WD repeat-containing protein 36

Overview
NameWD repeat-containing protein 36 (AHY82404.1)
Smed IDSMED30025781
Length (bp)2985
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 36 (SMED30025781) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 36 (SMED30025781) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 36 (SMED30025781) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 36 (SMED30025781) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30025781

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30025781SMESG000037091.1 dd_Smed_v4_6943_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30025781SMESG000037091.1 SmedASXL_011078SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30025781SMESG000037091.1 SmedASXL_011078SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30025781SMESG000037091.1 dd_Smed_v6_6943_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30025781SMESG000037091.1 SMED30025781smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30025781SMESG000037091.1 SMED30025781smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30025781SMESG000037091.1 dd_Smed_v4_6943_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30025781SMESG000037091.1 SmWIOct06_034458GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025781SMESG000037091.1 SMED_10969_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025781SMESG000037091.1 SMED_10969_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025781SMESG000037091.1 SMED_29154_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30025781SMESG000037091.1 SMED_29154_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 36 vs. Ensembl Human
Match: WDR36 (WD repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:30696])

HSP 1 Score: 336.65 bits (862), Expect = 4.661e-100
Identity = 267/915 (29.18%), Postives = 442/915 (48.31%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDI--LSIDGYKNKLFTGCETNVY-GYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYV-LPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSI--RIRNENATKGMASTEFFLPQVSEGLDGL--RWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPT 2733
            S L+   +A+GL+S ++P +++ S     FY+ + VG  F  Y    L+LV+ S+ + +DI  ++ DG   +L      NV+  ++R K +   +K  ++     +   G+  ++  ++    L+IW I   E + Q  F      F I  I+ P  Y  KIL+ S +G + L N   NKLLY F    +G  + +++Q+P  +V+AIG    G+V++ ++  +  LM+  QD GPIT+I FR D   H +M   +  GH+ +WDL+ K+ I Q R+ H  ++A L  +  +PLLV+N ADN++++W ++ P G   LLR R GH  P   I+++  G    ++LSA +D  L  F+T  E    S+G   + +   +   +     V LP      A  A+E  WD +  CH+G    +TW++ K T G ++L+P  LK+        +AT   I+SCGNF +IG SSG +  +N+QSGI RG +  +       +AH+ ++ G+AV      TV   + G  L  W+F ++  I  + L +    + LH    ++ +A  D  +++L + TR IV      S     +  +AFS +   L+  A    ++T+D  +  L+DCF        + M+P   FL ++H D LGIYLWS    +  + L  LP D+ P+  +  P   C   D     +    +  EL+E +   Q       L  +S LP S + NLLN+D I  + + +   K   S  FF+P +     GL  R+   E + D   +    +G L  +  F                          C  L     + +YD  + LLK   PS I+ E++ L P    +  + +Q+FL+++   + R  + E+ Q YLA  L  ++  L  +P 
