE=1 SV=2)

HSP 1 Score: 68.1662 bits (165), Expect = 1.889e-11
Identity = 65/231 (28.14%), Postives = 112/231 (48.48%), Query Frame = 2
Query:  233 PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIET--SIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQ--------SSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G + +D+++ +P H  ++  ++L  I    P  VI I+E   S      D  N  ++  +   ++    +I  Y   GI+    + + L T   K+ +GRL P+F+A+C    +D       I N G++ Q        SS+  + + R SFP  H++ T  A+  L LYL  R+  W   +    L+  L I VA Y    R+  Y +H +D+LA  LIG+++A++
Sbjct:  113 PYKRGFFCDDESLKHPFHDSTVRNWMLYFIGAVIPVGVIFIVEVIISQNKAKQDNGNATSRRYVFMNYELPDWMIECYKKIGIYAFGAVLSQLTTDIAKYSIGRLRPHFIAVCQPQMADGSTCDDAI-NAGKYIQEFTCKGVGSSARMLKEMRLSFPSGHSSFTFFAMVYLALYLQARM-TWRGSKLLRHLLQFLFIMVAWYTALSRVSDYKHHWSDVLAGSLIGSISALV 341          
BLAST of Lipid phosphate phosphohydrolase 2 vs. TrEMBL
Match: A0A091XYS5 (Lipid phosphate phosphohydrolase 1 (Fragment) OS=Opisthocomus hoazin OX=30419 GN=N306_15532 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.027e-14
Identity = 73/222 (32.88%), Postives = 119/222 (53.60%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKH-SLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + GV+ +D++I YP+K  ++S  +L  I+     IVI++ ET   ++ H  SN F + + +    +K   IG++IF     QS+      T   K+ +GRL P+FLA+C  + +    S G+I+NF   CQ     I +GR SF   H++ ++  +  L LYL  R+K  W  L  P   +   LIA +IYVG  R+  Y +H +D+L   + G + A++
Sbjct:   16 PFQRGVFCSDESIRYPYKEDTISYKLLAGIIVPFSIIVIILGETLSVFYNHLHSNSFVRNNYIATI-YKA--IGTFIFGAAASQSL------TDIAKYSIGRLRPHFLAVCQPDWARINCSLGYIENFS--CQGDKAKINEGRLSFYSGHSSFSMYCMLFLALYLQARMKGDWARLVRP--TLQFGLIAASIYVGLSRVSDYKHHWSDVLTGLIQGAMVAVL 224          
BLAST of Lipid phosphate phosphohydrolase 2 vs. TrEMBL
Match: A0A1U7R4W1 (phospholipid phosphatase 1 OS=Alligator sinensis OX=38654 GN=PLPP1 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 2.878e-14
Identity = 75/222 (33.78%), Postives = 117/222 (52.70%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKH-SLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + GV+ ND++I YP K  ++S  +L  I+     IVI+I E    Y+ H  SN F + + +    +K   IG++IF     QS+      T   K+ +GRL P+FLA+C  + +    S G+I+NF   CQ     + +GR SF   H++ ++  +  L LYL  R+K  W  L  P   V   L+A +IYVG  R+  Y +H +D+L   + G + AI+
Sbjct:   42 PFQRGVFCNDESIQYPIKEDTISYQLLAGIIVPLDIIVIIIGEALSVYYNHLHSNSFVRNNYIATI-YKA--IGTFIFGAAASQSL------TDIAKYSIGRLRPHFLAVCQPDWTQINCSLGYIENFP--CQGDKAKVNEGRLSFYSGHSSFSMYCMLFLALYLQARMKGDWARLLRP--TVQFGLVAASIYVGLSRVSDYKHHWSDVLTGLIQGAVIAIL 250          
BLAST of Lipid phosphate phosphohydrolase 2 vs. TrEMBL
Match: A0A384B7J9 (phospholipid phosphatase 1 isoform X2 OS=Balaenoptera acutorostrata scammoni OX=310752 GN=PLPP1 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 6.667e-14
Identity = 71/222 (31.98%), Postives = 118/222 (53.15%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVII-ETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G++ ND++I YP+K     Y L+  +    +I+++I+ ET   YF    SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+NF   CQ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+A +IYVG  RI  Y +H +D+L   + G L AI+
Sbjct:   33 PFQRGLFCNDESIKYPYKEDTIPYPLLGGIIIPFSIIVMIVGETLSVYFNLLHSNSFIRNNYIATI-YKA--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIENF--ICQGNAQKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--TLQFGLVAASIYVGLSRISDYKHHWSDVLTGLIQGALAAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. TrEMBL
Match: A0A5E4ANS3 (acidPPc domain-containing protein OS=Marmota monax OX=9995 GN=MONAX_5E031135 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 8.890e-14
Identity = 71/222 (31.98%), Postives = 120/222 (54.05%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVII-ETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + GV+ ND++I YP+K     Y L+  +    +IV+++I ET   YF    SN F + S +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+N+   C+ +++ + +GR SF   H++ ++  +  L +YL  R+K  W  L  P   +   L+AV+IYVG  R+  Y +H +D+L   + G + AI+
Sbjct:   33 PFQRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIVVMLIGETLSVYFKLLHSNSFIRNSYIAT-TYKA--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSDGYIENY--ICRGNADKVKEGRLSFYSGHSSFSMYCMLFLAIYLQARMKGDWARLLRP--TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLIQGAVVAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. TrEMBL
Match: A0A452SCC8 (Phospholipid phosphatase 1 OS=Ursus americanus OX=9643 GN=PLPP1 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 1.012e-13
Identity = 69/222 (31.08%), Postives = 120/222 (54.05%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL-SNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G++ ND++I YP+K     Y L+  +    +I+++II  ++  + + L SN F + + +    +K   IG+++F     QS+      T   K+ +GRL P+FL +C  + S    S G+I+N+   CQ ++  + +GR SF   H++ ++  +  + LYL  R+K  W  L  P   +   L+AV+IYVG  R+  Y +H +D+L   L G L AI+
Sbjct:   33 PFQRGIFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVMIIGEALSVYYNVLHSNSFIRNNYIATI-YKS--IGTFLFGAAASQSL------TDIAKYSIGRLRPHFLDVCDPDWSKINCSAGYIENY--ICQGNAQKVKEGRLSFYSGHSSFSMYCMLFVALYLQARMKGDWARLLRP--TLQFGLVAVSIYVGLSRVSDYKHHWSDVLTGLLQGALVAIL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Cavefish
Match: ENSAMXT00000045118.1 (phospholipid phosphatase 1-like [Source:NCBI gene;Acc:103035969])

