Acetylcholine receptor subunit beta-like 1

Overview
NameAcetylcholine receptor subunit beta-like 1
Smed IDSMED30025787
Uniprot Best hitAcetylcholine receptor subunit beta-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta1 PE=2 SV=1 (E=6.43831e-133)
Length (bp)1564
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Acetylcholine receptor subunit beta-like 1 (SMED30025787) t-SNE clustered cells

Violin plots show distribution of expression levels for Acetylcholine receptor subunit beta-like 1 (SMED30025787) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Acetylcholine receptor subunit beta-like 1 (SMED30025787) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Acetylcholine receptor subunit beta-like 1 (SMED30025787) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025787

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30025787SMESG000031561.1 dd_Smed_v4_12992_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30025787SMESG000031561.1 dd_Smed_v4_12992_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 332.413 bits (851), Expect = 8.925e-108
Identity = 165/333 (49.55%), Postives = 234/333 (70.27%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPT-TEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPP 1126
            +E E +L  +LF  +GYN   RPV NT+  + V  GL + Q+I+VDEKNQ++ +NVWL+  W+D++L+WNP+DFGN+  +RVPS+ IW PDIVL+NNADG + V+      +++ G + W+PP I+KSSC+IDVT+FPFDQQ CKM+FGSWT+D  ++ L      Q VDL D+W+S  W ++N  G   +  +   A    ++ Y   IRR  LFYT+NLI+PC+LI+ LT  VFYLP++ GEK+ LCISVLL+L VFLLL+++I+P TS+ IPLI +YLLFT I   +++++TV  +N+H+R+P  H MP W+R   +   P  LLM RPP
Sbjct:   34 TETEDRLFKHLF--RGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQME--QTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMNRPP 362          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Human
Match: CHRNB4 (cholinergic receptor nicotinic beta 4 subunit [Source:HGNC Symbol;Acc:HGNC:1964])

HSP 1 Score: 331.257 bits (848), Expect = 1.515e-107
Identity = 162/349 (46.42%), Postives = 240/349 (68.77%), Query Frame = 2
Query:   77 LHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            L L  +V +   G+  RV+  E KL+D L N   YNNLIRP ++++  ++++L L L Q+I+V+E+ QI+ +NVWL+  W D++L WN S +  +N++R+P+ +IW PDIVL+NNADG YEVS   N+++ ++G++LW+PP I+KS+C I+V YFPFDQQ C ++F SWT+D T++ +   +    +D  DF  S  WD++  PG  +   +P      ++ Y   I+RK LFYT+NLI+PCVL   L   VFYLP++ GEKM LCISVLLAL  FLLL+S+I+PPTS+ +PLI KYL+FT +L   +++ +V  +N+H+R+P  H M  W++ CF+ K P  L MKRP
Sbjct:    7 LVLFFLVALCGRGN-CRVANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIKLQLSLAQLISVNEREQIMTTNVWLKQEWTDYRLTWNSSRYEGVNILRIPAKRIWLPDIVLYNNADGTYEVSVYTNLIVRSNGSVLWLPPAIYKSACKIEVKYFPFDQQNCTLKFRSWTYDHTEIDMVLMTPTASMD--DFTPSGEWDIVALPG--RRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLTTLLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMAPWVKRCFLHKLPTFLFMKRP 350          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 330.872 bits (847), Expect = 5.255e-107
Identity = 165/333 (49.55%), Postives = 234/333 (70.27%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPT-TEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPP 1126
            +E E +L  +LF  +GYN   RPV NT+  + V  GL + Q+I+VDEKNQ++ +NVWL+  W+D++L+WNP+DFGN+  +RVPS+ IW PDIVL+NNADG + V+      +++ G + W+PP I+KSSC+IDVT+FPFDQQ CKM+FGSWT+D  ++ L      Q VDL D+W+S  W ++N  G   +  +   A    ++ Y   IRR  LFYT+NLI+PC+LI+ LT  VFYLP++ GEK+ LCISVLL+L VFLLL+++I+P TS+ IPLI +YLLFT I   +++++TV  +N+H+R+P  H MP W+R   +   P  LLM RPP
Sbjct:   56 TETEDRLFKHLF--RGYNRWARPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLEQME--QTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGALLGCVPRWLLMNRPP 384          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 327.791 bits (839), Expect = 4.698e-106
Identity = 180/458 (39.30%), Postives = 273/458 (59.61%), Query Frame = 2
Query:  125 RVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP---------------PHITN----EXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFA-------------AVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            R SE E +L + LF  + YN +IRPV+N +  + +   + + Q++ VDE NQI+ +N+WL+  WND++L+WNPSD+G    +RVP+ +IW+PDIVL+NNA G+++V  K   L+   G + WIPP IFKSSC IDVTYFPFD Q C M+FGSW++D  ++ L        ++L D+W+S  W ++  PG    Y H  +    E     I Y L+IRR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP  H MP W++  F+   P ++ M RP                 ++N       + K      P  +       +    +      +TR   ++E++D + +             +V +IA N+++++   +   DWK+VA VIDR+
Sbjct:   30 RASEAEHRLFERLF--EDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGS--SMNLKDYWESGEWAIIKAPG----YKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRS-SSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRI 478          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Human
Match: CHRNA3 (cholinergic receptor nicotinic alpha 3 subunit [Source:HGNC Symbol;Acc:HGNC:1957])

HSP 1 Score: 327.791 bits (839), Expect = 4.698e-106
Identity = 180/458 (39.30%), Postives = 273/458 (59.61%), Query Frame = 2
Query:  125 RVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP---------------PHITN----EXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFA-------------AVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            R SE E +L + LF  + YN +IRPV+N +  + +   + + Q++ VDE NQI+ +N+WL+  WND++L+WNPSD+G    +RVP+ +IW+PDIVL+NNA G+++V  K   L+   G + WIPP IFKSSC IDVTYFPFD Q C M+FGSW++D  ++ L        ++L D+W+S  W ++  PG    Y H  +    E     I Y L+IRR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP  H MP W++  F+   P ++ M RP                 ++N       + K      P  +       +    +      +TR   ++E++D + +             +V +IA N+++++   +   DWK+VA VIDR+
Sbjct:   30 RASEAEHRLFERLF--EDYNEIIRPVANVSDPVIIHFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWNPSDYGGAEFMRVPAQKIWKPDIVLYNNAVGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGS--SMNLKDYWESGEWAIIKAPG----YKHDIKYNCCEEIYPDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPSWVKTVFLNLLPRVMFMTRPTSNEGNAQKPRPLYGAELSNLNCFSRAESKGCKEGYPCQDGMCGYCHHRRIKISNFSANLTRS-SSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQDDWKYVAMVIDRI 478          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Celegans
Match: acr-3 (Acetylcholine receptor subunit beta-type acr-3 [Source:UniProtKB/Swiss-Prot;Acc:Q93149])

HSP 1 Score: 358.221 bits (918), Expect = 1.469e-118
Identity = 210/463 (45.36%), Postives = 307/463 (66.31%), Query Frame = 2
Query:  140 EGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXX--XXXXXQPDNEMTREIEANE-----NLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMXXXXXXXXXXXXXXXXXNFETIDPNFNQDEVIKKFSSQ 1504
            E +L+ Y+F+  GYN+LIRPV N ++  + V   L  + +INVDEKNQI+ +NVW  + WND+Q+QW+P +F  +  IRVP D++W PDIVLFNNADGNY VS+  NV++ + G++LW+PP ++KSSC IDV +FPFD+Q C + FGSWTF   ++ LS+ SG + V+L+D+  S  WDL++ PG + +         ++I Y + IRRK LFYTV LI+P VL+AFL+  VFYLP ES EK+ L IS+LLALVVFLL+VS+ILPPTS +IPL++KYLL TFI+N+I ++V+V+ IN+++R P  H MP W++  F++  P L +M+RP     EL K K+      S++ A++        +  EQP     ++  ++E     +  +   A+ +I  +L  ++A  +   +WKFV+ VIDR++L LF  VTT GT GILL+   +    NQ  VI++   Q
Sbjct:   26 EERLLSYIFD--GYNSLIRPVLNASSPPIEVFFSLAFVLLINVDEKNQIMQTNVWPTMKWNDYQMQWDPREFDGIKTIRVPPDKVWLPDIVLFNNADGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDVEFFPFDEQVCSLTFGSWTFRKDELQLSYLSGKRHVELNDYLPSGVWDLIDAPGLLID-------ERSKISYQIKIRRKALFYTVILIMPTVLMAFLSMMVFYLPAESSEKITLAISILLALVVFLLVVSKILPPTSSTIPLMAKYLLMTFIMNMITIMVSVIIINVYFRGPATHIMPNWVKTVFLKFLPVLFVMRRPESTEKELAKMKREKRERRSMKSALKTFFKRNDAKISEQPKQTSRKDGSSSEEKLSSDAKKAIEAIEYITTHLTHDNAFKRQREEWKFVSVVIDRLLLYLFFAVTTGGTVGILLSAPNVFEQVNQTSVIERLKQQ 479          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Celegans
Match: acr-2 (Acetylcholine receptor subunit beta-type acr-2 [Source:UniProtKB/Swiss-Prot;Acc:P48182])

HSP 1 Score: 353.984 bits (907), Expect = 8.416e-116
Identity = 186/343 (54.23%), Postives = 254/343 (74.05%), Query Frame = 2
Query:  107 DIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI 1132
            D GD++   E E +L+  LF  + YN LIRPV N ++  + V+ G+ +I +INVDEKNQI+ +NVWL + WNDFQL WNP+++GN++ + VPSD++W PDIVLFNNADGNYEVS+K NV + + G++ W+PP +FKSSC IDV +FPFD+Q C + FGSWT+++ +V L WY+ IQ V L D+  S  WD+++ PG++    H       ++V+ + IRRKTLFYTV LI+P VL+AFL+   FYLP +SGEK+ L IS+LLALVVFLLLVS+ILPPTS +IPL+ KYLL  F+LNI AV+ TV+ +NI++R+   H+MP W+R  F+E  P LL+MKRP  I
Sbjct:   51 DQGDTM--GEDEDRLVIDLF--REYNFLIRPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLHWYNNIQAVQLHDYSYSGIWDVIDVPGQL---VHKPDLKENKMVFNVVIRRKTLFYTVILIIPTVLMAFLSVMAFYLPVDSGEKVSLTISLLLALVVFLLLVSKILPPTS-NIPLMGKYLLLAFVLNITAVVGTVVIVNIYFRSALSHKMPTWVRKVFLEFLPHLLVMKRPERI 385          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Celegans
Match: unc-29 (Acetylcholine receptor subunit beta-type unc-29 [Source:UniProtKB/Swiss-Prot;Acc:P48181])

HSP 1 Score: 347.436 bits (890), Expect = 2.825e-114
Identity = 200/453 (44.15%), Postives = 303/453 (66.89%), Query Frame = 2
Query:   68 ISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMT--REIEANE-------NLDEIFA--AVNFIAANLQSEDAIDQALHDWKFVASVIDRMM 1390
            +S++ +L VVI   I ++I  S+ E +L+  +F  +GYN+LI+PV N++   L V++ L L+ +INVDEK+Q++ +NVWL L W+DFQ++WNP ++G +  IRV  D++W PDIVLFNNADGNYEVS+  NV+I + G++LW+PP I+KSSC IDV +FPFD+Q C + FGSWT++  ++ L +    + VD+S++  S  WD+++ P  + N         + I + + IRRKTLFYTV LI+P VL+AFL+  VF+LPT+SGEK+ L ISVLL++VVFLLLVS+ILPPTS +IPL++KYLL TF+LN+I ++VTV+ IN+++R P+ H+MP+W+R  F++  P L+ MKRP    +E    +     +P +       S  +      D+  T  R   +NE       + D + A  A+ +I  +L+ ++       DWK+VA +IDR++
Sbjct:    6 LSWILVLSVVIFLVIINTINASDDEERLMVDVF--RGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTNVWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVEFFPFDEQVCTLVFGSWTYNENEIKLEFVQA-ELVDVSEYSASSIWDVIDVPASLVN-------KRSRIEFQVRIRRKTLFYTVVLIIPTVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFRGPRTHRMPQWVRVVFLQFLPKLVCMKRPKS-ASERSAVRSGMAQLPGVGQFTLSPSAHHPLCPSADDRTTTIRNTASNETSAYYPLSTDALRAIDAIEYITEHLKRDEQHKSFRDDWKYVAMIIDRLL 447          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Celegans
Match: unc-29 (Acetylcholine receptor subunit beta-type unc-29 [Source:UniProtKB/Swiss-Prot;Acc:P48181])