Sbjct:   11 SALFAGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADG---RLVFAAYGNVFSAFARNKEIVHTFK-GHKAEIHFLQPFGD--HIISVDTDGILIIWHIYSEEEYLQLTF--DKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFPGWKVG--VTALQQAPAVDVVAIGLM-SGQVIIHNIKFNETLMKFRQDWGPITSISFRTD--GHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNALRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYY--GQNGQQILSASQDGTLQSFSTVHEKFNKSLGHGLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTIGAYFLKPKELKKDDI-----TATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKD-------QAHKGSVRGVAVDGLNQLTVTTGSEGL-LKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALDDFSISVLDIETRKIVR---EFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVM-LPGT-CQTQDVEVSEETVEPS-DELIEYDSPEQLNEQ---LVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIP----GLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDF--------------------------CLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGS-IEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPV 857          
BLAST of WD repeat-containing protein 36 vs. Ensembl Human
Match: WDR36 (WD repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:30696])

HSP 1 Score: 335.109 bits (858), Expect = 4.449e-99
Identity = 267/915 (29.18%), Postives = 442/915 (48.31%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDI--LSIDGYKNKLFTGCETNVY-GYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYV-LPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSI--RIRNENATKGMASTEFFLPQVSEGLDGL--RWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPT 2733
            S L+   +A+GL+S ++P +++ S     FY+ + VG  F  Y    L+LV+ S+ + +DI  ++ DG   +L      NV+  ++R K +   +K  ++     +   G+  ++  ++    L+IW I   E + Q  F      F I  I+ P  Y  KIL+ S +G + L N   NKLLY F    +G  + +++Q+P  +V+AIG    G+V++ ++  +  LM+  QD GPIT+I FR D   H +M   +  GH+ +WDL+ K+ I Q R+ H  ++A L  +  +PLLV+N ADN++++W ++ P G   LLR R GH  P   I+++  G    ++LSA +D  L  F+T  E    S+G   + +   +   +     V LP      A  A+E  WD +  CH+G    +TW++ K T G ++L+P  LK+        +AT   I+SCGNF +IG SSG +  +N+QSGI RG +  +       +AH+ ++ G+AV      TV   + G  L  W+F ++  I  + L +    + LH    ++ +A  D  +++L + TR IV      S     +  +AFS +   L+  A    ++T+D  +  L+DCF        + M+P   FL ++H D LGIYLWS    +  + L  LP D+ P+  +  P   C   D     +    +  EL+E +   Q       L  +S LP S + NLLN+D I  + + +   K   S  FF+P +     GL  R+   E + D   +    +G L  +  F                          C  L     + +YD  + LLK   PS I+ E++ L P    +  + +Q+FL+++   + R  + E+ Q YLA  L  ++  L  +P 
Sbjct:   67 SALFAGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADG---RLVFAAYGNVFSAFARNKEIVHTFK-GHKAEIHFLQPFGD--HIISVDTDGILIIWHIYSEEEYLQLTF--DKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFPGWKVG--VTALQQAPAVDVVAIGLM-SGQVIIHNIKFNETLMKFRQDWGPITSISFRTD--GHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNALRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYY--GQNGQQILSASQDGTLQSFSTVHEKFNKSLGHGLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTIGAYFLKPKELKKDDI-----TATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKD-------QAHKGSVRGVAVDGLNQLTVTTGSEGL-LKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALDDFSISVLDIETRKIVR---EFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVM-LPGT-CQTQDVEVSEETVEPS-DELIEYDSPEQLNEQ---LVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIP----GLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDF--------------------------CLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGS-IEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPV 913          
BLAST of WD repeat-containing protein 36 vs. Ensembl Human
Match: WDR36 (WD repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:30696])

HSP 1 Score: 335.109 bits (858), Expect = 4.449e-99