HSP 1 Score: 63.5438 bits (153), Expect = 4.888e-11
Identity = 58/220 (26.36%), Postives = 101/220 (45.91%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAI 889
            P + G + +D +I YP K     Y L+  +     + ++++   +  +     +  N       F      +GS++F     QS+      T   K+ +GRL P+FL +C  N        G+I+ F   C      + +GR SF   H++ ++  +  L LYL  R+K +W  L  P   +   LIA ++YVG  R+  Y +H +D+L  F+ G + A+
Sbjct:   33 PFKRGFFCSDDSIKYPFKEDTISYQLLMGIMIPFVLFVIVVGECLSIYLRSRPSFMNDY-----FACIYKAVGSFVFGAAVSQSL------TDIAKYTIGRLRPHFLTICKPNWGLVDCKSGYIEKFS--CTGDKTLVNEGRLSFYSGHSSFSMYCMLFLALYLQSRMKAEWARLLRP--TIQFFLIAASVYVGLSRVSDYKHHWSDVLTGFIQGAIVAM 237          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Cavefish
Match: plpp2b (phospholipid phosphatase 2-like [Source:NCBI gene;Acc:103028797])

HSP 1 Score: 63.1586 bits (152), Expect = 5.371e-11
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNR--FNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G+Y ND++I YP K     + LM  V  + A++I+    +   ++  L +   FN+ ++     +K   +G+++F     QS+      T   K  +GR  PNF+++C      P   KG++      C    + + + R SF   H++  +  +  L LY+  RL+ KW  L  P   +   L+A A+YVG  R+  Y +H +D+L   L G L A++
Sbjct:   16 PYQRGIYCNDESIMYPLKEDTITHGLMAAVTISCAVIILSSGEAYLVYSKKLQSNSGFNQYAVA---LYKA--VGTFLFGAAVSQSL------TDLAKFTIGRPRPNFISVC-----KPKLCKGYMPIIN--CTGVPDDVTESRLSFYSGHSSFGMYCMLFLALYVQARLRAKWARLLRP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVLVGLLQGALVAVL 218          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Cavefish
Match: plpp2b (phospholipid phosphatase 2-like [Source:NCBI gene;Acc:103028797])

HSP 1 Score: 63.5438 bits (153), Expect = 6.409e-11
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNR--FNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G+Y ND++I YP K     + LM  V  + A++I+    +   ++  L +   FN+ ++     +K   +G+++F     QS+      T   K  +GR  PNF+++C      P   KG++      C    + + + R SF   H++  +  +  L LY+  RL+ KW  L  P   +   L+A A+YVG  R+  Y +H +D+L   L G L A++
Sbjct:   34 PYQRGIYCNDESIMYPLKEDTITHGLMAAVTISCAVIILSSGEAYLVYSKKLQSNSGFNQYAVA---LYKA--VGTFLFGAAVSQSL------TDLAKFTIGRPRPNFISVC-----KPKLCKGYMPIIN--CTGVPDDVTESRLSFYSGHSSFGMYCMLFLALYVQARLRAKWARLLRP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVLVGLLQGALVAVL 236          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Cavefish
Match: plpp2b (phospholipid phosphatase 2-like [Source:NCBI gene;Acc:103028797])