HSP 1 Score: 347.436 bits (890), Expect = 2.825e-114
Identity = 200/453 (44.15%), Postives = 303/453 (66.89%), Query Frame = 2
Query:   68 ISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMT--REIEANE-------NLDEIFA--AVNFIAANLQSEDAIDQALHDWKFVASVIDRMM 1390
            +S++ +L VVI   I ++I  S+ E +L+  +F  +GYN+LI+PV N++   L V++ L L+ +INVDEK+Q++ +NVWL L W+DFQ++WNP ++G +  IRV  D++W PDIVLFNNADGNYEVS+  NV+I + G++LW+PP I+KSSC IDV +FPFD+Q C + FGSWT++  ++ L +    + VD+S++  S  WD+++ P  + N         + I + + IRRKTLFYTV LI+P VL+AFL+  VF+LPT+SGEK+ L ISVLL++VVFLLLVS+ILPPTS +IPL++KYLL TF+LN+I ++VTV+ IN+++R P+ H+MP+W+R  F++  P L+ MKRP    +E    +     +P +       S  +      D+  T  R   +NE       + D + A  A+ +I  +L+ ++       DWK+VA +IDR++
Sbjct:    6 LSWILVLSVVIFLVIINTINASDDEERLMVDVF--RGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTNVWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVEFFPFDEQVCTLVFGSWTYNENEIKLEFVQA-ELVDVSEYSASSIWDVIDVPASLVN-------KRSRIEFQVRIRRKTLFYTVVLIIPTVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFRGPRTHRMPQWVRVVFLQFLPKLVCMKRPKS-ASERSAVRSGMAQLPGVGQFTLSPSAHHPLCPSADDRTTTIRNTASNETSAYYPLSTDALRAIDAIEYITEHLKRDEQHKSFRDDWKYVAMIIDRLL 447          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Celegans
Match: lev-1 (Acetylcholine receptor subunit beta-type lev-1 [Source:UniProtKB/Swiss-Prot;Acc:Q27218])

HSP 1 Score: 334.339 bits (856), Expect = 6.156e-109
Identity = 192/430 (44.65%), Postives = 280/430 (65.12%), Query Frame = 2
Query:  134 EYEGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNE---MTREIEANENLDEI-------FAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMM 1390
            + E +L+  LF  +GYN+L++PV N +   + V++G+ L+ +INVDEK Q++ +NVWL + W+DFQL+W+P D+ N+  IRV  +++W PDIVLFNNADGNYEVS+  NVLI + G +LW+PP I+KSSC IDV +FPFD Q C + FGSWT++  ++ L + +  + VD S++  S  WD+++ P  +        +  + I + + IRRKTLFYTV LILP VL+AFL   VFYLPT SGEKM L ++VLL++VVFLLLVS+ILPPTS SIPL++KYLL TF+LNII ++VT +  NI++R+P  H++P W+R  F++  P L+ M+RP       +  ++     PS+E         +       N+       I+++E  DE+         A+ FI  N + E+   Q   DWKF+ASV+DR +
Sbjct:   36 DAEDRLMVDLF--RGYNSLVQPVRNRSELPMIVKIGMQLVLLINVDEKEQVMHTNVWLTMKWDDFQLKWDPRDYANITQIRVAPEKVWLPDIVLFNNADGNYEVSFMCNVLILSTGTVLWVPPAIYKSSCIIDVEFFPFDDQLCSLTFGSWTYNRDEIKLDFLTSDR-VDFSEYSTSSIWDMMDGPAVLT-------SDRSRIEFQIRIRRKTLFYTVVLILPTVLMAFLNVTVFYLPTASGEKMGLTMNVLLSIVVFLLLVSKILPPTSSSIPLVAKYLLLTFVLNIITIMVTTIICNIYFRSPITHRLPPWVRKVFLDILPLLMCMQRPHRKNVIQRSHRRLLETGPSVEENPMRSGEHHPLCRHTHNQDSCRRVRIQSDELDDELSPEAQRAIDAIEFITENRRDEEITKQFRDDWKFIASVVDRFL 455          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Fly
Match: nAChRbeta1 (gene:FBgn0000038 transcript:FBtr0073299)

HSP 1 Score: 399.438 bits (1025), Expect = 4.692e-134
Identity = 203/347 (58.50%), Postives = 265/347 (76.37%), Query Frame = 2
Query:   86 LIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPT-TEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            ++V++ F +   +  SE E +L+  LF  +GYN LIRPV N T  + V  GL  +Q+INV+EKNQI+ SNVWLRL W D+QLQW+ +D+G + V+R+P D++W+PDIVLFNNADGNYEV +K NVLIY  G +LW+PP I++SSCTIDVTYFPFDQQTC M+FGSWTF+  QV+L+ Y+   FVDLSD+WKS TWD++  P  +  Y      PT T+I + + IRRKTLFYTVNLILP VLI+FL   VFYLP E+GEK+ L IS+LL+LVVFLLLVS+ILPPTS+ +PLI+KYLLFTFI+N ++++VTV+ IN ++R P+ H+MP +IR  F+   P  L MKRP
Sbjct:   13 ILVLVAFSL---VSASEDEERLVRDLF--RGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQIMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRP 354          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 324.324 bits (830), Expect = 3.397e-104
Identity = 164/351 (46.72%), Postives = 240/351 (68.38%), Query Frame = 2
Query:  116 DSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQ--------FVDLSDFWKSETWDLLNCPGEIKNYTHPGQA-PTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            ++++ +    +L D L ++  YN LIRPVSN T T+ V+LGL L Q+I+++ K+QI+ +NVWL   W D + +W+PS++G +  + VPS+ IW PDIVL+NNADG Y V+     +++  G ++W PP IFKSSC IDV YFPFDQQTC M+FGSWT+D  Q+ L   S            +DL +++ S  WD+L  P E     +P  A P  +I + + +RRKTLFYTVNLI+PCV I++L+  VFYLP +SGEK+ LCIS+LL+  +F LL+S+I+P TS+++PL+ KYLLFT +L  ++V++T++ +NIHYR P  H+M  WIR  F+++ P LLLM+ P  +  +
Sbjct:   37 ETVQANPDAKRLYDDLLSN--YNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRD 385          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 324.324 bits (830), Expect = 3.397e-104
Identity = 164/351 (46.72%), Postives = 240/351 (68.38%), Query Frame = 2
Query:  116 DSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQ--------FVDLSDFWKSETWDLLNCPGEIKNYTHPGQA-PTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            ++++ +    +L D L ++  YN LIRPVSN T T+ V+LGL L Q+I+++ K+QI+ +NVWL   W D + +W+PS++G +  + VPS+ IW PDIVL+NNADG Y V+     +++  G ++W PP IFKSSC IDV YFPFDQQTC M+FGSWT+D  Q+ L   S            +DL +++ S  WD+L  P E     +P  A P  +I + + +RRKTLFYTVNLI+PCV I++L+  VFYLP +SGEK+ LCIS+LL+  +F LL+S+I+P TS+++PL+ KYLLFT +L  ++V++T++ +NIHYR P  H+M  WIR  F+++ P LLLM+ P  +  +
Sbjct:   37 ETVQANPDAKRLYDDLLSN--YNRLIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVPKDLLRD 385          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Fly
Match: nAChRbeta2 (gene:FBgn0004118 transcript:FBtr0084681)

HSP 1 Score: 320.087 bits (819), Expect = 3.846e-103
Identity = 185/459 (40.31%), Postives = 276/459 (60.13%), Query Frame = 2
Query:   83 LLIVVIIFDIGDSIRVSEYEG-----KLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQ-------FVDLSDFWKSETWDLLNCPGEIKNYTHPGQ-APTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP----PHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEAN----ENLD----EIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDR 1384
            LL V ++  + +S     +E      +L D L ++  YN LIRPV N T TLTV LGL L Q+I V+ KNQ++ +N+W++  W D++L+W+P ++G +  + VPS+ IW PDIVL+NN DGNYEV+      +   G + W PP I+KSSC ++V YFP+D+Q C M+FGSWT++  QV L     I         +DL++F+ S  WD+L  P       +P    P ++I + L +RRKTLFYTVNLI+PCV + FLT  VFYLP++SGEK+ LCIS+L++L VF LL+++I+PPTS+++PL+ KYLLFT IL  ++V  TV  +NIH+R+P  H M   +R  F+   P L++M+R     P   +        N I     ++      ++      DN M   ++++     NL     +   AV FIA +++  D  ++ + DWKFV+ V+DR
Sbjct:    6 LLCVFLLVPLANSTAPISFEANPDTKRLYDDLLSN--YNRLIRPVVNNTETLTVWLGLKLSQLIEVNLKNQVMTTNLWVKQRWFDYKLRWDPEEYGGVEQLYVPSEHIWVPDIVLYNNWDGNYEVTLMTKATLKYTGEVFWEPPAIYKSSCEMNVEYFPYDEQICFMKFGSWTYNGAQVDLKHLDQIPGSNLVQVGIDLTEFYLSVEWDILEVPATKNEEYYPDTLEPFSDITFKLTMRRKTLFYTVNLIVPCVALTFLTVLVFYLPSDSGEKVTLCISILVSLTVFFLLLAEIIPPTSLAVPLLGKYLLFTMILVSLSVWTTVCVLNIHFRSPSTHNMSPLVRKLFLHFMPKLMMMRRTQYTLPDYDDSTPSNGYTNEIDVRDSISDFPSEFKDSQDGAYDNGMQNSVDSDNVIPRNLTPEVLQALRAVRFIAQHIKDADKDNEIVEDWKFVSMVLDR 462          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0334916)

HSP 1 Score: 318.931 bits (816), Expect = 3.388e-102
Identity = 156/318 (49.06%), Postives = 227/318 (71.38%), Query Frame = 2
Query:  179 YNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQ-------FVDLSDFWKSETWDLLNCPG-EIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLL 1108
            YN LIRPV N +  LTV++GL L Q+I+V+ KNQI+ +NVW+   WND++L+WNP D+G ++ + VPS+ IW PDIVL+NNADGNYEV+     ++++ G ++W PP I+KS C IDV YFPFD+QTC M+FGSWT+D   V L               +DL D++ S  WD++  P    + +    + P  +IV+ L +RRKTLFYTVNLI+PCV I+FL+  VFYLP++SGEK+ LCIS+LL+L VF LL+++I+PPTS+++PL+ KYLLFT +L  ++V+VT+  +N+++R+P  H+M  W++  F++  P LL
Sbjct:   36 YNRLIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQILPKLL 353          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 331.257 bits (848), Expect = 4.787e-108
Identity = 177/437 (40.50%), Postives = 268/437 (61.33%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI-TNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDN----------------EMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             ++ E +L+D+L   + YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +NVWL   WND++L W+P+++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ N G+I W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ L  Y    F    D+  S  WD+++ PG  +           ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H+MP+W++  F+ K P  LLM+RP      E  ++K       S    + L  +     + P                      ++  + ++DE    V FIA +++ ED  +  + DWK+VA VIDR+
Sbjct:   12 AADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDL--YLTSDFASRDDYTPSGEWDIVSLPG--RRNEDLSDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDEAIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRL 444          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 330.487 bits (846), Expect = 8.383e-108
Identity = 177/437 (40.50%), Postives = 268/437 (61.33%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI-TNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDN----------------EMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             ++ E +L+D+L   + YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +NVWL   WND++L W+P+++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ N G+I W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ L  Y    F    D+  S  WD+++ PG  +           ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H+MP+W++  F+ K P  LLM+RP      E  ++K       S    + L  +     + P                      ++  + ++DE    V FIA +++ ED  +  + DWK+VA VIDR+
Sbjct:    4 AADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDL--YLTSDFASRDDYTPSGEWDIVSLPG--RRNEDLSDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDEAIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRL 436          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 331.257 bits (848), Expect = 9.842e-108
Identity = 177/437 (40.50%), Postives = 268/437 (61.33%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI-TNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDN----------------EMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             ++ E +L+D+L   + YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +NVWL   WND++L W+P+++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ N G+I W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ L  Y    F    D+  S  WD+++ PG  +           ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H+MP+W++  F+ K P  LLM+RP      E  ++K       S    + L  +     + P                      ++  + ++DE    V FIA +++ ED  +  + DWK+VA VIDR+
Sbjct:   25 AADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDL--YLTSDFASRDDYTPSGEWDIVSLPG--RRNEDLSDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDEAIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRL 457          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 330.872 bits (847), Expect = 1.031e-107
Identity = 177/437 (40.50%), Postives = 268/437 (61.33%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI-TNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDN----------------EMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             ++ E +L+D+L   + YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +NVWL   WND++L W+P+++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ N G+I W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ L  Y    F    D+  S  WD+++ PG  +           ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H+MP+W++  F+ K P  LLM+RP      E  ++K       S    + L  +     + P                      ++  + ++DE    V FIA +++ ED  +  + DWK+VA VIDR+
Sbjct:   23 AADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDL--YLTSDFASRDDYTPSGEWDIVSLPG--RRNEDLSDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDEAIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRL 455          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Zebrafish
Match: chrnb5a (cholinergic receptor, nicotinic, beta 5a [Source:ZFIN;Acc:ZDB-GENE-090312-169])