Identity = 267/915 (29.18%), Postives = 442/915 (48.31%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDI--LSIDGYKNKLFTGCETNVY-GYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYV-LPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSI--RIRNENATKGMASTEFFLPQVSEGLDGL--RWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPT 2733
            S L+   +A+GL+S ++P +++ S     FY+ + VG  F  Y    L+LV+ S+ + +DI  ++ DG   +L      NV+  ++R K +   +K  ++     +   G+  ++  ++    L+IW I   E + Q  F      F I  I+ P  Y  KIL+ S +G + L N   NKLLY F    +G  + +++Q+P  +V+AIG    G+V++ ++  +  LM+  QD GPIT+I FR D   H +M   +  GH+ +WDL+ K+ I Q R+ H  ++A L  +  +PLLV+N ADN++++W ++ P G   LLR R GH  P   I+++  G    ++LSA +D  L  F+T  E    S+G   + +   +   +     V LP      A  A+E  WD +  CH+G    +TW++ K T G ++L+P  LK+        +AT   I+SCGNF +IG SSG +  +N+QSGI RG +  +       +AH+ ++ G+AV      TV   + G  L  W+F ++  I  + L +    + LH    ++ +A  D  +++L + TR IV      S     +  +AFS +   L+  A    ++T+D  +  L+DCF        + M+P   FL ++H D LGIYLWS    +  + L  LP D+ P+  +  P   C   D     +    +  EL+E +   Q       L  +S LP S + NLLN+D I  + + +   K   S  FF+P +     GL  R+   E + D   +    +G L  +  F                          C  L     + +YD  + LLK   PS I+ E++ L P    +  + +Q+FL+++   + R  + E+ Q YLA  L  ++  L  +P 
Sbjct:   67 SALFAGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADG---RLVFAAYGNVFSAFARNKEIVHTFK-GHKAEIHFLQPFGD--HIISVDTDGILIIWHIYSEEEYLQLTF--DKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFPGWKVG--VTALQQAPAVDVVAIGLM-SGQVIIHNIKFNETLMKFRQDWGPITSISFRTD--GHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNALRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYY--GQNGQQILSASQDGTLQSFSTVHEKFNKSLGHGLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTIGAYFLKPKELKKDDI-----TATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKD-------QAHKGSVRGVAVDGLNQLTVTTGSEGL-LKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALDDFSISVLDIETRKIVR---EFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVM-LPGT-CQTQDVEVSEETVEPS-DELIEYDSPEQLNEQ---LVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIP----GLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDF--------------------------CLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGS-IEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPV 913          
BLAST of WD repeat-containing protein 36 vs. Ensembl Celegans
Match: Y45F10D.7 (pep chromosome:WBcel235:IV:13789085:13796224:1 gene:WBGene00012887.1 transcript:Y45F10D.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y45F10D.7)

HSP 1 Score: 225.713 bits (574), Expect = 4.310e-61
Identity = 204/781 (26.12%), Postives = 354/781 (45.33%), Query Frame = 1
Query:  433 LFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF--NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGI--------------------ERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRD-NIGLLILDADITSLTLHPSGDMVA-VATGDGLVNLLQLTRFIVFHKIRA-SLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFL-DMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNE--NATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLA 2688