HSP 1 Score: 62.7734 bits (151), Expect = 7.939e-11
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNR--FNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G+Y ND++I YP K     + LM  V  + A++I+    +   ++  L +   FN+ ++     +K   +G+++F     QS+      T   K  +GR  PNF+++C      P   KG++      C    + + + R SF   H++  +  +  L LY+  RL+ KW  L  P   +   L+A A+YVG  R+  Y +H +D+L   L G L A++
Sbjct:   34 PYQRGIYCNDESIMYPLKEDTITHGLMAAVTISCAVIILSSGEAYLVYSKKLQSNSGFNQYAVA---LYKA--VGTFLFGAAVSQSL------TDLAKFTIGRPRPNFISVC-----KPKLCKGYMPIIN--CTGVPDDVTESRLSFYSGHSSFGMYCMLFLALYVQARLRAKWARLLRP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVLVGLLQGALVAVL 236          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Cavefish
Match: plpp2b (phospholipid phosphatase 2-like [Source:NCBI gene;Acc:103028797])

HSP 1 Score: 62.3882 bits (150), Expect = 1.424e-10
Identity = 62/223 (27.80%), Postives = 108/223 (48.43%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNR--FNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P + G+Y ND++I YP K     + LM  V  + A++I+    +   ++  L +   FN+ ++     +K   +G+++F     QS+      T   K  +GR  PNF+++C      P   KG++      C    + + + R SF   H++  +  +  L LY+  RL+ KW  L  P   +   L+A A+YVG  R+  Y +H +D+L   L G L A++
Sbjct:   65 PYQRGIYCNDESIMYPLKEDTITHGLMAAVTISCAVIILSSGEAYLVYSKKLQSNSGFNQYAVA---LYKA--VGTFLFGAAVSQSL------TDLAKFTIGRPRPNFISVC-----KPKLCKGYMPIIN--CTGVPDDVTESRLSFYSGHSSFGMYCMLFLALYVQARLRAKWARLLRP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVLVGLLQGALVAVL 267          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Nematostella
Match: EDO33490 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS23])

HSP 1 Score: 57.7658 bits (138), Expect = 1.473e-9
Identity = 67/237 (28.27%), Postives = 111/237 (46.84%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHS-LSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQ----SMIFTF------LITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA--IIFFY 901
            P   G Y ND+TI+ P+K S +  YV   +    P    +++ET           RF++ +   R   + + +GS     + L+     ++F F      L+T   K+ VGRL P+FL +C  +TS    +  FI +    C      I + R SFP  H++     +  LILY+  R+    +YL  P  L+ L+ + + I  G  RI  Y +H +D+ A   +GT  A  +++F+
Sbjct:   67 PYHRGFYCNDETINKPYKDSTVKNYVATLVGLLLPGASFILVETL----------RFSEETPKERDMHQIYYVGSVKLHPVFLRFAKIVVVFLFGAAVNTLLTDVGKYSVGRLRPHFLTMCKPDTSLFNCTTEFITSV--VCTGDPAIIREARLSFPSGHSSFAAYTMCFLILYIQARVDIPQSYLLKP--LLQLIPLVLGILCGLSRISDYKHHWSDVFAGLALGTTIAYGVVWFH 289          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Nematostella
Match: EDO33491 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS24])

HSP 1 Score: 53.9138 bits (128), Expect = 1.976e-8
Identity = 65/238 (27.31%), Postives = 104/238 (43.70%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHS-LSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFL-------------KHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFY 901
            P   G Y ND+TI+ P+  S +  YV   +    P    +++ET           RF + +   R   + + +GS     +H   M F  ++ +FL             K+ VGRL P+FL +C  +TS    +  FI +    C      I Q R SFP  H++     +  LILY+  R+    +YL     L+ L+ + + I  G  RI  Y +H +D+ A   +GT  A +  +
Sbjct:   21 PYHRGFYCNDETINKPYIDSTVKNYVATLVGLLLPGASFILVETL----------RFREETPKERAMHQIYYVGS---VKLHPVFMRFAKIVVVFLFGAAVNTLLTDVGKYSVGRLRPHFLTVCKPDTSLFNCTTEFITSV--VCTGDPAIIRQARLSFPSGHSSFAAYTMCFLILYIQARVDIPQSYLLK--PLLQLIPLILGILCGLSRISDYKHHWSDVFAGLALGTTIAYVVVW 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Nematostella
Match: EDO45164 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTY2])