HSP 1 Score: 330.487 bits (846), Expect = 1.413e-107
Identity = 177/437 (40.50%), Postives = 268/437 (61.33%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI-TNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDN----------------EMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             ++ E +L+D+L   + YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +NVWL   WND++L W+P+++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ N G+I W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ L  Y    F    D+  S  WD+++ PG  +           ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H+MP+W++  F+ K P  LLM+RP      E  ++K       S    + L  +     + P                      ++  + ++DE    V FIA +++ ED  +  + DWK+VA VIDR+
Sbjct:   17 AADAEERLVDFLLGPERYNKLIRPAVNKSQQVTIGIKVSLAQLISVNEREQIMTTNVWLTQEWNDYRLVWDPNEYEGIKKLRIPSRHIWLPDIVLYNNADGVYEVSFYCNAVVSNTGDIFWLPPAIYKSACAIEVRNFPFDQQNCTLKFRSWTYDRTELDL--YLTSDFASRDDYTPSGEWDIVSLPG--RRNEDLSDPTYLDVTYDFVIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHRMPEWVKRVFLHKLPFFLLMRRPGRSNVRERFRRKHQRKSFSSDTKGLRLDGDSYFLSDDPGRVCGAWRVGDLPEGSEFRQRVKVRHDPDVDEAIEGVRFIAEHMKIEDDDEGIIEDWKYVAMVIDRL 449          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 335.495 bits (859), Expect = 1.514e-109
Identity = 176/438 (40.18%), Postives = 269/438 (61.42%), Query Frame = 2
Query:  113 GDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPH--ITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANE-----------NLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            G   + ++ E +L++ L     YN LIRP  N +  ++++L L L Q+I+V+E+ QI+ +NVWL   W D++L WNP+D+  +  +R+PS QIW PDIVL+NNADG YEVS   N ++ N+G++ W+PP I+KS+C I+V +FPFDQQ C ++F SWT+D T++ L    G  +  + DF  S  WD++  PG  +    P      ++ Y   I+RK LFYT+NLI+PC+LI  L   VFYLP++ G+KM LCISVLLAL VFLLL+S+I+PPTS+ +PLI KYL+FT +L   +++ +V  +N+H+R+P  H MP W++ CF+++ P  L MKRP +   + +L+  ++N  I         +        +   N+    +   E            + E    V FI+ +++SED     + DWK+VA V+DR+
Sbjct:    1 GRGCKAADSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDYTEIDLVLNKG--WATMDDFTPSGEWDIIELPG--RRTICPLDPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYTPEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRL 434          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 333.183 bits (853), Expect = 3.186e-108
Identity = 175/434 (40.32%), Postives = 268/434 (61.75%), Query Frame = 2
Query:  125 RVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPH--ITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANE-----------NLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            + ++ E +L++ L     YN LIRP  N +  ++++L L L Q+I+V+E+ QI+ +NVWL   W D++L WNP+D+  +  +R+PS QIW PDIVL+NNADG YEVS   N ++ N+G++ W+PP I+KS+C I+V +FPFDQQ C ++F SWT+D T++ L    G  +  + DF  S  WD++  PG  +    P      ++ Y   I+RK LFYT+NLI+PC+LI  L   VFYLP++ G+KM LCISVLLAL VFLLL+S+I+PPTS+ +PLI KYL+FT +L   +++ +V  +N+H+R+P  H MP W++ CF+++ P  L MKRP +   + +L+  ++N  I         +        +   N+    +   E            + E    V FI+ +++SED     + DWK+VA V+DR+
Sbjct:   43 KAADSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDYTEIDLVLNKG--WATMDDFTPSGEWDIIELPG--RRTICPLDPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYTPEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRL 472          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 332.413 bits (851), Expect = 3.327e-108
Identity = 175/434 (40.32%), Postives = 268/434 (61.75%), Query Frame = 2
Query:  125 RVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPH--ITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANE-----------NLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            + ++ E +L++ L     YN LIRP  N +  ++++L L L Q+I+V+E+ QI+ +NVWL   W D++L WNP+D+  +  +R+PS QIW PDIVL+NNADG YEVS   N ++ N+G++ W+PP I+KS+C I+V +FPFDQQ C ++F SWT+D T++ L    G  +  + DF  S  WD++  PG  +    P      ++ Y   I+RK LFYT+NLI+PC+LI  L   VFYLP++ G+KM LCISVLLAL VFLLL+S+I+PPTS+ +PLI KYL+FT +L   +++ +V  +N+H+R+P  H MP W++ CF+++ P  L MKRP +   + +L+  ++N  I         +        +   N+    +   E            + E    V FI+ +++SED     + DWK+VA V+DR+
Sbjct:   23 KSTDSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDYTEIDLVLNKG--WATMDDFTPSGEWDIIELPG--RRTICPLDPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYTPEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRL 452          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Xenopus
Match: usp16 (ubiquitin specific peptidase 16 [Source:Xenbase;Acc:XB-GENE-1007164])

HSP 1 Score: 332.798 bits (852), Expect = 3.379e-108
Identity = 175/434 (40.32%), Postives = 268/434 (61.75%), Query Frame = 2
Query:  125 RVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPH--ITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANE-----------NLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            + ++ E +L++ L     YN LIRP  N +  ++++L L L Q+I+V+E+ QI+ +NVWL   W D++L WNP+D+  +  +R+PS QIW PDIVL+NNADG YEVS   N ++ N+G++ W+PP I+KS+C I+V +FPFDQQ C ++F SWT+D T++ L    G  +  + DF  S  WD++  PG  +    P      ++ Y   I+RK LFYT+NLI+PC+LI  L   VFYLP++ G+KM LCISVLLAL VFLLL+S+I+PPTS+ +PLI KYL+FT +L   +++ +V  +N+H+R+P  H MP W++ CF+++ P  L MKRP +   + +L+  ++N  I         +        +   N+    +   E            + E    V FI+ +++SED     + DWK+VA V+DR+
Sbjct:   35 KAADSEERLMNNLLRKDKYNKLIRPAYNNSQLVSIQLQLSLAQLISVNEREQIMTTNVWLNQEWVDYRLTWNPADYDGIKKLRIPSQQIWLPDIVLYNNADGTYEVSLFTNAIVQNNGSVAWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDYTEIDLVLNKG--WATMDDFTPSGEWDIIELPG--RRTICPLDPTYVDVTYDFIIKRKPLFYTINLIIPCILITSLAILVFYLPSDCGQKMTLCISVLLALTVFLLLISKIVPPTSLDVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKNCFLDRLPVFLFMKRPENSSASQKLRSYRRNMQIESFRNSNYFVNMTTARPCDHTVNDPPESVRHQEFRYRYPRKYTPEVHEAMDGVKFISEHMKSEDEDQSIIEDWKYVAMVVDRL 464          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Xenopus
Match: chrnb2 (cholinergic receptor nicotinic beta 2 subunit [Source:NCBI gene;Acc:100101688])

HSP 1 Score: 330.487 bits (846), Expect = 2.839e-107
Identity = 160/340 (47.06%), Postives = 236/340 (69.41%), Query Frame = 2
Query:  104 FDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            F  G     ++ E +L+++L +   YN LIRP +N +  +TV+L + L Q+I+V E+ QI+ +NVWL   W D++L W+P++F ++  +R+PS  IW PD+VL+NNADG YEVS+  N ++ +DG+I W+PP I+KS+C I+V +FPFDQQ C M+F SWT+D T++ L   S +  +D  DF  S  WD++  PG  +   +P  +   +I Y   IRRK LFYT+NLI+PC+LI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+ +PL+ KYL+FT +L   +++ +V  +N+H+R+P  H MP W++  F++K P LL MK+P
Sbjct:   14 FAFGTGCLGTDTEERLVEHLLDPSRYNKLIRPATNGSEQVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWDPAEFDDMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSHDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTELDLVLRSDVASLD--DFTPSGEWDIIALPG--RRNENPNDSTYVDITYDFIIRRKPLFYTINLIIPCILITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPPWVKVVFLDKLPTLLFMKQP 349          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Mouse
Match: Chrnb4 (cholinergic receptor, nicotinic, beta polypeptide 4 [Source:MGI Symbol;Acc:MGI:87892])

HSP 1 Score: 347.821 bits (891), Expect = 3.397e-114
Identity = 186/452 (41.15%), Postives = 272/452 (60.18%), Query Frame = 2
Query:  113 GDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP---------PH------ITNEXXXXXXXXXXXPXXX------------XXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            GD  R++  E KL+D L N   YNNLIRP ++++  +++ L L L Q+I+V+E+ QI+ +++WL+  W D++L WN S +  +N++R+P+ ++W PDIVL+NNADG YEVS   NV++ ++G+I W+PP I+KS+C I+V +FPFDQQ C ++F SWT+D T++ +   S    +D  DF  S  WD++  PG  +   +P      ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL  FLLL+S+I+PPTS+ IPLI KYLLFT +L   +++ TV  +N+H+R+P  H M  W++ CF+ K P  L MKRP         PH       T E           PS                 +   + +      D  +       ++L E    V+FIA +L+S+D     + DWKFVA V+DR+
Sbjct:   18 GDC-RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMD--DFTPSGEWDIVALPG--RRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPHSSQLHLTTAEATSTSALGPSSPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSSGRFRQDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRL 464          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Mouse
Match: Chrna6 (cholinergic receptor, nicotinic, alpha polypeptide 6 [Source:MGI Symbol;Acc:MGI:106213])

HSP 1 Score: 339.347 bits (869), Expect = 7.816e-111
Identity = 178/443 (40.18%), Postives = 272/443 (61.40%), Query Frame = 2
Query:  134 EYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHP-----GQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXX--------------------XXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            E E +L   LF H  YN  IRPV N +  +TV   L + Q+ NVDE NQI+ +N+WLR  W D++L+W+P+++  +  +RVP+D IW+PDIVL+NNA G+++V  K   L+  DG I W PP IFKSSC +D+T+FPFD Q C ++FGSWT+D  ++ L        VD++DFW++  W++++  G    Y H       +   T+I Y  +IRR  +FYT+NLI+PC+ I+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPL+ +YLLFT I   ++++VTV  +NIHYRTP  H MPKW++  F++ FP +L+M++P   T E    K                  E++                    + +QP   +    E + +++++  +V FIA N++S +  ++   DWK++A V+DR+
Sbjct:   32 ESEEQLFHRLFAH--YNRFIRPVENVSDPVTVHFELAITQLANVDEVNQIMETNLWLRHIWKDYRLRWDPTEYDGIETLRVPADNIWKPDIVLYNNAVGDFQVEGKTKALLKYDGVITWTPPAIFKSSCPMDITFFPFDHQNCSLKFGSWTYDKAEIDLLIIGSK--VDMNDFWENSEWEIVDASG----YKHDIKYNCCEEIYTDITYSFYIRRLPMFYTINLIIPCLFISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLVGEYLLFTMIFVTLSIVVTVFVLNIHYRTPATHTMPKWVKTIFLQAFPSILMMRKPLDKTKEAGGVKDPKSHTKRPAKVKFTHRGESKLLKECHHCQKSSDIAPGKRRSSQQPARWVAENSEHSSDVEDVIESVQFIAENMKSHNETNEVEDDWKYMAMVVDRV 466          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 329.717 bits (844), Expect = 5.544e-107
Identity = 179/456 (39.25%), Postives = 275/456 (60.31%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMT------REIE------------ANENLDEIFA-------------AVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             SE E +L  YLF  + YN +IRPV+N +  + ++  + + Q++ VDE NQI+ +N+WL+  WND++L+W PSD+  +  +RVP+++IW+PDIVL+NNADG+++V  K   L+   G + WIPP IFKSSC IDVTYFPFD Q C M+FGSW++D  ++ L        ++L D+W+S  W ++  PG    Y H  +    E     I Y L+IRR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP  H MP W++  F+   P ++ M RP     +  K +       S         +++     P  + T      R ++            ++E++D + +             +V +IA N+++++   +   DWK+VA VIDR+
Sbjct:   30 ASEAEHRLFQYLF--EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGS--SMNLKDYWESGEWAIIKAPG----YKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRI 477          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 329.331 bits (843), Expect = 7.676e-107
Identity = 179/456 (39.25%), Postives = 275/456 (60.31%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMT------REIE------------ANENLDEIFA-------------AVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             SE E +L  YLF  + YN +IRPV+N +  + ++  + + Q++ VDE NQI+ +N+WL+  WND++L+W PSD+  +  +RVP+++IW+PDIVL+NNADG+++V  K   L+   G + WIPP IFKSSC IDVTYFPFD Q C M+FGSW++D  ++ L        ++L D+W+S  W ++  PG    Y H  +    E     I Y L+IRR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP  H MP W++  F+   P ++ M RP     +  K +       S         +++     P  + T      R ++            ++E++D + +             +V +IA N+++++   +   DWK+VA VIDR+
Sbjct:   25 ASEAEHRLFQYLF--EDYNEIIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIGS--SMNLKDYWESGEWAIIKAPG----YKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSTEEDAPKTRNFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSESVDAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRI 472          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Mouse
Match: Chrnb2 (cholinergic receptor, nicotinic, beta polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87891])

HSP 1 Score: 327.02 bits (837), Expect = 4.803e-106
Identity = 160/333 (48.05%), Postives = 231/333 (69.37%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPH 1129
            ++ E +L+++L +   YN LIRP +N +  +TV+L + L Q+I+V E+ QI+ +NVWL   W D++L W P DF N+  +R+PS  IW PD+VL+NNADG YEVS+  N ++  DG+I W+PP I+KS+C I+V +FPFDQQ C M+F SWT+D T++ L   S +  +D  DF  S  WD++  PG  +   +P  +   +I Y   IRRK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+ +PL+ KYL+FT +L   +++ +V  +N+H+R+P  H M  W++  F+EK P LL +++P H
Sbjct:   26 TDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEDFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSDVASLD--DFTPSGEWDIIALPG--RRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPTLLFLQQPRH 354          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. UniProt
Match: sp|P04755|ACH3_DROME (Acetylcholine receptor subunit beta-like 1 OS=Drosophila melanogaster OX=7227 GN=nAChRbeta1 PE=2 SV=1)