            L    S++F I  I  P  Y  KI+V S+ G+M +IN+   K+++ F  +    I  ++Q+   +V+ +G   +G V++ ++  D ++     D   IT + FR+D E    M+TA  NG +A+WDL+ +  IG+    H   +  L+ VPG+P+++S S DNS+++W ++  DG P  L    GH KP A IKF  +      +LSAG+D  +  ++    + +  +G       G + ++    Q V   A        +E  W+ V         +TTW     T G   LE    K++   F  ++AT   +S CGNF+ IGYS+GH+ +FN QSG                      +G    NG   + + A ++ I+ L+V Q     +   A G  L  W   ++  N  +   D  +      PS  +VA VA  +     + L   +     RA     N V A+ FS +   +++AD +  ++ FD   ++L+D     +P   +       +L + H+ +  +Y W+ K+ F+  + +   P D+ P+ ++ + +     D   DE+D      Q++  ++    +      L   SGLP S ++NL ++  I+ RN+  +A K +    FFL   S  LDG  + + E+  D          ++D   +++  K     R   EL SS         +LL  A + +      + L++ S SAID++I+ L+P       + +  F R+L   ++   N E+ Q Y A
Sbjct:  138 LLMEGSDDFEITAICHPSTYLNKIVVGSSTGRMKIINFRTGKVIHEFQRSFDSRITIIEQTTALDVVVVGLE-NGEVMLFNVKMDKIITSFRHD-AKITNVAFRDDGES--TMVTADKNGTMAVWDLEKQELIGKITGIHSDEINCLYFVPGEPIMLSASLDNSLRLWIFDSADGMPRELVRLEGHSKPCASIKFVGK----DHVLSAGKDGSIRKYDVSSLTMRQKLGTV---GQGVKLNK--EVQNVAEMAFGW----QREAAWNNVFCRQVNDTKITTWQTRNNTSGAFTLEHDRFKKK-VDFIDANATALCVSPCGNFVFIGYSTGHIDQFNAQSGRHVHSFTASTTVKKSKKSKNPRKGPTKTNGDIHNDTPAADSPITSLSVDQRGKELMSTDAQGHIL-FWSLSTKAINAKMFKKDVRLGICAPCPSNSLVALVAIAENGKESVILVDTVCHRVARAFETVGNKVNAMTFSSDGKWLLVADNDSYIRVFDVATSQLIDVLLFSKPCISMSYNETGQYLATVHEGERAVYTWANKVLFVAHINIRAHPADYLPSWSMISTEEGGTCDIDDDEDDLTTLMDQDIKAMKELQIDEN----LVTFSGLPSSRWANLPDLALIKERNKPTDAVKKIKQAPFFL-SASATLDGFEF-ETENIGD----------EMDGDSRYITSK-----RNLLELESS-------FTTLLRNAKTRDHLLDAFKTLQNMSLSAIDFQIRTLNP-------KTIPIFFRMLLEVLKTKTNFELVQAYAA 864          
BLAST of WD repeat-containing protein 36 vs. Ensembl Celegans
Match: Y45F10D.7 (pep chromosome:WBcel235:IV:13788936:13796223:1 gene:WBGene00012887.1 transcript:Y45F10D.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y45F10D.7)

HSP 1 Score: 225.713 bits (574), Expect = 4.310e-61
Identity = 204/781 (26.12%), Postives = 354/781 (45.33%), Query Frame = 1
Query:  433 LFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF--NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGI--------------------ERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRD-NIGLLILDADITSLTLHPSGDMVA-VATGDGLVNLLQLTRFIVFHKIRA-SLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFL-DMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNE--NATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLA 2688
            L    S++F I  I  P  Y  KI+V S+ G+M +IN+   K+++ F  +    I  ++Q+   +V+ +G   +G V++ ++  D ++     D   IT + FR+D E    M+TA  NG +A+WDL+ +  IG+    H   +  L+ VPG+P+++S S DNS+++W ++  DG P  L    GH KP A IKF  +      +LSAG+D  +  ++    + +  +G       G + ++    Q V   A        +E  W+ V         +TTW     T G   LE    K++   F  ++AT   +S CGNF+ IGYS+GH+ +FN QSG                      +G    NG   + + A ++ I+ L+V Q     +   A G  L  W   ++  N  +   D  +      PS  +VA VA  +     + L   +     RA     N V A+ FS +   +++AD +  ++ FD   ++L+D     +P   +       +L + H+ +  +Y W+ K+ F+  + +   P D+ P+ ++ + +     D   DE+D      Q++  ++    +      L   SGLP S ++NL ++  I+ RN+  +A K +    FFL   S  LDG  + + E+  D          ++D   +++  K     R   EL SS         +LL  A + +      + L++ S SAID++I+ L+P       + +  F R+L   ++   N E+ Q Y A
Sbjct:  138 LLMEGSDDFEITAICHPSTYLNKIVVGSSTGRMKIINFRTGKVIHEFQRSFDSRITIIEQTTALDVVVVGLE-NGEVMLFNVKMDKIITSFRHD-AKITNVAFRDDGES--TMVTADKNGTMAVWDLEKQELIGKITGIHSDEINCLYFVPGEPIMLSASLDNSLRLWIFDSADGMPRELVRLEGHSKPCASIKFVGK----DHVLSAGKDGSIRKYDVSSLTMRQKLGTV---GQGVKLNK--EVQNVAEMAFGW----QREAAWNNVFCRQVNDTKITTWQTRNNTSGAFTLEHDRFKKK-VDFIDANATALCVSPCGNFVFIGYSTGHIDQFNAQSGRHVHSFTASTTVKKSKKSKNPRKGPTKTNGDIHNDTPAADSPITSLSVDQRGKELMSTDAQGHIL-FWSLSTKAINAKMFKKDVRLGICAPCPSNSLVALVAIAENGKESVILVDTVCHRVARAFETVGNKVNAMTFSSDGKWLLVADNDSYIRVFDVATSQLIDVLLFSKPCISMSYNETGQYLATVHEGERAVYTWANKVLFVAHINIRAHPADYLPSWSMISTEEGGTCDIDDDEDDLTTLMDQDIKAMKELQIDEN----LVTFSGLPSSRWANLPDLALIKERNKPTDAVKKIKQAPFFL-SASATLDGFEF-ETENIGD----------EMDGDSRYITSK-----RNLLELESS-------FTTLLRNAKTRDHLLDAFKTLQNMSLSAIDFQIRTLNP-------KTIPIFFRMLLEVLKTKTNFELVQAYAA 864          