HSP 1 Score: 46.2098 bits (108), Expect = 7.076e-6
Identity = 45/136 (33.09%), Postives = 60/136 (44.12%), Query Frame = 2
Query:  488 IFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGR--FCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRL-KKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA 886
            I T LIT   K  VGR  P FLA+C     DPL        +     C      IL+ R SFP  H++     +  L LYL   +  + T L  P + V  + + +   +   RI  Y +H  D+LA   IGTL A
Sbjct:  101 IVTSLITDIGKLSVGRQRPYFLAVC---KPDPLKINCTAGQYTEVSVCTGDKAEILEARLSFPSGHSSFAAYTMVFLSLYLEAIIPTRKTVLLKPFLQVSAISLGLLCALS--RIFDYRHHWGDVLAGLAIGTLIA 231          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Medaka
Match: plpp1a (phospholipid phosphatase 1 [Source:NCBI gene;Acc:101172508])

HSP 1 Score: 73.1738 bits (178), Expect = 2.442e-14
Identity = 68/223 (30.49%), Postives = 109/223 (48.88%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGH-IIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG-FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P   G Y ND TI YP K     Y L+  V     I+I+II   +  +     NR +  S  G +  + +  +G+++F     QS+      T   K+ +GRL P+FL +C  + +    S G +I+NF   C   +  + +GR SF   H++ ++  +  L LYL  RL+ +W  L  P   +   LIA ++Y G  R+  Y +H +D+L   L G L A++
Sbjct:   33 PFRRGFYCNDDTIKYPFKEDTISYQLLGAVMIPVTILIMIIGECLLVYL----NRLHSKSCFGSYVARVYKAVGTFLFGAAMSQSL------TDIAKYSIGRLRPHFLDVCKPDWTRINCSLGVYIENFT--CTGDAKMVNEGRLSFYSGHSSFSMYCMLFLALYLQARLQVQWARLLRP--TLQFFLIAASVYTGLSRVSDYKHHWSDVLTGLLQGALMALL 241          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Medaka
Match: plpp1a (phospholipid phosphatase 1 [Source:NCBI gene;Acc:101172508])

HSP 1 Score: 65.855 bits (159), Expect = 8.533e-12
Identity = 64/224 (28.57%), Postives = 112/224 (50.00%), Query Frame = 2
Query:  233 PPELGVYENDKTISYP-HKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGH-IIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG-FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P ++G + +D +I YP H  +++  VL  +    P   ++I E  + Y      NR +  S  G +  + +  +G+++F     QS+      T   K+ +GRL P+FL +C  + +    S G +I+NF   C   +  + +GR SF   H++ ++  +  L LYL  RL+ +W  L  P   +   LIA ++Y G  R+  Y +H +D+L   L G L A++
Sbjct:   34 PYQVGFFCSDDSIRYPFHPSTITSTVLYTVGFVLPISCMIIGECLLVYL-----NRLHSKSCFGSYVARVYKAVGTFLFGAAMSQSL------TDIAKYSIGRLRPHFLDVCKPDWTRINCSLGVYIENFT--CTGDAKMVNEGRLSFYSGHSSFSMYCMLFLALYLQARLQVQWARLLRP--TLQFFLIAASVYTGLSRVSDYKHHWSDVLTGLLQGALMALL 242          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Medaka
Match: plpp2a (phospholipid phosphatase 2 [Source:NCBI gene;Acc:101168661])

HSP 1 Score: 64.6994 bits (156), Expect = 1.553e-11
Identity = 62/224 (27.68%), Postives = 108/224 (48.21%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL--SNRFNK-VSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P +  ++ ND+TI YP+K     +  M  V    +IVI+    +   +   L  + +FN+ +S L +      ++G+Y+F     QS+      T   K  +GR  PNF ++C      P+  +G +      C  ++  + + R SF   H++  +  +  L LY+  R++ KWT L  P   +   L+A A+YVG  R+  Y +H +D+L   L G L A++
Sbjct:   30 PYQRDIFCNDQTIKYPYKKDTISHGTMAAVTITCSIVIITTGEAFLVYKKRLHSNTKFNQYLSTLYK------VVGTYLFGAAVSQSL------TDLAKFTIGRPRPNFFSVCA-----PVSCEGLV--LRSNCTGAARNVTESRLSFYSGHSSFGMYCMVFLSLYVQARMQGKWTRLARP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVLVGLLQGALIAVL 232          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Medaka
Match: plpp2a (phospholipid phosphatase 2 [Source:NCBI gene;Acc:101168661])