HSP 1 Score: 399.053 bits (1024), Expect = 6.438e-133
Identity = 202/347 (58.21%), Postives = 265/347 (76.37%), Query Frame = 2
Query:   86 LIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPT-TEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            ++V++ F +   +  SE E +L+  LF  +GYN LIRPV N T  + V  GL  +Q+INV+EKNQ++ SNVWLRL W D+QLQW+ +D+G + V+R+P D++W+PDIVLFNNADGNYEV +K NVLIY  G +LW+PP I++SSCTIDVTYFPFDQQTC M+FGSWTF+  QV+L+ Y+   FVDLSD+WKS TWD++  P  +  Y      PT T+I + + IRRKTLFYTVNLILP VLI+FL   VFYLP E+GEK+ L IS+LL+LVVFLLLVS+ILPPTS+ +PLI+KYLLFTFI+N ++++VTV+ IN ++R P+ H+MP +IR  F+   P  L MKRP
Sbjct:   13 ILVLVAFSL---VSASEDEERLVRDLF--RGYNKLIRPVQNMTQKVGVRFGLAFVQLINVNEKNQVMKSNVWLRLVWYDYQLQWDEADYGGIGVLRLPPDKVWKPDIVLFNNADGNYEVRYKSNVLIYPTGEVLWVPPAIYQSSCTIDVTYFPFDQQTCIMKFGSWTFNGDQVSLALYNNKNFVDLSDYWKSGTWDIIEVPAYLNVYEGDSNHPTETDITFYIIIRRKTLFYTVNLILPTVLISFLCVLVFYLPAEAGEKVTLGISILLSLVVFLLLVSKILPPTSLVLPLIAKYLLFTFIMNTVSILVTVIIINWNFRGPRTHRMPMYIRSIFLHYLPAFLFMKRP 354          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. UniProt
Match: sp|Q93149|ACR3_CAEEL (Acetylcholine receptor subunit beta-type acr-3 OS=Caenorhabditis elegans OX=6239 GN=acr-3 PE=1 SV=1)

HSP 1 Score: 358.221 bits (918), Expect = 1.869e-117
Identity = 210/463 (45.36%), Postives = 307/463 (66.31%), Query Frame = 2
Query:  140 EGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXX--XXXXXQPDNEMTREIEANE-----NLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMXXXXXXXXXXXXXXXXXNFETIDPNFNQDEVIKKFSSQ 1504
            E +L+ Y+F+  GYN+LIRPV N ++  + V   L  + +INVDEKNQI+ +NVW  + WND+Q+QW+P +F  +  IRVP D++W PDIVLFNNADGNY VS+  NV++ + G++LW+PP ++KSSC IDV +FPFD+Q C + FGSWTF   ++ LS+ SG + V+L+D+  S  WDL++ PG + +         ++I Y + IRRK LFYTV LI+P VL+AFL+  VFYLP ES EK+ L IS+LLALVVFLL+VS+ILPPTS +IPL++KYLL TFI+N+I ++V+V+ IN+++R P  H MP W++  F++  P L +M+RP     EL K K+      S++ A++        +  EQP     ++  ++E     +  +   A+ +I  +L  ++A  +   +WKFV+ VIDR++L LF  VTT GT GILL+   +    NQ  VI++   Q
Sbjct:   26 EERLLSYIFD--GYNSLIRPVLNASSPPIEVFFSLAFVLLINVDEKNQIMQTNVWPTMKWNDYQMQWDPREFDGIKTIRVPPDKVWLPDIVLFNNADGNYLVSFYSNVVVEHTGDMLWVPPAVYKSSCLIDVEFFPFDEQVCSLTFGSWTFRKDELQLSYLSGKRHVELNDYLPSGVWDLIDAPGLLID-------ERSKISYQIKIRRKALFYTVILIMPTVLMAFLSMMVFYLPAESSEKITLAISILLALVVFLLVVSKILPPTSSTIPLMAKYLLMTFIMNMITIMVSVIIINVYFRGPATHIMPNWVKTVFLKFLPVLFVMRRPESTEKELAKMKREKRERRSMKSALKTFFKRNDAKISEQPKQTSRKDGSSSEEKLSSDAKKAIEAIEYITTHLTHDNAFKRQREEWKFVSVVIDRLLLYLFFAVTTGGTVGILLSAPNVFEQVNQTSVIERLKQQ 479          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. UniProt
Match: sp|P48182|ACR2_CAEEL (Acetylcholine receptor subunit beta-type acr-2 OS=Caenorhabditis elegans OX=6239 GN=acr-2 PE=1 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 1.071e-114
Identity = 186/343 (54.23%), Postives = 254/343 (74.05%), Query Frame = 2
Query:  107 DIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHI 1132
            D GD++   E E +L+  LF  + YN LIRPV N ++  + V+ G+ +I +INVDEKNQI+ +NVWL + WNDFQL WNP+++GN++ + VPSD++W PDIVLFNNADGNYEVS+K NV + + G++ W+PP +FKSSC IDV +FPFD+Q C + FGSWT+++ +V L WY+ IQ V L D+  S  WD+++ PG++    H       ++V+ + IRRKTLFYTV LI+P VL+AFL+   FYLP +SGEK+ L IS+LLALVVFLLLVS+ILPPTS +IPL+ KYLL  F+LNI AV+ TV+ +NI++R+   H+MP W+R  F+E  P LL+MKRP  I
Sbjct:   51 DQGDTM--GEDEDRLVIDLF--REYNFLIRPVKNVSSPPVVVDFGVAMILLINVDEKNQILQTNVWLTMKWNDFQLAWNPAEYGNISNLHVPSDRVWLPDIVLFNNADGNYEVSFKSNVFVDHHGDVTWVPPAMFKSSCRIDVEWFPFDEQCCTLVFGSWTYNSEEVRLHWYNNIQAVQLHDYSYSGIWDVIDVPGQL---VHKPDLKENKMVFNVVIRRKTLFYTVILIIPTVLMAFLSVMAFYLPVDSGEKVSLTISLLLALVVFLLLVSKILPPTS-NIPLMGKYLLLAFVLNITAVVGTVVIVNIYFRSALSHKMPTWVRKVFLEFLPHLLVMKRPERI 385          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. UniProt
Match: sp|Q8R493|ACHB4_MOUSE (Neuronal acetylcholine receptor subunit beta-4 OS=Mus musculus OX=10090 GN=Chrnb4 PE=2 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 2.376e-113
Identity = 186/452 (41.15%), Postives = 272/452 (60.18%), Query Frame = 2
Query:  113 GDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP---------PH------ITNEXXXXXXXXXXXPXXX------------XXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            GD  R++  E KL+D L N   YNNLIRP ++++  +++ L L L Q+I+V+E+ QI+ +++WL+  W D++L WN S +  +N++R+P+ ++W PDIVL+NNADG YEVS   NV++ ++G+I W+PP I+KS+C I+V +FPFDQQ C ++F SWT+D T++ +   S    +D  DF  S  WD++  PG  +   +P      ++ Y   I+RK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL  FLLL+S+I+PPTS+ IPLI KYLLFT +L   +++ TV  +N+H+R+P  H M  W++ CF+ K P  L MKRP         PH       T E           PS                 +   + +      D  +       ++L E    V+FIA +L+S+D     + DWKFVA V+DR+
Sbjct:   18 GDC-RLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELSLSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNADGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEIDMVLKSPTAIMD--DFTPSGEWDIVALPG--RRTVNPQDPSYVDVTYDFIIKRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLFTMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSPARVPHSSQLHLTTAEATSTSALGPSSPSNLYGNSMYFVNPVPATPKSAVSSHTAGLPRDARLRSSGRFRQDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRL 464          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. UniProt
Match: sp|P48181|ACH2_CAEEL (Acetylcholine receptor subunit beta-type unc-29 OS=Caenorhabditis elegans OX=6239 GN=unc-29 PE=1 SV=2)

HSP 1 Score: 347.436 bits (890), Expect = 3.593e-113
Identity = 200/453 (44.15%), Postives = 303/453 (66.89%), Query Frame = 2
Query:   68 ISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTAT-LTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMT--REIEANE-------NLDEIFA--AVNFIAANLQSEDAIDQALHDWKFVASVIDRMM 1390
            +S++ +L VVI   I ++I  S+ E +L+  +F  +GYN+LI+PV N++   L V++ L L+ +INVDEK+Q++ +NVWL L W+DFQ++WNP ++G +  IRV  D++W PDIVLFNNADGNYEVS+  NV+I + G++LW+PP I+KSSC IDV +FPFD+Q C + FGSWT++  ++ L +    + VD+S++  S  WD+++ P  + N         + I + + IRRKTLFYTV LI+P VL+AFL+  VF+LPT+SGEK+ L ISVLL++VVFLLLVS+ILPPTS +IPL++KYLL TF+LN+I ++VTV+ IN+++R P+ H+MP+W+R  F++  P L+ MKRP    +E    +     +P +       S  +      D+  T  R   +NE       + D + A  A+ +I  +L+ ++       DWK+VA +IDR++
Sbjct:    6 LSWILVLSVVIFLVIINTINASDDEERLMVDVF--RGYNSLIQPVRNSSELPLIVKMALQLVLLINVDEKDQVMHTNVWLTLQWHDFQMKWNPVNYGEIKQIRVSPDKVWLPDIVLFNNADGNYEVSFMCNVVINHKGDMLWVPPAIYKSSCIIDVEFFPFDEQVCTLVFGSWTYNENEIKLEFVQA-ELVDVSEYSASSIWDVIDVPASLVN-------KRSRIEFQVRIRRKTLFYTVVLIIPTVLMAFLSMAVFFLPTDSGEKITLTISVLLSIVVFLLLVSKILPPTSSTIPLMAKYLLLTFVLNVITILVTVIIINVYFRGPRTHRMPQWVRVVFLQFLPKLVCMKRPKS-ASERSAVRSGMAQLPGVGQFTLSPSAHHPLCPSADDRTTTIRNTASNETSAYYPLSTDALRAIDAIEYITEHLKRDEQHKSFRDDWKYVAMIIDRLL 447          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18291677 (tr|A0A1I8G5W0|A0A1I8G5W0_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 452.21 bits (1162), Expect = 4.157e-151
Identity = 214/341 (62.76%), Postives = 275/341 (80.65%), Query Frame = 2
Query:  119 SIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            S  + + E KL++ LF HKGYN LIRPV++   T+ V+ GL ++Q+INV+EK QI+ SNVWLR+ WND+QL+W+P+DFG + VIR+  D+IWRPDIVL+NNADG YEVSW+PN LI++ G +LWIPP I++SSCTI V YFPFDQQ C+M+FGSWTFDATQV L  Y   + VDL+D+W+S +WD+++CPG I      GQ P T I+Y L IRRKTLFYTVNLI+PCVLI+FL+ CVFYLP ++GEKM LCIS+LLALVVFLLLVS++LPPTS+SIPLISK+LLFTFI+NI  ++ TV+ IN ++RTP+ H+MP+W+R  F++  P LLLMKRP HI  E
Sbjct:   25 SATIGDDEVKLVNLLFEHKGYNRLIRPVADLNQTVQVDFGLAMVQLINVEEKAQILKSNVWLRMMWNDYQLRWDPADFGGIQVIRLNPDKIWRPDIVLYNNADGRYEVSWEPNALIFSTGTVLWIPPAIYQSSCTIHVRYFPFDQQECEMKFGSWTFDATQVVLGLYENSRVVDLNDYWRSGSWDIIDCPGNISIIEKAGQPPQTMIIYKLSIRRKTLFYTVNLIIPCVLISFLSVCVFYLPADAGEKMTLCISILLALVVFLLLVSKMLPPTSISIPLISKFLLFTFIMNIFTIVFTVIIINWNFRTPRTHKMPRWVRGLFLKFLPRLLLMKRPEHIDQE 365          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15797460 (tr|A0A1I8JD08|A0A1I8JD08_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 5.550e-151
Identity = 213/338 (63.02%), Postives = 274/338 (81.07%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            + + E KL++ LF HKGYN LIRPV++   T+ V+ GL ++Q+INV+EK QI+ SNVWLR+ WND+QL+W+P+DFG + VIR+  D+IWRPDIVL+NNADG YEVSW+PN LI++ G +LWIPP I++SSCTI V YFPFDQQ C+M+FGSWTFDATQV L  Y   + VDL+D+W+S +WD+++CPG I      GQ P T I+Y L IRRKTLFYTVNLI+PCVLI+FL+ CVFYLP ++GEKM LCIS+LLALVVFLLLVS++LPPTS+SIPLISK+LLFTFI+NI  ++ TV+ IN ++RTP+ H+MP+W+R  F++  P LLLMKRP HI  E
Sbjct:    2 IGDDEVKLVNLLFEHKGYNRLIRPVADLNQTVQVDFGLAMVQLINVEEKAQILKSNVWLRMMWNDYQLRWDPADFGGIQVIRLNPDKIWRPDIVLYNNADGRYEVSWEPNALIFSTGTVLWIPPAIYQSSCTIHVRYFPFDQQECEMKFGSWTFDATQVVLGLYENSRVVDLNDYWRSGSWDIIDCPGNISIIEKAGQPPQTMIIYKLSIRRKTLFYTVNLIIPCVLISFLSVCVFYLPADAGEKMTLCISILLALVVFLLLVSKMLPPTSISIPLISKFLLFTFIMNIFTIVFTVIIINWNFRTPRTHKMPRWVRGLFLKFLPRLLLMKRPEHIDQE 339          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18248509 (tr|A0A267F0H4|A0A267F0H4_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000461g1 PE=3 SV=1)