BLAST of WD repeat-containing protein 36 vs. Ensembl Fly
Match: CG9799 (gene:FBgn0038146 transcript:FBtr0082763)

HSP 1 Score: 332.413 bits (851), Expect = 1.279e-98
Identity = 257/867 (29.64%), Postives = 425/867 (49.02%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIKSVGDD-DFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF-NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRA-YVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDN--IGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGL-PLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQ------ELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDP 2583
            S ++   +A+G  S  VP + + V    D  L + +G  F VY  ++  L+  S    ++I ++   +   +T     +Y +   KH+  VY+  ++K+  +++  G    L  I+  N L +W+I   +V+ +   P +SEEF I  +  P  Y  KI++ S +G++ ++N  KN ++    +    I  ++ SP  +V+A+G  GDG +++L+L  D VLM   QD G +T + FR D     I+++A SNG++A W+L+ ++  GQ +  HE SV +  C+P +P++ + S DNS++++ ++ PDG    LR R GH KPP  I++   G     +LS+G DS + VF+T  ES   SMGRA Y P+   +++R   +++ +P  L+ T+ +A+E  WD +A  H G    TTWSF K   G+H L P   +  +    ++  T   ++ CGNF++IGYSSG + +FNIQSG+ R  Y         S AH+ A+ GLA       TV+   +   L  W F  + +  +  L L   I  +  H    M+A+      + ++ + TR IV   +  +   N    + FS +   L+  A  + +K +D  ++ +VD F+   P   L M+PN  FL + H   LGIYLW+ K  F  + L  + PL  +P   +  P   C   +  D   E     +      EL++ +          L+  +SGL  S + NLL+++ I+ RN  +   K      FFLP VS GL+ LR+ D E+            GQ +  +  +R  +T  N                   LL   A   ++   +  L    PS +D+EI+ L P
Sbjct:   23 SCIFRRNRALGYVSNQVPAVTRYVQRRRDTLLITCIGRSFQVYTANHFRLLHVSGLHPDEITALATDRLHTYTASNKCIYAWRAGKHIRHVYR-GHQKDVHLLLPFGSS--LIAIDRQNVLKVWNISTEDVYLEV--PFRSEEFQITAVTHPPTYINKIVLGSQQGQLKILNIKKNSVVCTLSHHDSRITCIEPSPALDVVAVG-HGDGTIILLNLKFDEVLMSFQQDWGQVTNLSFRTDGPP--ILVSACSNGYMAFWNLEERKLAGQLQ-AHEESVTTAICLPSEPVVFTTSPDNSMRMFVFDMPDGGARQLRIREGHTKPPFCIRY--HGSSGVSILSSGEDSTMRVFSTISESLNKSMGRATYNPKATKKKNRFEHDKFGMPPILEFTSDTAREKEWDNIAAIHAGVIQTTTWSFGKNRMGEHRLVPKQFQNSNRTNFQNETTCIVLTHCGNFVIIGYSSGDIERFNIQSGLHRATY--------GSPAHKMAVRGLA-SDNLNQTVISGCSEGLLKFWSFKGKVDKPLATLRLADGIALIRQHRESSMLAIGLETFKIFVVDMHTRVIVRKFVGHTAKLN---DLTFSPDSRWLITAAMDSTIKVWDIPSSYMVDHFRVEAPCVSLSMSPNGDFLATAHVGLLGIYLWANKTLFNQISLRSIDPL--EPAPYVGLPTNVCDAMELEDGMKELEIDEEDESKLGELVDTKYETPTQLSEELIT-LSGLAASRWQNLLDLELIKQRNKPKAPPKAPKQAPFFLPTVS-GLE-LRF-DVEN------------GQKEEDESRIRKASTLNNLT-------------AFGQLLEETADSLDFASAVAHLTQLGPSMVDFEIKSLHP 835          
BLAST of WD repeat-containing protein 36 vs. Ensembl Zebrafish
Match: wdr36 (WD repeat domain 36 [Source:ZFIN;Acc:ZDB-GENE-030131-464])

HSP 1 Score: 340.502 bits (872), Expect = 1.137e-101
Identity = 253/906 (27.92%), Postives = 438/906 (48.34%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSI--RIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            S ++   +A+GLYS ++  +++      +FY+ +AVG  F  Y    L +V+ S+ L EDI S+      ++      +  ++R++ V   Y   ++ +  +++  G   +L  +++ N ++IWD+E  + + Q  +   S  F +  +M P  Y  KIL  S++G + L N   NKLL+ F+     +  ++Q+P  +V+ +G    G++++ ++  D  LM+  QD GPITA+ FR D   H IM + +  GH+ +WDL+ K+ + Q R  H  ++A L  +  +PLL++N ADN+I+VW ++   G   LLR R GH  PP +I+ + +  ++  +LSAG+D  L  F+T  E    S+G   + +   ++  V  +   LP+     + +A++  WD +  CH G    T+W++ K + G H LEP    +   L     AT   ISSCGNF +I  SSGH+  +N+QSG+ RG Y  +       +AHE  + G+AV      T  +  A   L  W F S++++    L A   S  LH    M+A+A     +++L + TR IV    + S     +  + FS +   ++ A  +  ++T+D  +  LVDCF        + ++P   FL S+H D LG+YLWS       + L  LP D++PT  +      C   D  +E    +++ +    I PA  +      L  +S LP S + NLL++D I  + + +   K   +  FF+P +  GL     L    S  QS      V                            +    N    L  A     Y++ ++LL+   PSAI+ E++ L P         +++FL+++   ++   + ++ Q YLA  L  ++  + ++P