HSP 1 Score: 65.0846 bits (157), Expect = 1.692e-11
Identity = 62/224 (27.68%), Postives = 108/224 (48.21%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDL--SNRFNK-VSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLK-KWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAII 892
            P +  ++ ND+TI YP+K     +  M  V    +IVI+    +   +   L  + +FN+ +S L +      ++G+Y+F     QS+      T   K  +GR  PNF ++C      P+  +G +      C  ++  + + R SF   H++  +  +  L LY+  R++ KWT L  P   +   L+A A+YVG  R+  Y +H +D+L   L G L A++
Sbjct:   42 PYQRDIFCNDQTIKYPYKKDTISHGTMAAVTITCSIVIITTGEAFLVYKKRLHSNTKFNQYLSTLYK------VVGTYLFGAAVSQSL------TDLAKFTIGRPRPNFFSVCA-----PVSCEGLV--LRSNCTGAARNVTESRLSFYSGHSSFGMYCMVFLSLYVQARMQGKWTRLARP--TIQFFLVAFAVYVGYTRVSDYKHHWSDVLVGLLQGALIAVL 244          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Medaka
Match: ENSORLT00000037249.1 (phospholipid phosphatase 3 [Source:NCBI gene;Acc:101171943])

HSP 1 Score: 62.7734 bits (151), Expect = 1.089e-10
Identity = 66/222 (29.73%), Postives = 108/222 (48.65%), Query Frame = 2
Query:  230 FPP-ELGVYENDKTISYPHKHSLSLYVLMPIVCFA-PAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIF-CGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTA 886
            FPP + G + ND +I  P+K S+    ++  V F+ P + I+I E+   YF ++ S  F     +     +   +G +IF C I   S  FT +     K  VGR+ P+FL +C  + S    S G+I  +   CQ   +++ + R SF   H + ++  +  L+ YL  R   W   +    L    LI ++ Y G  R+  + +HPTD+LA F+ G + A
Sbjct:   59 FPPYQRGFFCNDNSIRLPYKTSVVSTTVLTAVGFSVPVVSIIIGESYRIYFLNEGSKSFVGNPYISALYKQ---VGVFIFGCAI---SQSFTDI----AKVSVGRMRPHFLDVCKPDFSTINCSLGYITEYQ--CQGPESHVQEARKSFFSGHASFSMYTMLYLVFYLQSRFT-WHGARLLRPLTQFTLIMMSFYTGLSRVSDHKHHPTDVLAGFIQGAVVA 267          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Planmine SMEST
Match: SMESG000062942.1 (SMESG000062942.1)

HSP 1 Score: 503.442 bits (1295), Expect = 0.000e+0
Identity = 280/282 (99.29%), Postives = 281/282 (99.65%), Query Frame = 2
Query:  146 MKFHTRLLVDVTXXXXXXXXXXXXXXFEFPPELGVYENDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFYQYSLGNISCAIGFNSESVTYLDFSNRNQIV 991
            MKFHTRLLVDVTIFLLALLLCILISIFEFPPELGVY NDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPLILVYLLLIAVAIYVGSLRIITYWNHPTDILASFL+GTLTAIIFFYQYSLGNISCAIGFNSESVTYLDFSNRNQIV
Sbjct:    1 MKFHTRLLVDVTIFLLALLLCILISIFEFPPELGVYGNDKTISYPHKHSLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWTYLQSPLILVYLLLIAVAIYVGSLRIITYWNHPTDILASFLVGTLTAIIFFYQYSLGNISCAIGFNSESVTYLDFSNRNQIV 282          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Planmine SMEST
Match: SMESG000051487.1 (SMESG000051487.1)

HSP 1 Score: 86.2705 bits (212), Expect = 4.546e-19
Identity = 78/245 (31.84%), Postives = 132/245 (53.88%), Query Frame = 2
Query:  245 GVYENDKTISYPHKH-SLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKGFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWT-------YLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFYQYSLGNISCAIGFNSESV 955
            G + ND+T+ +P K+ +++  +L+ +    P I+I+I+E S+    + L     KV +  RF    ++   +    +H   ++ TF IT  +K RVGRL P FL +C L  S  L S  F+D+    C+ +   +   R SFP  H+A T+ AV  +I+Y+H +L  WT       +LQS      L L+++ IYV + R+  YW+HP D++A  ++G +  +I +Y  +    +C  G N+ES+
Sbjct:   37 GFFPNDQTLMHPLKNETVNWNILLLLTATIPPIIIIIVEFSLSINRNSL-----KVQMTERFSIPLYVFNIFKSVYLHWLVLVITFFITDIVKFRVGRLRPYFLTVCDLEVS-KLNSSSFVDD-PSLCRGNETTLSVARQSFPSGHSAMTMCAVVSVIIYIHKKL--WTDCPSLRFFLQS----FSLGLLSIVIYVATSRLNDYWHHPLDVIAGVILGFIVTVILYYSQT-DCFNC--GNNTESI 265          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Planmine SMEST
Match: SMESG000018237.1 (SMESG000018237.1)