HSP 1 Score: 451.825 bits (1161), Expect = 1.001e-150
Identity = 214/343 (62.39%), Postives = 276/343 (80.47%), Query Frame = 2
Query:  113 GDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            G+   + + E KL++ LF HKGYN LIRPV++   T+ V+ GL ++Q+INV+EK QI+ SNVWLR+ WND+QL+W+P+DFG + VIR+  D+IWRPDIVL+NNADG YEVSW+PN LI++ G +LWIPP I++SSCTI V YFPFDQQ C+M+FGSWTFDATQV L  Y   + VDL+D+W+S +WD+++CPG I      GQ P T I+Y L IRRKTLFYTVNLI+PCVLI+FL+ CVFYLP ++GEKM LCIS+LLALVVFLLLVS++LPPTS+SIPLISK+LLFTFI+NI  ++ TV+ IN ++RTP+ H+MP+W+R  F++  P LLLMKRP HI  E
Sbjct:   26 GEIPTIGDDEVKLVNLLFEHKGYNRLIRPVADLNQTVQVDFGLAMVQLINVEEKAQILKSNVWLRMMWNDYQLRWDPADFGGIQVIRLNPDKIWRPDIVLYNNADGRYEVSWEPNALIFSTGTVLWIPPAIYQSSCTIHVRYFPFDQQECEMKFGSWTFDATQVVLGLYENSRVVDLNDYWRSGSWDIIDCPGNISIIEKAGQPPQTMIIYKLSIRRKTLFYTVNLIIPCVLISFLSVCVFYLPADAGEKMTLCISILLALVVFLLLVSKMLPPTSISIPLISKFLLFTFIMNIFTIVFTVIIINWNFRTPRTHKMPRWVRGLFLKFLPRLLLMKRPEHIDQE 368          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18337223 (tr|A0A267E106|A0A267E106_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000461g5 PE=3 SV=1)

HSP 1 Score: 451.44 bits (1160), Expect = 1.057e-150
Identity = 214/343 (62.39%), Postives = 276/343 (80.47%), Query Frame = 2
Query:  113 GDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            G+   + + E KL++ LF HKGYN LIRPV++   T+ V+ GL ++Q+INV+EK QI+ SNVWLR+ WND+QL+W+P+DFG + VIR+  D+IWRPDIVL+NNADG YEVSW+PN LI++ G +LWIPP I++SSCTI V YFPFDQQ C+M+FGSWTFDATQV L  Y   + VDL+D+W+S +WD+++CPG I      GQ P T I+Y L IRRKTLFYTVNLI+PCVLI+FL+ CVFYLP ++GEKM LCIS+LLALVVFLLLVS++LPPTS+SIPLISK+LLFTFI+NI  ++ TV+ IN ++RTP+ H+MP+W+R  F++  P LLLMKRP HI  E
Sbjct:   26 GEIPTIGDDEVKLVNLLFEHKGYNRLIRPVADLNQTVQVDFGLAMVQLINVEEKAQILKSNVWLRMMWNDYQLRWDPADFGGIQVIRLNPDKIWRPDIVLYNNADGRYEVSWEPNALIFSTGTVLWIPPAIYQSSCTIHVRYFPFDQQECEMKFGSWTFDATQVVLGLYENSRVVDLNDYWRSGSWDIIDCPGNISIIEKAGQPPQTMIIYKLSIRRKTLFYTVNLIIPCVLISFLSVCVFYLPADAGEKMTLCISILLALVVFLLLVSKMLPPTSISIPLISKFLLFTFIMNIFTIVFTVIIINWNFRTPRTHKMPRWVRGLFLKFLPRLLLMKRPEHIDQE 368          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|15792443 (tr|A0A267FGD3|A0A267FGD3_9PLAT Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig009398g1 PE=3 SV=1)

HSP 1 Score: 446.817 bits (1148), Expect = 2.652e-149
Identity = 244/489 (49.90%), Postives = 336/489 (68.71%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXX-----------------XXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDE---------------IFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMXXXXXXXXXXXXXXXXXNFETIDPNFNQDEVIKKFSS 1501
            S  E KL++ LF+H+GYN+LIRPV+    T+ V+ GL ++Q+INVDEK+Q + SNVWLR+ W D+Q++W+P+DFG + VIRV   ++W+PDIVLFNNADG YEVSW+PN LI+++G +LWIPP I++SSCTI V YFPFDQQ C+M+FGSWTFDA QV   WY G +  DL+D+WKS +WD+++CPG I      G AP   +++ L IRRKTLFYTVNLI+PCVLI+FL+ CVFYLP ++GEKM LCIS+LLALVVFLLLVS+ILPPT++++PLISKYLLFTFI+NII ++ TV+ IN ++RTP+ H MP W+R  F+ + P LL MKRP H+  E +K+ +                      P  +    L    + +    D+ +   +E  E  +E                 AA+NFI+ +++ ED  +Q L DWK+VASVIDR+ L++F  VT IGT  IL++   I    +QD++I++ + 
Sbjct:   21 SHDEVKLVNMLFDHRGYNSLIRPVTELNMTVKVDFGLAMVQLINVDEKSQTMKSNVWLRMTWYDYQMRWDPADFGGIQVIRVSPSKVWKPDIVLFNNADGKYEVSWQPNALIFSNGYVLWIPPAIYQSSCTIYVKYFPFDQQECEMKFGSWTFDANQVIFGWYEGTKVADLTDYWKSGSWDIVDCPGNITRIERTGHAPQEMMIFKLTIRRKTLFYTVNLIIPCVLISFLSVCVFYLPADAGEKMTLCISILLALVVFLLLVSKILPPTAIAVPLISKYLLFTFIMNIITIVFTVIIINWNFRTPRTHTMPGWVRTLFLWRLPRLLFMKRPDHVEREEQKRHRLRQVNDESEQHDGVNFVCNGRSPGSQQGFRLHQMGHSSAASLDS-IGPAVEGGERPNEDIRFGGLKVTPDLKRAIAAINFISTHMEVEDDYEQVLQDWKYVASVIDRIQLLIFTAVTFIGTVAILMDAPFIMDFVDQDQIIRELTG 508          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Cavefish
Match: chrnb5b (neuronal acetylcholine receptor subunit beta-2-like [Source:NCBI gene;Acc:103031405])

HSP 1 Score: 336.265 bits (861), Expect = 7.408e-110
Identity = 178/451 (39.47%), Postives = 279/451 (61.86%), Query Frame = 2
Query:   89 IVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP--PHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQ-------------PDNEMTRE---IEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            + ++   +G ++  +E E +LI+YL +   YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +N WL   WND++L W+P ++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ ++G + W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ +   S   F    DF  S  WD+++ PG  +    P      +I Y   IRRK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H MP W+++ F+ + P  L M+RP   +I  + ++K +            +  S+    + +             P+N   R+   ++ + +++E    V +IA  ++SED  +  + DWK+VA VIDR+
Sbjct:    9 LALLALTVG-AVLCAEVEERLINYLLSPDRYNKLIRPAVNKSQQVTIAIQVSLAQLISVNEREQIMTTNCWLTQVWNDYRLMWDPEEYEGVRKVRLPSRHIWLPDIVLYNNADGTYEVSFYSNAVVSSNGEVAWLPPAIYKSACKIEVRDFPFDQQNCTLKFRSWTYDHTEIDMILLS--DFASRDDFKPSGEWDIISLPG--RKNEDPDDETYLDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKHFFLHRLPAFLFMRRPGASNIREKFRRKHQQRSFSEMPAKGEQDASDSTFFVNEDSAKHMGWRSTDLPENSELRKRLAVKCSVDMEEAMEGVRYIADKMKSEDDDEGIIEDWKYVAMVIDRL 454          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Cavefish
Match: chrna6 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:103022127])

HSP 1 Score: 334.724 bits (857), Expect = 7.955e-110
Identity = 178/408 (43.63%), Postives = 256/408 (62.75%), Query Frame = 2
Query:  179 YNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            YN  IRPV N +  +TVE  + + Q++ VDE NQI+ +N+WLR  WND++L+W P++F  +  IRVPS++IWRPDIVL+NNA G++ V  K   L+  DG I W+PP IFKSSC +D+TYFPFD Q C M+FGSWT+D  ++ L        V+L DFW+S  W++++ PG    Y H  +    E     I Y  +IRR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP  H MP W+R  F+   P ++LM+RP   +    K              V+      +   Q  N +      +  + +   +V +IA N++S +   +   DWK+VA VIDR+
Sbjct:   28 YNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLKWIPAEFDGIEYIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSK--VNLKDFWESGEWEIIDAPG----YKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPGWVRTVFLRALPRIMLMRRPIDQSESSTKA--------KEGPEVDCGKVSRQLSPQAINTVVAFSVVSPEIKQAIESVKYIAENMRSRNKAKEVEDDWKYVAMVIDRI 421          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Cavefish
Match: chrnb5b (neuronal acetylcholine receptor subunit beta-2-like [Source:NCBI gene;Acc:103031405])

HSP 1 Score: 335.88 bits (860), Expect = 9.229e-110
Identity = 177/437 (40.50%), Postives = 272/437 (62.24%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP--PHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQ-------------PDNEMTRE---IEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            +E E +LI+YL +   YN LIRP  N +  +T+ + + L Q+I+V+E+ QI+ +N WL   WND++L W+P ++  +  +R+PS  IW PDIVL+NNADG YEVS+  N ++ ++G + W+PP I+KS+C I+V  FPFDQQ C ++F SWT+D T++ +   S   F    DF  S  WD+++ PG  +    P      +I Y   IRRK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+++PLI KYL+FT +L   +++ +V  +N+H+R+P  H MP W+++ F+ + P  L M+RP   +I  + ++K +            +  S+    + +             P+N   R+   ++ + +++E    V +IA  ++SED  +  + DWK+VA VIDR+
Sbjct:   20 AEVEERLINYLLSPDRYNKLIRPAVNKSQQVTIAIQVSLAQLISVNEREQIMTTNCWLTQVWNDYRLMWDPEEYEGVRKVRLPSRHIWLPDIVLYNNADGTYEVSFYSNAVVSSNGEVAWLPPAIYKSACKIEVRDFPFDQQNCTLKFRSWTYDHTEIDMILLS--DFASRDDFKPSGEWDIISLPG--RKNEDPDDETYLDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLAVPLIGKYLMFTMVLVTFSIVTSVCVLNVHHRSPSTHTMPPWVKHFFLHRLPAFLFMRRPGASNIREKFRRKHQQRSFSEMPAKGEQDASDSTFFVNEDSAKHMGWRSTDLPENSELRKRLAVKCSVDMEEAMEGVRYIADKMKSEDDDEGIIEDWKYVAMVIDRL 452          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Cavefish
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:103025148])

HSP 1 Score: 334.339 bits (856), Expect = 2.147e-109
Identity = 178/426 (41.78%), Postives = 266/426 (62.44%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTH-PGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP------PHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            SE E +L   +F+   YN  IRPV N +  + V+  + + Q++ VDE NQI+ +N+WLR  WND++L+W+P DFG +  IRVPS++IW+PDIVL+NNA G+++V  K   L+  +G++ WIPP IFKSSC IDVTYFPFD Q C M+FGSWT+D  ++ L        ++L DFW+S  W +++ PG   +  +   +   T+I Y L+IRR  LFYT+N+I+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP+ H MP W+R  F+   P ++ M RP      P ++    +    +      +   + L           +   R         E   +V +IA N++ ++   +   DWK+VA VIDR+
Sbjct:   22 SEAEHRLFSVIFS--SYNQYIRPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLRWDPKDFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRYNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIGST--INLKDFWESGEWMIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLGLLPRVMFMTRPDRDPERPQVSGSSARSCTLHNSSSFPQHLTKPLGPVRLLAFSALSPEVR---------EAIESVKYIAENMRLQNEAKEVQDDWKYVAMVIDRI 434          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Cavefish
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103031133])