Sbjct:   11 SVIFSGFRALGLYSNHLAHVVRFHKKHREFYVVTAVGQCFHTYNVKKLGIVAVSNALPEDISSVTADCMLVYAAYGKLISAFARSREVVHTYT-GHQADVHLLLPFGN--HLISVDKDNVVIIWDVESEDTYLQISYDKAS--FEVSALMHPSTYLNKILFGSSQGSLQLWNIKSNKLLFTFSGWSAAVTVLQQTPAVDVVGVGLA-SGQIIIHNIKFDETLMKFQQDWGPITALSFRTD--GHPIMASGSPIGHIGLWDLEEKKLVSQMRDAHTTAIAGLTFLQNEPLLITNGADNAIRVWIFDVAGGDGRLLRQRMGHSAPPTKIRHYDQSGLN--ILSAGQDGTLQSFSTVHERFNKSLGHGTLNKAKAKKKGVKYDTAKLPSITTFASETARQSDWDGIIACHRGFLMTTSWNYQKGSMGAHKLEPERFNRNRSL--NVHATAVDISSCGNFAVIALSSGHIDVYNMQSGLHRGHYGED-------KAHEGPVRGVAVDALNQLTFSV-GADHLLKIWKFKSKEHLHTHRLPAAPASSLLHRDSGMLAIALDVFAIHILDVETRRIVR---KFSGHRGQINDMTFSPDGRWLITASMDCTIRTWDLPSGSLVDCFLVEAAAVSVSLSPTGNFLASSHVDGLGVYLWSNNTLCSLVSLRPLPADYEPTVIMLPGN--CPSKDTEEEEVLDSDSSEMAEYISPAQLD----EHLVTLSLLPDSRWKNLLHLDIIKKKNKPKEPPKVPKAAPFFIPTI-PGLVPQFSLPNTPSEAQSKVVNLGV----------------------------LAQKSNFYIELENAIESNSYEEPVKLLRELGPSAIETELRALSPDM-GGDVGVMKSFLKMISCILKSKKDFDLAQAYLALFLKLHLRLISDEP 857          
BLAST of WD repeat-containing protein 36 vs. Ensembl Xenopus
Match: nfatc1 (nuclear factor of activated T cells 1 [Source:Xenbase;Acc:XB-GENE-876756])

HSP 1 Score: 370.933 bits (951), Expect = 7.037e-113
Identity = 277/913 (30.34%), Postives = 441/913 (48.30%), Query Frame = 1
Query:   16 NVNFMSFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQL-ACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDS-ADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            NV   S L+   +++G+YS ++P +++      +FYL ++VG  F+ Y  + L  V+ S+ L E I  +   +  +F      +  ++R K V   Y+  +E    ++   G+  ++  ++  N L+IWDI+  E + Q  F      F I  IM P  Y  KIL+ S +G + L N   NKLLY F   G  +  ++Q+P  +V+AIG    G++++ ++  D  LM   QD GPIT++ FR D   H I+   +  GH+ +WDL+ K+ + Q R  H  ++A L  V G+PLL++N+ADN+I+VW ++ P G   LLR R GH  PP  I+    G    ++LSAG+D  L  F+T  +    S+G   V +   ++  +      LP      +  A++  WD +  CH+     TTW++ K T G H L+P  LK    L     AT   I+SCGNF +IG S+G +  +NIQSGI RG Y          +AH   I G+ V     + V I+A   +L   W F +++ I    L    T++ LH    M+AVA  D  +N+  + TR +V    R       V  + FS +   ++ A  +  +K +D  +  L+DCF     +  L ++P   FL + H DDLGIYLWS K  F  + L  LP DF+PT  +        + +  +   E     +++ME E   Q G     L  +S LP S + NLLN+D I+ RN  +   K   S  FF+P     L GL      D+  D S +    +G L+ +  F                             L  A + + Y   ++ +K   PS++D E++ L P  +    + +Q+FL+++ + +    + EV Q YLA  L  ++  +  +P
Sbjct:    5 NVARGSVLFTGYRSLGVYSNHIPHVVRYHKKHKEFYLVTSVGKSFLTYNVNKLGQVAVSNALPEPISCLAADRMLVFAAHSNLLKAFARNKEVVHTYQ-GHEAEIHLVQPFGD--HVISVDTSNVLMIWDIKSEEEYLQLTF--DKTNFAISAIMHPSTYLNKILLGSQQGSLQLWNIKSNKLLYTFQGWGSGVTVLQQAPAVDVVAIGLTC-GKIIIHNIKFDETLMTFQQDWGPITSLSFRTD--GHPILAAGSPLGHIGLWDLEEKKLMNQMREAHSTAIAGLTFVHGEPLLITNAADNAIRVWIFDGPGGQGRLLRFRMGHSAPPTFIRH--HGADGKQILSAGQDGTLQSFSTVHDRYSKSLGHGSVDKAKSKKVGLRCLSLRLPPITLFASEEARQSDWDGIVACHQQSLSCTTWNYVKCTMGAHKLKPPDLKNSKTL--EIYATASDITSCGNFTVIGLSNGSVDVYNIQSGIHRGHY-------GKEKAHGGPIRGVVV--DGLNQVTITAGSDKLIKFWKFKTKELIQTTSLSVPPTAVLLHRESAMLAVALDDFTLNIFDIETRRLVR---RFQGHNGRVNDMTFSPDGRWLLTASMDCTIKVWDLPSGCLIDCFLLDSAVVSLTLSPTGDFLATAHVDDLGIYLWSNKSLFSLISLRPLPADFEPTVVMLPGG--ADEMEVEETVVEVENTNEDIMEYESPEQLG---EKLVTLSLLPESRWKNLLNLDIIKQRNKPKEPPKVPKSAPFFIPT----LPGLVPRFASDAQGDTSQSKIVNLGVLEQKSAFFVQ--------------------------LEEALTRQNYSVPLKTIKEMGPSSVDTELRNLAP-ENGGSVEVMQSFLKMIQSMLDTKKDFEVAQAYLALFLKLHLKFISSEP 857          