HSP 1 Score: 68.5514 bits (166), Expect = 6.457e-13
Identity = 69/228 (30.26%), Postives = 114/228 (50.00%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKH-SLSLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSK-GFIDNFGRFCQSSSNYILQG-RFSFPCIHTACTVSAVGILILYLHFRLKKWT--YLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFY 901
            P + G Y +D++I YP+K  ++  YV+  I    P I+I + E       H+  N   K +I     F   +I  Y+FCGI L  + F  ++T   K  +GRL P+F+  C ++ +    S   ++     FC  ++  IL+  R SFP  H++C+      L +YL   +K+W   + Q   +LV  L I +A+  G  R+  Y +H +D+L     GT+ AI+ +Y
Sbjct:   33 PFQRGFYCDDESIRYPYKQGTIPFYVVGIIGIGIPLIIIALTE-----LFHERENLSRKSNIYK--SFPAVVINIYMFCGIFLFGVAFDQMLTNSSKFLIGRLRPHFINACQVDFNKVNCSNYNYVIIDDTFCLQTNPKILKDMRLSFPSGHSSCSAYCAIALTIYL---IKRWNLRHFQVLRVLVQALFIGLAVMCGLSRVSDYKHHWSDVLTGLCSGTVVAIVMWY 250          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Planmine SMEST
Match: SMESG000018250.1 (SMESG000018250.1)

HSP 1 Score: 56.6102 bits (135), Expect = 6.046e-9
Identity = 65/237 (27.43%), Postives = 106/237 (44.73%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFA-PAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG---FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWT--YLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFYQYSLGNIS 925
            P   G + +D++I YP+  S   + L+ I+    P  +IV+ E       H   N   K ++         I+  Y FCGI    + F   +T   K  +GRL P+FL  C L+ S    S     +I+N     + S+  +   R SFP  H++ +        +YL    K+W   + Q   +L+ +L I +AI  G  RI  Y +H +D+      GT+ AI+ +Y +   N+ 
Sbjct:   33 PFRRGFFCDDESIRYPNNKSTVSFNLVWIIGVGIPLGIIVLTE-----IFHQRENLIRKSNVYRNLPVV--IMNCYTFCGIFFFGVGFDQSLTNLTKFVIGRLRPHFLDACKLDISKLNCSDHAYVYIEN-SACAEKSARALKHMRMSFPSGHSSLSAYGAVAFTIYL---TKRWNLGHFQILRVLIQILYIGLAIMCGFSRISDYKHHWSDVAYGMCSGTVVAIVIWYVFLRVNVD 258          
BLAST of Lipid phosphate phosphohydrolase 2 vs. Planmine SMEST
Match: SMESG000018250.1 (SMESG000018250.1)