HSP 1 Score: 333.954 bits (855), Expect = 5.363e-109
Identity = 184/421 (43.71%), Postives = 267/421 (63.42%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPG--EIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            S  E +L   LF   GYN   RPV NT+  + V+ GL + Q+I+VDEKNQ++ +NVWL+  WND++L+W PSD+ N+  IRVPS+ IW PDIVL+NNADG + V+      ++  G + W+PP I+KSSC+IDVT+FPFDQQ CKM+FGSWT+D  ++ L     +  VDL D+W+S  W ++N  G    K Y    +    +I Y   IRR  LFYT+NLI+PC+LI+ LT  VFYLP++ GEK+ LCISVLL+L VFLLL+++I+P TS+ IPLI +YLLFT I   +++I+TV  +N+H+R+P  H+MP W+   F++  P  L M+RP   +   ++       + +             +  +P  E  R    + ++ +    V++IA +L++EDA      DWK+VA VIDR+
Sbjct:   50 SHAEDELFKKLF--IGYNKWSRPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFYTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERLETM--VDLKDYWESGEWAIINAVGTYNTKKYDCCHEI-YPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPGTHEMPHWVHAVFLDLIPRWLFMRRPAPDSRRRQRLLLLQQGM-ACLPNSRHSGARINHTNRPTEEDQRS-PLSPSIMQALEGVHYIADHLRAEDADFSVKEDWKYVAMVIDRI 463          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 320.857 bits (821), Expect = 1.641e-104
Identity = 160/338 (47.34%), Postives = 231/338 (68.34%), Query Frame = 2
Query:  125 RVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            R SE   +L   LF    YN  IRPV N +  + V   + + Q++ +DE NQI+ +N+WL+  WND++ QWNP  F  +  IRVPSD+IW+PDIVL+NNADG+++V  K   L+  DG ++W+PP IFKSSC IDVTYFPFD Q C M+FGSWT+D  ++ L    G + ++L DFW+S  W +++ PG    Y H  +    E     I Y +++RR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ L ISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++T+  +N+HYRTP+ H MP W+R  F++  P ++L++ P
Sbjct:    3 RASEAASRLYKTLFT--SYNPYIRPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLV-LVGTK-INLKDFWESGEWVIIDVPG----YKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFLDTLPKIMLLQPP 332          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 306.99 bits (785), Expect = 1.588e-99
Identity = 172/425 (40.47%), Postives = 255/425 (60.00%), Query Frame = 2
Query:  119 SIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQ-MPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMM 1390
            S+ ++E E +L+  +   K Y   +RPV   + T+ V+ GLG+ Q+++VDEKNQ++ +NVWL+  W D  L+WNP D+G +N IRVP+  IW PDIVL++NADG +E S     ++ +DG I W PP I+KSSCTIDVT+FPFDQQ C M+FGSWT+D T V L   +    VD  +++ +  W+ LN  G  K     G      I Y   IRR  LFYT+ LI+PC+ ++FLT  VFYLP++ GEK+ LC SVL++L VFLL++ +I+P +S  IPLI +YLLF  I   +++I+TV  IN+H+R+   H  M  W+R  F+ K P +L M+   H+ +      + +   P                E P +   R I    +      +V +I  +++ E+ + + + DWKFVA V+DR++
Sbjct:   28 SLSLAELEDRLLKRML--KDYQKWVRPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVNSD--VDRGEYFDNGEWEFLNATGN-KGVRLDGHRFYPYITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCMRS--HV-DRYTAPDEADRDHP------GRAGCACHGGESPPSASERLILTAID------SVRYITRHIKKENEVREVVEDWKFVAQVVDRIL 432          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 291.197 bits (744), Expect = 4.309e-92
Identity = 145/294 (49.32%), Postives = 212/294 (72.11%), Query Frame = 2
Query:  251 QIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPG--EIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPP 1126
             + + DEKNQ++ +NVWL+  W+D++LQW+P+++ N+  IRVPS+ IW PDIVL+NNADG++ V+      +++ G + W PP I+KSSC+IDVT+FPFDQQ C M+FGSWT+D  ++ L   S  + VDL D+W+S  W +++  G    K Y    Q    +I Y   IRR  LFYT+NLI+PC+LI+ LT  VFYLP++ GEK+ LCISVLL+L VFLLL+++I+P TS+ IPLI +YLLFT I   +++++TV  +N+H+R+P  H MP+W+R  F+++ P  L+M+RPP
Sbjct:    9 HLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL--VSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQV-YPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFLDRVPRWLVMRRPP 299          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 242.276 bits (617), Expect = 2.763e-74
Identity = 152/447 (34.00%), Postives = 240/447 (53.69%), Query Frame = 2
Query:  119 SIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQ-------FVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP---------PHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFA--------AVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
             +R  E E  L+  LF  + Y  L+RP    T  +TV LG+ L Q+I++      +  +  + L+W D +L W+P ++ NL  IR+   ++W PDI L NN DGN++     +VL+   G + W+PP+I++SSC + V YFPFD Q C M F S+T+D +++ L +             +D S F  S  W + + P   +  T+P      +I + L + RK LFY +N+++PC+LI       FYLP ++GEKM LCISVLLAL VFLLL++  +P TS+ +P+I  YL+FT ++    VI+TV+ +N+H+R+P  H MP W+R  F+   P  L ++RP         P +T   +       I      A+ LL         P    + E+   + L  +          AV++I+ ++ S+   D+   DW++VA V+DR+
Sbjct:   17 GVRGLEAEENLLKDLFVVQQYKTLVRPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIRHIIIDESTFPVSGEWQIKHKPS--RKNTNPRDPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIHSLPKYLWIERPKKEELAPKLPVLTQHQQHCHDEYFIRTPPSQALLLLPTSPSFGMTP---FSSELAGPDKLHVVLPPELQSAVDAVHYISEHMLSQKEFDELKEDWQYVAMVVDRI 458          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 193.356 bits (490), Expect = 1.839e-56
Identity = 109/261 (41.76%), Postives = 162/261 (62.07%), Query Frame = 2
Query:  368 IRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFV--DLSDFWKSETWDLLNCPGEIKN-YTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            +R    QIW PDI+L+N+AD  ++ ++  NVL+   GN   +PP + KS+C IDV +FPFD Q C ++FGSWT D       W   +Q +  D S +  +  WDL+  PG+    Y    Q P  ++ Y L IRR+TL+Y +NL++PCVLI+ L+  VF LP +SGEK+ L I+VLL+L VF+LLV++I+P TS S+PLI +Y   T I+   +V+VTV+ +  H+  P   +MP+W+R   ++     L MK+P    +E
Sbjct:    9 LRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDG------WLIDLQMLEADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILLDWCAWFLRMKQPGRERHE 263          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 224.942 bits (572), Expect = 2.511e-69
Identity = 128/336 (38.10%), Postives = 204/336 (60.71%), Query Frame = 2
Query:  140 EGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNAD----GNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHP-GQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYR---TPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            E +LI  L   +GY+   RPV N+  TL V  G+ ++QI+NV+ +NQI+ +NVW+R  W++  L W+PS++  +  +R+ +  +W PDIVL+++AD    G +E  +K +V+I  DG+  W  P  F+S+C IDVTYFPFD+QTC M+FGSWT+    V +   +    V  S + KS  WDL++     K+  +     P +++   + IRRK LFY  NLI PC+++  +    F+LP ESGE++ L I+VLLA+ VFL LV++ LP  S SIPL+ ++ +       ++++ T   +NIH+R   T  + +MPKW+    +     +L +++P
Sbjct:    1 EQRLISDLL--QGYSRNARPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHE-KYKTHVIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ--ASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVLCVRQP 331          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Nematostella
Match: EDO42038 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N9])

HSP 1 Score: 228.024 bits (580), Expect = 5.478e-68
Identity = 130/326 (39.88%), Postives = 199/326 (61.04%), Query Frame = 2
Query:  128 VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVS---WKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPG--QAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFME 1090
            + + EG+L   LF   GYN  +RPV +    +TV LG+ + QII+V EK+QI+ ++ W+R  W +  L+WN + +G +  I V   Q+W PD+VL+NNAD + + S   +K  +++ +DG  +W+ P IF SSCTI + YFPFD Q C ++FGSWTFD   + L          LS F  +  WDL+  P  I+N        AP  ++ + LH+RR+ LF+  NLI+PC +I  LT   FYLP +SGE++ + I+ LLA+ VF+L+V+ ILPPTS  + +IS +   + I   IA++ T + +  H+ +  IH+MP W+R+  +E
Sbjct:   46 IDDDEGRLTRDLF--AGYNPKLRPVFHKRENVTVVLGMSVHQIIDVYEKDQIIKTSFWVRQIWYNPFLRWNETFYGGIKEINVSPLQVWTPDLVLYNNADASTDGSLENFKTRIIVSSDGKNMWLAPVIFSSSCTIKIKYFPFDDQYCSLKFGSWTFDGFHLDLK--PEAPQASLSKFIPNGEWDLIGAPA-IRNVLRYDCCPAPYPDVTFTLHLRRRVLFFLFNLIIPCFVIVVLTSLSFYLPPDSGERISVVITNLLAMTVFMLMVADILPPTSDEVSIISIFYSCSIIEVGIALLGTCIVLKYHFCSTSIHKMPPWVRFLVIE 366          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 224.557 bits (571), Expect = 1.497e-67
Identity = 143/420 (34.05%), Postives = 229/420 (54.52%), Query Frame = 2
Query:  140 EGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVS---WKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKN-YTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            E +L+  LF  + Y++ +RPV N +  + VE  L LIQII V+ K+Q+V  +VW+R  W +  L WN S +G +  + +   ++W PDI+L+NNAD  Y      +K +V+  +DG   W  P  F S+C I+V YFPFD Q C ++FGSWT+   ++ ++  S     DLS +  +  W LL  P ++   + +  + P  ++   L I+RK L+Y  NLI+PC LIA LT   F+LP ESGEK+ L I+VLLA+ VFLLLV++ LP TS  IPL+ +Y + T  +  I+++ T + +N  +R P    MP W++   ++       M R P       +  +++ +IP    +          +    N  T  +     LD+I    N +A ++++    ++   +W+  A V+DRM
Sbjct:   38 EKRLLADLF--RNYDSEVRPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMT--STSDSADLSKYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIILD------YMARSPR----NARLMRDDSVIPPSGRSTPCERRRMSTVSSQLNPFTERL-----LDDI----NVLAEDVRARQEDERLREEWRCAALVLDRM 434          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Nematostella
Match: EDO39535 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9T6])

HSP 1 Score: 218.779 bits (556), Expect = 4.945e-67
Identity = 122/313 (38.98%), Postives = 189/313 (60.38%), Query Frame = 2
Query:  161 LFNH--KGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGN-----YEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHP-GQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIR 1075
            L+ H    Y+N++RPV      + V   +G  Q++N+ EKNQI+ISN+W+RL W D  L WN SDFG +  I+V    +W PDIVL+NN D +     Y+ + K N  I++DG + W+ P   KS C ID+T FP D+Q CK+ FGSW +D  ++ L+  +  +  DLS +  +  W +L+     K    P  +AP   ++Y+ H++R+ LFY +NLI+PCVL+ FL+   F  P ESGE++ L I++LL + VF+L+    +PPTS  +PLI KY   +  +   ++I T M+++++Y    +  MP W+R
Sbjct:    7 LYKHLFANYSNVVRPVKRVEEVVPVSFDIGYSQMVNLVEKNQILISNLWVRLKWYDPWLTWNESDFGGMKSIKVDPSCVWVPDIVLYNNVDSDSSGEMYKFTTKVN--IHSDGTVQWLSPIQVKSECKIDITNFPLDEQFCKLEFGSWAYDGFELNLT--NARETADLSLYTTNGEWRMLSGKVTRKLSKFPCCEAPYITLIYMFHVQRRALFYVMNLIIPCVLLTFLSALTFRFPPESGERVSLTITILLGMTVFMLIFIDNIPPTSEVMPLIGKYFSCSLFIMGSSLIATCMSLSLYYNN-AMAPMPVWLR 314          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Nematostella
Match: EDO43642 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY59])

HSP 1 Score: 213.772 bits (543), Expect = 1.510e-65
Identity = 120/281 (42.70%), Postives = 183/281 (65.12%), Query Frame = 2
Query:  140 EGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVS---WKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKN--YTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKY 967
            E KL+  LF++  YN  +RPV   T+++TV+LG+ L QII++DE+NQI+ISN+W+R  WN+  L W+P+ FGNL  I V   ++WRPD++L+NNAD + + +   +   V +  DG+ LW+ P IFKS+C  DV YFPFD+Q+C ++FGSWT+D  ++ +   +G   + +  F  +  W+L       +N  +      P  ++ + L IRR TLFY +N+++PC LI  LT   + LP ESGE++ L ++ LLA  V+LLLVS+I+PP +  +PLIS Y
Sbjct:    2 ENKLLKDLFSN--YNPSVRPVLKATSSVTVQLGVSLHQIIDLDERNQILISNLWVRQKWNNPLLTWDPTHFGNLTSINVDPLRVWRPDLILYNNADRDTDGALDRFYTKVQLKFDGSSLWLAPIIFKSTCKFDVAYFPFDEQSCILKFGSWTYDGLRLNIVPENGTD-IGIDKFVSNGEWELTGVSAN-RNVMFYDCCVEPYPDVTFTLKIRRLTLFYYMNMLIPCFLITGLTLLSYILPPESGERITLVVTSLLAQAVYLLLVSEIMPPVAEVVPLISIY 278          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Medaka
Match: chrna4b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101158195])