BLAST of WD repeat-containing protein 36 vs. Ensembl Xenopus
Match: nfatc1 (nuclear factor of activated T cells 1 [Source:Xenbase;Acc:XB-GENE-876756])

HSP 1 Score: 369.392 bits (947), Expect = 1.102e-112
Identity = 277/905 (30.61%), Postives = 437/905 (48.29%), Query Frame = 1
Query:   16 NVNFMSFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIG--CGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQL-ACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDS-ADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLN 2700
            NV   S L+   +++G+YS ++P +++      +FYL ++VG  F+ Y  + L  V+ S+ L E I  +   +  +F      +  ++R K V   Y+  +E    ++   G+  ++  ++  N L+IWDI+  E + Q  F      F I  IM P  Y  KIL+ S +G + L N   NKLLY F   G  +  ++Q+P  +V+AIG  CG   ++++ ++  D  LM   QD GPIT++ FR D   H I+   +  GH+ +WDL+ K+ + Q R  H  ++A L  V G+PLL++N+ADN+I+VW ++ P G   LLR R GH  PP  I+    G    ++LSAG+D  L  F+T  +    S+G   V +   ++  +      LP      +  A++  WD +  CH+     TTW++ K T G H L+P  LK    L     AT   I+SCGNF +IG S+G +  +NIQSGI RG Y          +AH   I G+ V     + V I+A   +L   W F +++ I    L    T++ LH    M+AVA  D  +N+  + TR +V    R       V  + FS +   ++ A  +  +K +D  +  L+DCF     +  L ++P   FL + H DDLGIYLWS K  F  + L  LP DF+PT  +        + +  +   E     +++ME E   Q G     L  +S LP S + NLLN+D I+ RN  +   K   S  FF+P     L GL      D+  D S +    +G L+ +  F                             L  A + + Y   ++ +K   PS++D E++ L P  +    + +Q+FL+++ + +    + EV Q YLA  L 
Sbjct:    5 NVARGSVLFTGYRSLGVYSNHIPHVVRYHKKHKEFYLVTSVGKSFLTYNVNKLGQVAVSNALPEPISCLAADRMLVFAAHSNLLKAFARNKEVVHTYQ-GHEAEIHLVQPFGD--HVISVDTSNVLMIWDIKSEEEYLQLTF--DKTNFAISAIMHPSTYLNKILLGSQQGSLQLWNIKSNKLLYTFQGWGSGVTVLQQAPAVDVVAIGLTCG---KIIIHNIKFDETLMTFQQDWGPITSLSFRTD--GHPILAAGSPLGHIGLWDLEEKKLMNQMREAHSTAIAGLTFVHGEPLLITNAADNAIRVWIFDGPGGQGRLLRFRMGHSAPPTFIRH--HGADGKQILSAGQDGTLQSFSTVHDRYSKSLGHGSVDKAKSKKVGLRCLSLRLPPITLFASEEARQSDWDGIVACHQQSLSCTTWNYVKCTMGAHKLKPPDLKNSKTL--EIYATASDITSCGNFTVIGLSNGSVDVYNIQSGIHRGHY-------GKEKAHGGPIRGVVV--DGLNQVTITAGSDKLIKFWKFKTKELIQTTSLSVPPTAVLLHRESAMLAVALDDFTLNIFDIETRRLVR---RFQGHNGRVNDMTFSPDGRWLLTASMDCTIKVWDLPSGCLIDCFLLDSAVVSLTLSPTGDFLATAHVDDLGIYLWSNKSLFSLISLRPLPADFEPTVVMLPGG--ADEMEVEETVVEVENTNEDIMEYESPEQLG---EKLVTLSLLPESRWKNLLNLDIIKQRNKPKEPPKVPKSAPFFIPT----LPGLVPRFASDAQGDTSQSKIVNLGVLEQKSAFFVQ--------------------------LEEALTRQNYSVPLKTIKEMGPSSVDTELRNLAP-ENGGSVEVMQSFLKMIQSMLDTKKDFEVAQAYLALFLK 847          
BLAST of WD repeat-containing protein 36 vs. Ensembl Xenopus
Match: nfatc1 (nuclear factor of activated T cells 1 [Source:Xenbase;Acc:XB-GENE-876756])

HSP 1 Score: 362.459 bits (929), Expect = 8.904e-110
Identity = 276/913 (30.23%), Postives = 437/913 (47.86%), Query Frame = 1