HSP 1 Score: 56.225 bits (134), Expect = 8.253e-9
Identity = 65/237 (27.43%), Postives = 106/237 (44.73%), Query Frame = 2
Query:  233 PPELGVYENDKTISYPHKHSLSLYVLMPIVCFA-PAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHIIGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSKG---FIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKWT--YLQSPXXXXXXXXXXXXXXXGSLRIITYWNHPTDILASFLIGTLTAIIFFYQYSLGNIS 925
            P   G + +D++I YP+  S   + L+ I+    P  +IV+ E       H   N   K ++         I+  Y FCGI    + F   +T   K  +GRL P+FL  C L+ S    S     +I+N     + S+  +   R SFP  H++ +        +YL    K+W   + Q   +L+ +L I +AI  G  RI  Y +H +D+      GT+ AI+ +Y +   N+ 
Sbjct:   38 PFRRGFFCDDESIRYPNNKSTVSFNLVWIIGVGIPLGIIVLTE-----IFHQRENLIRKSNVYRNLPVV--IMNCYTFCGIFFFGVGFDQSLTNLTKFVIGRLRPHFLDACKLDISKLNCSDHAYVYIEN-SACAEKSARALKHMRMSFPSGHSSLSAYGAVAFTIYL---TKRWNLGHFQILRVLIQILYIGLAIMCGFSRISDYKHHWSDVAYGMCSGTVVAIVIWYVFLRVNVD 263          
The following BLAST results are available for this feature:
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLPP12.835e-1229.73phospholipid phosphatase 1 [Source:HGNC Symbol;Acc... [more]
PLPP14.843e-1229.60phospholipid phosphatase 1 [Source:HGNC Symbol;Acc... [more]
PLPP21.188e-1027.68phospholipid phosphatase 2 [Source:HGNC Symbol;Acc... [more]
PLPP25.666e-1027.68phospholipid phosphatase 2 [Source:HGNC Symbol;Acc... [more]
PLPP31.347e-828.19phospholipid phosphatase 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
plpp-1.34.904e-625.11PhosphoLipid PhosPhatase homolog [Source:UniProtK... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wun4.776e-1328.21gene:FBgn0016078 transcript:FBtr0306111[more]
wun6.213e-1328.14gene:FBgn0016078 transcript:FBtr0088553[more]
wun1.885e-1228.14gene:FBgn0016078 transcript:FBtr0088552[more]
CG114262.367e-1126.89gene:FBgn0037166 transcript:FBtr0078506[more]
wun21.582e-824.35gene:FBgn0041087 transcript:FBtr0339380[more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plpp1a1.506e-1027.80phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-G... [more]
plpp1a1.601e-1027.80phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-G... [more]
plpp1a1.645e-1027.75phospholipid phosphatase 1a [Source:ZFIN;Acc:ZDB-G... [more]
LO018102.12.329e-1028.95phospholipid phosphatase 1-like [Source:NCBI gene;... [more]
plpp2b3.417e-1028.57phospholipid phosphatase 2b [Source:ZFIN;Acc:ZDB-G... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plpp12.718e-1229.55phospholipid phosphatase 1 [Source:NCBI gene;Acc:4... [more]
plpp11.042e-1029.55phospholipid phosphatase 1 [Source:NCBI gene;Acc:4... [more]
bmp2k5.008e-1026.94BMP2 inducible kinase [Source:Xenbase;Acc:XB-GENE-... [more]
PLPPR52.157e-726.91phospholipid phosphatase related 5 [Source:NCBI ge... [more]
PLPPR52.619e-726.91phospholipid phosphatase related 5 [Source:NCBI ge... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plpp12.888e-1229.28phospholipid phosphatase 1 [Source:MGI Symbol;Acc:... [more]
Plpp23.357e-1028.05phospholipid phosphatase 2 [Source:MGI Symbol;Acc:... [more]
Plpp38.962e-1030.40phospholipid phosphatase 3 [Source:MGI Symbol;Acc:... [more]
Plpp13.773e-927.80phospholipid phosphatase 1 [Source:MGI Symbol;Acc:... [more]
Plppr51.849e-725.55phospholipid phosphatase related 5 [Source:MGI Sym... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P60588|PLPP1_PIG3.071e-1531.08Phospholipid phosphatase 1 OS=Sus scrofa OX=9823 G... [more]
sp|O88956|PLPP1_CAVPO9.204e-1529.73Phospholipid phosphatase 1 OS=Cavia porcellus OX=1... [more]
sp|O08564|PLPP1_RAT3.604e-1430.63Phospholipid phosphatase 1 OS=Rattus norvegicus OX... [more]
sp|O14494|PLPP1_HUMAN1.361e-1129.73Phospholipid phosphatase 1 OS=Homo sapiens OX=9606... [more]
sp|Q9V576|WUN_DROME1.889e-1128.14Putative phosphatidate phosphatase OS=Drosophila m... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A091XYS52.027e-1432.88Lipid phosphate phosphohydrolase 1 (Fragment) OS=O... [more]
A0A1U7R4W12.878e-1433.78phospholipid phosphatase 1 OS=Alligator sinensis O... [more]
A0A384B7J96.667e-1431.98phospholipid phosphatase 1 isoform X2 OS=Balaenopt... [more]
A0A5E4ANS38.890e-1431.98acidPPc domain-containing protein OS=Marmota monax... [more]
A0A452SCC81.012e-1331.08Phospholipid phosphatase 1 OS=Ursus americanus OX=... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000045118.14.888e-1126.36phospholipid phosphatase 1-like [Source:NCBI gene;... [more]
plpp2b5.371e-1127.80phospholipid phosphatase 2-like [Source:NCBI gene;... [more]
plpp2b6.409e-1127.80phospholipid phosphatase 2-like [Source:NCBI gene;... [more]
plpp2b7.939e-1127.80phospholipid phosphatase 2-like [Source:NCBI gene;... [more]
plpp2b1.424e-1027.80phospholipid phosphatase 2-like [Source:NCBI gene;... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO334901.473e-928.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334911.976e-827.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO451647.076e-633.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
plpp1a2.442e-1430.49phospholipid phosphatase 1 [Source:NCBI gene;Acc:1... [more]
plpp1a8.533e-1228.57phospholipid phosphatase 1 [Source:NCBI gene;Acc:1... [more]
plpp2a1.553e-1127.68phospholipid phosphatase 2 [Source:NCBI gene;Acc:1... [more]
plpp2a1.692e-1127.68phospholipid phosphatase 2 [Source:NCBI gene;Acc:1... [more]
ENSORLT00000037249.11.089e-1029.73phospholipid phosphatase 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Lipid phosphate phosphohydrolase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062942.10.000e+099.29SMESG000062942.1[more]
SMESG000051487.14.546e-1931.84SMESG000051487.1[more]
SMESG000018237.16.457e-1330.26SMESG000018237.1[more]
SMESG000018250.16.046e-927.43SMESG000018250.1[more]
SMESG000018250.18.253e-927.43SMESG000018250.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025789 ID=SMED30025789|Name=Lipid phosphate phosphohydrolase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1057bp
GTCGGTCATGATTAAAGCCCATTAAATGAGTGGGGTACAGATACTTAAAG
AATCTTGAGGGAATTAGCATTTTGATGTGCAAACCGAATAATGTAATAAA
TTATGCCAAAGTTCAATTATTTACATCGTTCTAACAAAACCTGACATGAA
ATTTCATACCCGTTTGCTCGTGGATGTTACTATATTTCTGCTTGCATTGT
TGCTCTGTATCCTAATAAGTATTTTCGAATTTCCGCCGGAGCTTGGAGTG
TACGAAAATGACAAAACTATATCATATCCACATAAACATTCACTAAGTCT
CTACGTATTAATGCCAATTGTATGCTTTGCTCCGGCTATTGTAATAGTTA
TTATTGAAACCTCAATCCAATATTTTACTCATGATCTCAGCAATCGGTTC
AACAAGGTTTCAATTCTTGGCCGGTTTCAGTTCAAAGGTCACATCATTGG
AAGCTATATATTCTGTGGAATTCACTTGCAGTCCATGATATTTACTTTTC
TCATTACTTTATTCTTGAAACATCGCGTAGGAAGGTTAAGTCCAAATTTC
TTGGCTTTATGTATACTCAACACATCGGATCCACTTCCGTCCAAGGGGTT
CATTGATAACTTTGGTAGGTTTTGTCAAAGTAGTTCAAATTACATTCTAC
AAGGGAGATTCTCATTTCCATGCATTCATACGGCTTGCACGGTCAGCGCC
GTTGGAATTTTGATTTTGTATTTGCACTTTCGATTAAAAAAATGGACTTA
TCTTCAATCTCCATTGATTTTGGTTTATTTACTTTTGATTGCTGTAGCGA
TATATGTTGGCAGTTTGAGAATCATCACTTATTGGAACCATCCTACTGAC
ATCCTAGCTAGCTTTCTAATTGGAACCTTAACTGCAATAATCTTTTTCTA
CCAATATTCTCTCGGCAATATTTCCTGTGCTATCGGCTTCAATTCCGAAT
CTGTAACATATCTGGACTTTAGCAATCGCAATCAAATTGTTCTTTAAATT
TTGTTCATTAAAAAAATAAAATAATAATAATATTAATAATAATATTAATA
ATAATAA
back to top