HSP 1 Score: 336.265 bits (861), Expect = 6.293e-108
Identity = 168/338 (49.70%), Postives = 238/338 (70.41%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPT-TEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            +  E +L+  LF    YN L RPV NT+ T+ V  GL + Q+I+VDEKNQ++ +NVWL+  WND++L+WNP D+ N+  IR+PS+ IWRPDIVL+NNADG++ V+      ++ DG I W+PP I+KSSC+IDVT+FPFDQQ+CKM+FGSWT+D  ++ L   S    VD  D+W+S  W ++N  G+     +   A    +I Y   IRR  LFYT+NLI+PC+LI+ LT  VFYLP++ GEK+ LCISVLL+L VFLLL+++I+P TS+ IPLI +YLLFT +   +++I+T+  +N+H+R+PQ H MP W+R  F++  P +L MKRPP    +
Sbjct:   42 AHAEERLLQNLFAR--YNKLSRPVQNTSDTVLVHFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPEDYENVTSIRIPSEIIWRPDIVLYNNADGDFAVTHLTKAHLFYDGQIKWMPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDRAKIDL--ISMASDVDQMDYWESGEWVIVNAVGKYNTKKYECCAEIYADITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMVFVTLSIIITIFVLNVHHRSPQTHGMPHWVRRVFLDLVPRVLFMKRPPGTAKQ 375          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Medaka
Match: chrnb2 (cholinergic receptor nicotinic beta 2 subunit [Source:NCBI gene;Acc:101175346])

HSP 1 Score: 330.487 bits (846), Expect = 1.004e-107
Identity = 175/419 (41.77%), Postives = 258/419 (61.58%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            ++ E +L+++L N   YN LIRP +N +  +TV+L + L Q+I+V E+ Q++ +NVWL   W D++L W P +F  +  +R+PS  IW PD+VL+NNADG YEVS+  N ++  DG+I W+PP I+KS+C I+V +FPFDQQ C +RF SWT+D T++ L   + +  +D  DF  S  WD++  PG  +   +P      +I Y   IRRK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+ +PL+ KYL+FT +L   +++ +V  +N+H+R+P  H MP W++  F+ K P LL M++P +     + +++                          + + R         E    V FIA +++SED       DWK+VA VIDR+
Sbjct:   38 ADTEERLVEHLLNPAHYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQVMTTNVWLTQEWQDYRLTWVPEEFDGMLKVRLPSKHIWLPDVVLYNNADGVYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTLRFRSWTYDRTEIDLVLRADVASMD--DFTPSGEWDIIALPG--RRNENPADPAYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPPWVKLVFLNKLPALLFMRQPRNSCERQRLRQRRRAQEQREVKQFGGDLGGAGGGSM--DGLNR---------EAVEGVRFIANHMKSEDDDQSVSEDWKYVAMVIDRL 441          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Medaka
Match: chrna3 (neuronal acetylcholine receptor subunit alpha-3 [Source:NCBI gene;Acc:101159658])

HSP 1 Score: 326.25 bits (835), Expect = 4.830e-105
Identity = 162/332 (48.80%), Postives = 234/332 (70.48%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTH-PGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            SE E KL   +F++  YN  IRPV N +  + V+  + + Q++ VDE NQI+ +N+WLR  WND++L+WNP +FG +  IRVPS++IW+PDIVL+NNA G+++V  K   L+  +G++ WIPP IFKSSC IDVTYFPFD Q C M+FGSWT+D  ++ L        ++L DFW+S  W +++ PG   +  +   +   T+I Y L+IRR  LFYT+N+I+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP+ H MP W+R  F+   P ++ M RP
Sbjct:   25 SEAEHKLFSVIFSN--YNQYIRPVENVSDPVIVQFEVSMSQLVKVDEVNQIMETNLWLRHIWNDYKLKWNPKEFGGVEFIRVPSNRIWKPDIVLYNNAVGDFQVDDKTKALLRFNGDVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLIGST--INLKDFWESGEWTIIDAPGYKHDIKYNCCEEIYTDITYSLYIRRLPLFYTINMIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPCWVRRVFLGLLPRVMFMTRP 352          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Medaka
Match: ENSORLT00000017941.2 (neuronal acetylcholine receptor subunit alpha-3-like [Source:NCBI gene;Acc:101168601])

HSP 1 Score: 323.939 bits (829), Expect = 5.267e-105
Identity = 164/336 (48.81%), Postives = 231/336 (68.75%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTE-----IVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            S+ E +L   LF  + YN  IRPV N +  +TVE  + + Q++ VDE NQI+ +N+WLR  WND++L+W P++F  +  IRVPS++IWRPDIVL+NNA G++ V  K   L+  DG I W+PP IFKSSC +D+TYFPFD Q C M+FGSWT+D  ++ L        V+L DFW+S  W++++ PG    Y H  +    E     I Y  +IRR  LFYT+NLI+PC+LI+FLT  VFYLP++ GEK+ LCISVLL+L VFLL++++ +P TS+ IPLI +YLLFT I   +++++TV  +N+HYRTP  H MP W+   F++  P ++LM+RP
Sbjct:   26 SKAEDRLFRKLF--RRYNQFIRPVENVSDPVTVEFEVSISQLVKVDEVNQIMETNLWLRHIWNDYKLRWTPAEFDGIEFIRVPSNKIWRPDIVLYNNAVGDFLVEDKTKALLKFDGTITWVPPAIFKSSCPMDITYFPFDYQNCSMKFGSWTYDKAKIDLVLIGSK--VNLKDFWESGEWEIIDAPG----YKHDIKYNCCEEIYPDITYSFYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPMTHTMPGWVHLVFLKVLPRIMLMRRP 353          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Medaka
Match: chrnb2 (cholinergic receptor nicotinic beta 2 subunit [Source:NCBI gene;Acc:101175346])

HSP 1 Score: 322.398 bits (825), Expect = 9.406e-104
Identity = 157/331 (47.43%), Postives = 228/331 (68.88%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            ++ E +L+++L N   YN LIRP +N +  +TV+L + L Q+I+V E+ Q++ +NVWL   W D++L W P +F  +  +R+PS  IW PD+VL+NNADG YEVS+  N ++  DG+I W+PP I+KS+C I+V +FPFDQQ C +RF SWT+D T++ L   + +  +D  DF  S  WD++  PG  +   +P      +I Y   IRRK LFYT+NLI+PCVLI  L   VFYLP++ GEKM LCISVLLAL VFLLL+S+I+PPTS+ +PL+ KYL+FT +L   +++ +V  +N+H+R+P  H MP W++  F+ K P LL M++P
Sbjct:   33 ADTEERLVEHLLNPAHYNKLIRPATNGSELVTVQLMVSLAQLISVHEREQVMTTNVWLTQEWQDYRLTWVPEEFDGMLKVRLPSKHIWLPDVVLYNNADGVYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTLRFRSWTYDRTEIDLVLRADVASMD--DFTPSGEWDIIALPG--RRNENPADPAYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMPPWVKLVFLNKLPALLFMRQP 359          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Planmine SMEST
Match: SMESG000031561.1 (SMESG000031561.1)

HSP 1 Score: 860.136 bits (2221), Expect = 0.000e+0
Identity = 485/485 (100.00%), Postives = 485/485 (100.00%), Query Frame = 2
Query:   53 MVFKYISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMXXXXXXXXXXXXXXXXXNFETIDPNFNQDEVIKKFSSQL 1507
            MVFKYISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISVLLALVVFLLLVSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNELKKKKKNNLIIPSLEVAVELLSNENENLEQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMLILFIIVTTIGTFGILLNFETIDPNFNQDEVIKKFSSQL
Sbjct:    1 MVFKYISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISVLLALVVFLLLVSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNELKKKKKNNLIIPSLEVAVELLSNENENLEQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMLILFIIVTTIGTFGILLNFETIDPNFNQDEVIKKFSSQL 485          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Planmine SMEST
Match: SMESG000031561.1 (SMESG000031561.1)

HSP 1 Score: 815.839 bits (2106), Expect = 0.000e+0
Identity = 462/463 (99.78%), Postives = 463/463 (100.00%), Query Frame = 2
Query:  119 SIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMXXXXXXXXXXXXXXXXXNFETIDPNFNQDEVIKKFSSQL 1507
            +IRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISVLLALVVFLLLVSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNELKKKKKNNLIIPSLEVAVELLSNENENLEQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMLILFIIVTTIGTFGILLNFETIDPNFNQDEVIKKFSSQL
Sbjct:   25 TIRVSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISVLLALVVFLLLVSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNELKKKKKNNLIIPSLEVAVELLSNENENLEQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMLILFIIVTTIGTFGILLNFETIDPNFNQDEVIKKFSSQL 487          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Planmine SMEST
Match: SMESG000029213.1 (SMESG000029213.1)

HSP 1 Score: 428.328 bits (1100), Expect = 2.446e-144
Identity = 205/331 (61.93%), Postives = 266/331 (80.36%), Query Frame = 2
Query:  131 SEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRP 1123
            +++E KLI YL  HK YN LIRPVSN + T+ VEL L +IQII V+EK+QI+ SNVW+RL W D+QL+W PSDFGN++V R+   ++W+PDIVLFNNADGNYEVSW+PNVL+  +GN+LWIPP IF SSCTI V YFPFDQQ+C+M+FGSWTFDA+Q+ L +  G + VDLSD+WKS +W +++CP  + N T   Q+P T+IVY + ++RK+LFYTVNLI+PCVLI+ LT CVFYLP ++GEKM L IS+LL+LVVFLLL+S+ILPPTS SIPLISK+LLFTFI+NI  + +TVM IN ++R+P  H+M  WIR  F++  P  L+M+RP
Sbjct:   35 TQHESKLIHYLLEHKQYNPLIRPVSNLSNTIRVELALAMIQIIAVEEKSQIMKSNVWIRLKWTDYQLRWEPSDFGNVDVARITPSRVWQPDIVLFNNADGNYEVSWQPNVLVTPNGNVLWIPPAIFISSCTIHVEYFPFDQQSCEMKFGSWTFDASQLTLGYIDGKKHVDLSDYWKSGSWYMVDCPSRMDNITGADQSPETQIVYTIILQRKSLFYTVNLIIPCVLISLLTVCVFYLPADAGEKMTLSISILLSLVVFLLLISRILPPTSSSIPLISKFLLFTFIMNIFTITITVMIINWNFRSPNTHKMSGWIRKWFIDVLPKFLMMERP 365          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Planmine SMEST
Match: SMESG000064521.1 (SMESG000064521.1)

HSP 1 Score: 396.356 bits (1017), Expect = 4.295e-132
Identity = 212/363 (58.40%), Postives = 270/363 (74.38%), Query Frame = 2
Query:   62 KYISFLHLLIVVIIFDIGDSIR--VSEYEGKLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDFWKSETWDLLNCPGEIKNYTHPGQA-PTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNE 1141
            K I  L +L  +I+   G ++    S+ EG+L DYLF +KGYN LIRPV N T  + V+  L LIQ+INV+EK QI+ SNVW+R+ W D+QL W P+DFG + V RV    +W+PDIVLFNNADGNYEV W+PN+LI  DG ILWIPP I++SSC+I V YFPFD+Q C+MRFGSWTF++ QV+LSW SG   +DLS +W+S TWD+++CPG I N T       T EI+Y + IRRKTLFYTV LILPC+LI+ LT CVFYLP +   KM L IS+LLAL+VF LL+S++LPPTS SIPLISKYLLFTFI+NII +++TV+ IN++YRTP+ H MP W++  F+E  P +L M RP HI  E
Sbjct:    5 KKIVILLVLYYIILKTDGKAVESLASDDEGRLKDYLFKYKGYNQLIRPVVNLTDVIDVKFELALIQLINVEEKKQILKSNVWIRMKWVDYQLVWEPADFGGIKVTRVSPKIVWKPDIVLFNNADGNYEVLWQPNILIQYDGEILWIPPAIYESSCSILVEYFPFDEQVCEMRFGSWTFNSKQVSLSW-SGSSKIDLSTYWQSGTWDIISCPGRITNGTMDSSGIDTQEIIYQITIRRKTLFYTVILILPCLLISLLTVCVFYLPADDHHKMTLTISILLALIVFFLLISKLLPPTSTSIPLISKYLLFTFIVNIIVIVITVIIINLNYRTPRTHYMPSWVKKVFIEFLPIVLGMSRPKHIEQE 366          
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Planmine SMEST
Match: SMESG000020665.1 (SMESG000020665.1)

HSP 1 Score: 284.648 bits (727), Expect = 3.794e-90
Identity = 164/432 (37.96%), Postives = 248/432 (57.41%), Query Frame = 2
Query:  146 KLIDYLFNHKGYNNLIRPVSNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDFGNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPN--VLIYNDGNILWIPPTIFKSSCTIDVTYFPFDQQTCKMRFGSWT-----FDATQVALSWYSGIQF----------VDLSDFWKSETWDLLNCPGEIKNYTHPG-QAPTTEIVYLLHIRRKTLFYTVNLILPCVLIAFLTFCVFYLPTESGEKMCLCISXXXXXXXXXXXXSQILPPTSVSIPLISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPPLLLMKRPPHITNEXXXXXXXXXXXPXXXXXXXXXXXXXXXXXQPDNEMTREIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRM 1387
            +L D L   +GY+  +RPV + T+T+ + + L L+QI++VDEKNQI++ N+W+   WND    W+P+D+GN+  + +PS +IW PD+VL+NNA G+++++   N  V++ +DG++LW PP IFKS C I+V +FPFD+Q C ++ G+WT      D    A    S   F          +DLS +  +  WDLL    +     +P    P  +I + + +RR+TLFY +NLI PC+ I+FLT  VFYLP +SGEK+ L IS+LL+L VF LL+  I PPTS+ +PLI KYLLFT IL  ++V+ TV+ +NIH+R+P  H+M  W+R  F    P LL MK+P     + +              +               + +  EIE           V  I  +++ E++      DWK+VA V+DR+
Sbjct:   22 RLYDDLMRRRGYDPSVRPVKSYTSTVLLYMNLSLVQILDVDEKNQIIVLNMWVNQEWNDPNFVWDPNDYGNVTELNIPSREIWTPDLVLYNNAGGDWDLASSSNTKVIVNHDGSVLWKPPIIFKSQCGINVEFFPFDKQLCDLKIGTWTHNGFLIDLRHTAQKNQSQASFDNCNAKIDYAIDLSQYVNNVEWDLLEVSAKRNIEFYPCCTEPYLDISFNVSLRRRTLFYGINLICPCLAISFLTILVFYLPADSGEKVSLSISILLSLTVFFLLIFDISPPTSIVVPLILKYLLFTMILVTLSVMATVLVLNIHWRSPDTHKMAPWVRSVFTSTLPKLLFMKKPDQDYRDNETDDIPETFHEDETDSNIQDKWSTRRAAVSGDNVVNEIEL------ALEGVRRIVHHIKKENSYSAMRDDWKYVAVVLDRL 447          
The following BLAST results are available for this feature:
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA28.925e-10849.55cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNB41.515e-10746.42cholinergic receptor nicotinic beta 4 subunit [Sou... [more]
CHRNA25.255e-10749.55cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA34.698e-10639.30cholinergic receptor nicotinic alpha 3 subunit [So... [more]
CHRNA34.698e-10639.30cholinergic receptor nicotinic alpha 3 subunit [So... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-31.469e-11845.36Acetylcholine receptor subunit beta-type acr-3 [S... [more]
acr-28.416e-11654.23Acetylcholine receptor subunit beta-type acr-2 [S... [more]
unc-292.825e-11444.15Acetylcholine receptor subunit beta-type unc-29 [... [more]
unc-292.825e-11444.15Acetylcholine receptor subunit beta-type unc-29 [... [more]
lev-16.156e-10944.65Acetylcholine receptor subunit beta-type lev-1 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRbeta14.692e-13458.50gene:FBgn0000038 transcript:FBtr0073299[more]
nAChRalpha23.397e-10446.72gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha23.397e-10446.72gene:FBgn0000039 transcript:FBtr0084640[more]
nAChRbeta23.846e-10340.31gene:FBgn0004118 transcript:FBtr0084681[more]
nAChRalpha13.388e-10249.06gene:FBgn0000036 transcript:FBtr0334916[more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb5a4.787e-10840.50cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
chrnb5a8.383e-10840.50cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
chrnb5a9.842e-10840.50cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
chrnb5a1.031e-10740.50cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
chrnb5a1.413e-10740.50cholinergic receptor, nicotinic, beta 5a [Source:Z... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
usp161.514e-10940.18ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
usp163.186e-10840.32ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
usp163.327e-10840.32ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
usp163.379e-10840.32ubiquitin specific peptidase 16 [Source:Xenbase;Ac... [more]
chrnb22.839e-10747.06cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrnb43.397e-11441.15cholinergic receptor, nicotinic, beta polypeptide ... [more]
Chrna67.816e-11140.18cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna35.544e-10739.25cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna37.676e-10739.25cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrnb24.803e-10648.05cholinergic receptor, nicotinic, beta polypeptide ... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P04755|ACH3_DROME6.438e-13358.21Acetylcholine receptor subunit beta-like 1 OS=Dros... [more]
sp|Q93149|ACR3_CAEEL1.869e-11745.36Acetylcholine receptor subunit beta-type acr-3 OS=... [more]
sp|P48182|ACR2_CAEEL1.071e-11454.23Acetylcholine receptor subunit beta-type acr-2 OS=... [more]
sp|Q8R493|ACHB4_MOUSE2.376e-11341.15Neuronal acetylcholine receptor subunit beta-4 OS=... [more]
sp|P48181|ACH2_CAEEL3.593e-11344.15Acetylcholine receptor subunit beta-type unc-29 OS... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|182916774.157e-15162.76tr|A0A1I8G5W0|A0A1I8G5W0_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157974605.550e-15163.02tr|A0A1I8JD08|A0A1I8JD08_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|182485091.001e-15062.39tr|A0A267F0H4|A0A267F0H4_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|183372231.057e-15062.39tr|A0A267E106|A0A267E106_9PLAT Uncharacterized pro... [more]
gnl|BL_ORD_ID|157924432.652e-14949.90tr|A0A267FGD3|A0A267FGD3_9PLAT Uncharacterized pro... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrnb5b7.408e-11039.47neuronal acetylcholine receptor subunit beta-2-lik... [more]
chrna67.955e-11043.63neuronal acetylcholine receptor subunit alpha-3 [S... [more]
chrnb5b9.229e-11040.50neuronal acetylcholine receptor subunit beta-2-lik... [more]
chrna32.147e-10941.78neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrna2b5.363e-10943.71neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna31.641e-10447.34cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrnb3b1.588e-9940.47cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
chrna2a4.309e-9249.32cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb1l2.763e-7434.00cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
ENSPMAT00000008550.11.839e-5641.76pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479692.511e-6938.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420385.478e-6839.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420541.497e-6734.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395354.945e-6738.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436421.510e-6542.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna4b6.293e-10849.70neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrnb21.004e-10741.77cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
chrna34.830e-10548.80neuronal acetylcholine receptor subunit alpha-3 [S... [more]
ENSORLT00000017941.25.267e-10548.81neuronal acetylcholine receptor subunit alpha-3-li... [more]
chrnb29.406e-10447.43cholinergic receptor nicotinic beta 2 subunit [Sou... [more]
back to top
BLAST of Acetylcholine receptor subunit beta-like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031561.10.000e+0100.00SMESG000031561.1[more]
SMESG000031561.10.000e+099.78SMESG000031561.1[more]
SMESG000029213.12.446e-14461.93SMESG000029213.1[more]
SMESG000064521.14.295e-13258.40SMESG000064521.1[more]
SMESG000020665.13.794e-9037.96SMESG000020665.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025787 ID=SMED30025787|Name=Acetylcholine receptor subunit beta-like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1564bp
TTTTATTATAAGTTTTCACTTTCATTAACAAAGTCACAATTTTAAAATTA
AAATGGTTTTCAAATATATTAGTTTTCTACATTTATTAATTGTTGTGATA
ATATTCGATATTGGAGATTCGATTAGAGTTAGTGAATACGAAGGGAAATT
AATAGATTATTTATTCAACCATAAAGGCTACAATAACCTTATTCGACCGG
TTTCCAACACCACAGCTACATTGACAGTTGAATTGGGACTGGGTCTCATT
CAAATTATAAATGTGGATGAAAAGAATCAAATTGTTATCAGTAATGTTTG
GCTAAGATTGGCTTGGAATGACTTTCAATTACAATGGAATCCGAGTGATT
TCGGAAATCTGAACGTTATTCGAGTTCCTTCAGATCAAATTTGGAGACCC
GACATTGTCTTATTTAATAATGCCGATGGAAATTATGAAGTATCTTGGAA
ACCGAACGTTCTCATTTATAACGACGGCAATATTCTTTGGATTCCTCCGA
CAATTTTCAAAAGTTCGTGTACAATTGACGTAACTTACTTTCCATTCGAC
CAACAGACTTGTAAAATGAGATTTGGAAGTTGGACATTTGATGCCACACA
GGTAGCATTAAGTTGGTACAGTGGCATCCAGTTTGTTGACTTATCTGATT
TTTGGAAAAGCGAGACTTGGGACTTACTCAACTGTCCTGGAGAAATTAAA
AACTATACTCATCCTGGACAGGCTCCGACGACTGAAATAGTTTATCTGCT
TCACATTCGTCGAAAAACTTTATTTTACACTGTAAATTTAATTTTACCAT
GTGTATTGATTGCATTTTTAACCTTTTGCGTGTTTTACCTTCCAACTGAA
TCTGGAGAAAAAATGTGTCTATGTATCTCAGTACTTCTAGCTTTAGTTGT
CTTTCTTTTACTTGTCAGTCAAATCCTGCCTCCAACTTCTGTTTCGATTC
CACTTATCAGCAAATATTTACTTTTCACTTTCATATTAAACATTATAGCT
GTCATTGTTACCGTGATGACAATTAATATTCATTATCGAACTCCACAAAT
CCACCAAATGCCAAAATGGATTCGTTATTGCTTCATGGAGAAATTCCCAC
CGCTGTTACTCATGAAACGGCCACCTCACATAACAAATGAACTCAAAAAG
AAAAAGAAAAATAACCTGATCATACCATCTTTGGAAGTTGCTGTTGAGTT
GTTGTCAAACGAAAATGAGAATCTAGAACAGCCTGACAATGAAATGACCA
GGGAAATCGAGGCAAACGAAAACCTTGATGAAATATTTGCTGCGGTAAAT
TTCATTGCTGCCAATCTTCAATCAGAAGATGCCATAGATCAAGCTTTACA
TGATTGGAAATTTGTAGCTTCGGTCATTGACAGAATGATGCTAATATTAT
TCATTATTGTCACCACAATTGGGACTTTTGGAATTTTGTTAAACTTTGAA
ACAATTGATCCCAACTTCAATCAAGATGAAGTAATAAAGAAATTTTCCTC
TCAGTTGTGAATCAATTAAAATTAAATAATAATTATAAGCTGTTAAAGGT
TTAAGATCGGAAGA
back to top

protein sequence of SMED30025787-orf-1

>SMED30025787-orf-1 ID=SMED30025787-orf-1|Name=SMED30025787-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=486bp
MVFKYISFLHLLIVVIIFDIGDSIRVSEYEGKLIDYLFNHKGYNNLIRPV
SNTTATLTVELGLGLIQIINVDEKNQIVISNVWLRLAWNDFQLQWNPSDF
GNLNVIRVPSDQIWRPDIVLFNNADGNYEVSWKPNVLIYNDGNILWIPPT
IFKSSCTIDVTYFPFDQQTCKMRFGSWTFDATQVALSWYSGIQFVDLSDF
WKSETWDLLNCPGEIKNYTHPGQAPTTEIVYLLHIRRKTLFYTVNLILPC
VLIAFLTFCVFYLPTESGEKMCLCISVLLALVVFLLLVSQILPPTSVSIP
LISKYLLFTFILNIIAVIVTVMTINIHYRTPQIHQMPKWIRYCFMEKFPP
LLLMKRPPHITNELKKKKKNNLIIPSLEVAVELLSNENENLEQPDNEMTR
EIEANENLDEIFAAVNFIAANLQSEDAIDQALHDWKFVASVIDRMMLILF
IIVTTIGTFGILLNFETIDPNFNQDEVIKKFSSQL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0005216ion channel activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005515protein binding
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: biological process
TermDefinition
GO:0034220ion transmembrane transport
GO:0006810transport
GO:0006811ion transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
GO:0098655cation transmembrane transport
GO:0007271synaptic transmission, cholinergic
GO:0007274neuromuscular synaptic transmission
GO:0035094response to nicotine
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR002394Nicotinic_acetylcholine_rcpt
IPR027361Acetylcholine_rcpt_TM
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: cellular component
TermDefinition
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0043204perikaryon
GO:0045202synapse
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005892acetylcholine-gated channel complex
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 112..123
score: 52.3
coord: 156..170
score: 55.05
coord: 79..95
score: 35.11
coord: 233..245
score: 39.96
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 17..463
e-value: 2.6E-96
score: 321.1
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 31..470
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 136..154
score: 46.9
coord: 66..82
score: 47.71
coord: 100..114
score: 41.41
coord: 118..130
score: 63.08
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 246..461
e-value: 1.6E-58
score: 198.6
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 398..474
e-value: 1.3E-11
score: 46.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 243..357
e-value: 1.7E-39
score: 136.7
NoneNo IPR availablePANTHERPTHR18945:SF784ACETYLCHOLINE RECEPTOR SUBUNIT BETA-LIKE 1coord: 31..470
NoneNo IPR availableCDDcd19032LGIC_ECD_nAChR_proto_beta-likecoord: 30..239
e-value: 9.40951E-121
score: 350.086
NoneNo IPR availableCDDcd19064LGIC_TM_nAChRcoord: 240..330
e-value: 7.62905E-36
score: 126.859
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.746
NoneNo IPR availableTMHMMTMhelixcoord: 446..468
NoneNo IPR availableTMHMMTMhelixcoord: 306..328
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 272..291
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 32..239
e-value: 4.6E-68
score: 228.9
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 30..242
e-value: 3.4E-76
score: 257.3
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 29..238
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 156..170
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 239..465