protein sequence of SMED30025789-orf-1

>SMED30025789-orf-1 ID=SMED30025789-orf-1|Name=SMED30025789-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=284bp
MKFHTRLLVDVTIFLLALLLCILISIFEFPPELGVYENDKTISYPHKHSL
SLYVLMPIVCFAPAIVIVIIETSIQYFTHDLSNRFNKVSILGRFQFKGHI
IGSYIFCGIHLQSMIFTFLITLFLKHRVGRLSPNFLALCILNTSDPLPSK
GFIDNFGRFCQSSSNYILQGRFSFPCIHTACTVSAVGILILYLHFRLKKW
TYLQSPLILVYLLLIAVAIYVGSLRIITYWNHPTDILASFLIGTLTAIIF
FYQYSLGNISCAIGFNSESVTYLDFSNRNQIVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006644phospholipid metabolic process
GO:0006629lipid metabolic process
GO:0016311dephosphorylation
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043216PLPP
IPR036938P_Acid_Pase_2/haloperoxi_sf
IPR000326P_Acid_Pase_2/haloperoxidase
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0008195phosphatidate phosphatase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000326Phosphatidic acid phosphatase type 2/haloperoxidaseSMARTSM00014acid_phosph_2coord: 107..251
e-value: 2.0E-6
score: 37.3
IPR000326Phosphatidic acid phosphatase type 2/haloperoxidasePFAMPF01569PAP2coord: 112..254
e-value: 2.1E-18
score: 66.4
NoneNo IPR availableGENE3DG3DSA:1.20.144.10coord: 5..260
e-value: 8.9E-13
score: 49.8
NoneNo IPR availableTMHMMTMhelixcoord: 49..71
NoneNo IPR availableTMHMMTMhelixcoord: 234..256
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 173..195
IPR043216Phospholipid phosphatasePANTHERPTHR10165LIPID PHOSPHATE PHOSPHATASEcoord: 9..254
IPR036938Phosphatidic acid phosphatase type 2/haloperoxidase superfamilySUPERFAMILYSSF48317Acid phosphatase/Vanadium-dependent haloperoxidasecoord: 107..254