Query:   16 NVNFMSFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQL-ACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDS-ADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            NV   S L+   +++G+YS ++P +++      +FYL ++VG  F+ Y  SN         L E I  +   +  +F      +  ++R K V   Y+  +E    ++   G+  ++  ++  N L+IWDI+  E + Q  F      F I  IM P  Y  KIL+ S +G + L N   NKLLY F   G  +  ++Q+P  +V+AIG    G++++ ++  D  LM   QD GPIT++ FR D   H I+   +  GH+ +WDL+ K+ + Q R  H  ++A L  V G+PLL++N+ADN+I+VW ++ P G   LLR R GH  PP  I+    G    ++LSAG+D  L  F+T  +    S+G   V +   ++  +      LP      +  A++  WD +  CH+     TTW++ K T G H L+P  LK    L     AT   I+SCGNF +IG S+G +  +NIQSGI RG Y          +AH   I G+ V     + V I+A   +L   W F +++ I    L    T++ LH    M+AVA  D  +N+  + TR +V    R       V  + FS +   ++ A  +  +K +D  +  L+DCF     +  L ++P   FL + H DDLGIYLWS K  F  + L  LP DF+PT  +        + +  +   E     +++ME E   Q G     L  +S LP S + NLLN+D I+ RN  +   K   S  FF+P     L GL      D+  D S +    +G L+ +  F                             L  A + + Y   ++ +K   PS++D E++ L P  +    + +Q+FL+++ + +    + EV Q YLA  L  ++  +  +P
Sbjct:    5 NVARGSVLFTGYRSLGVYSNHIPHVVRYHKKHKEFYLVTSVGKSFLTYNVSN--------ALPEPISCLAADRMLVFAAHSNLLKAFARNKEVVHTYQ-GHEAEIHLVQPFGD--HVISVDTSNVLMIWDIKSEEEYLQLTF--DKTNFAISAIMHPSTYLNKILLGSQQGSLQLWNIKSNKLLYTFQGWGSGVTVLQQAPAVDVVAIGLTC-GKIIIHNIKFDETLMTFQQDWGPITSLSFRTD--GHPILAAGSPLGHIGLWDLEEKKLMNQMREAHSTAIAGLTFVHGEPLLITNAADNAIRVWIFDGPGGQGRLLRFRMGHSAPPTFIRH--HGADGKQILSAGQDGTLQSFSTVHDRYSKSLGHGSVDKAKSKKVGLRCLSLRLPPITLFASEEARQSDWDGIVACHQQSLSCTTWNYVKCTMGAHKLKPPDLKNSKTL--EIYATASDITSCGNFTVIGLSNGSVDVYNIQSGIHRGHY-------GKEKAHGGPIRGVVV--DGLNQVTITAGSDKLIKFWKFKTKELIQTTSLSVPPTAVLLHRESAMLAVALDDFTLNIFDIETRRLVR---RFQGHNGRVNDMTFSPDGRWLLTASMDCTIKVWDLPSGCLIDCFLLDSAVVSLTLSPTGDFLATAHVDDLGIYLWSNKSLFSLISLRPLPADFEPTVVMLPGG--ADEMEVEETVVEVENTNEDIMEYESPEQLG---EKLVTLSLLPESRWKNLLNLDIIKQRNKPKEPPKVPKSAPFFIPT----LPGLVPRFASDAQGDTSQSKIVNLGVLEQKSAFFVQ--------------------------LEEALTRQNYSVPLKTIKEMGPSSVDTELRNLAP-ENGGSVEVMQSFLKMIQSMLDTKKDFEVAQAYLALFLKLHLKFISSEP 849          
BLAST of WD repeat-containing protein 36 vs. Ensembl Xenopus
Match: nfatc1 (nuclear factor of activated T cells 1 [Source:Xenbase;Acc:XB-GENE-876756])

HSP 1 Score: 360.918 bits (925), Expect = 2.962e-109
Identity = 273/906 (30.13%), Postives = 432/906 (47.68%), Query Frame = 1
Query:   37 LYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQL-ACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDS-ADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            L+   +++G+YS ++P +++      +FYL ++VG  F+ Y  SN         L E I  +   +  +F      +  ++R K V   Y+  +E    ++   G+  ++  ++  N L+IWDI+  E + Q  F      F I  IM P  Y  KIL+ S +G + L N   NKLLY F   G  +  ++Q+P  +V+AIG    G++++ ++  D  LM   QD GPIT++ FR D   H I+   +  GH+ +WDL+ K+ + Q R  H  ++A L  V G+PLL++N+ADN+I+VW ++ P G   LLR R GH  PP  I+    G    ++LSAG+D  L  F+T  +    S+G   V +   ++  +      LP      +  A++  WD +  CH+     TTW++ K T G H L+P  LK    L     AT   I+SCGNF +IG S+G +  +NIQSGI RG Y          +AH   I G+ V     + V I+A   +L   W F +++ I    L    T++ LH    M+AVA  D  +N+  + TR +V    R       V  + FS +   ++ A  +  +K +D  +  L+DCF     +  L ++P   FL + H DDLGIYLWS K  F  + L  LP DF+PT  +             +   E     +++ME E   Q G     L  +S LP S + NLLN+D I+ RN  +   K   S  FF+P     L GL      D+  D S +    +G L+ +  F                             L  A + + Y   ++ +K   PS++D E++ L P  +    + +Q+FL+++ + +    + EV Q YLA  L  ++  +  +P
Sbjct:    9 LFTGYRSLGVYSNHIPHVVRYHKKHKEFYLVTSVGKSFLTYNVSN--------ALPEPISCLAADRMLVFAAHSNLLKAFARNKEVVHTYQ-GHEAEIHLVQPFGD--HVISVDTSNVLMIWDIKSEEEYLQLTF--DKTNFAISAIMHPSTYLNKILLGSQQGSLQLWNIKSNKLLYTFQGWGSGVTVLQQAPAVDVVAIGLTC-GKIIIHNIKFDETLMTFQQDWGPITSLSFRTD--GHPILAAGSPLGHIGLWDLEEKKLMNQMREAHSTAIAGLTFVHGEPLLITNAADNAIRVWIFDGPGGQGRLLRFRMGHSAPPTFIRH--HGADGKQILSAGQDGTLQSFSTVHDRYSKSLGHGSVDKAKSKKVGLRCLSLRLPPITLFASEEARQSDWDGIVACHQQSLSCTTWNYVKCTMGAHKLKPPDLKNSKTL--EIYATASDITSCGNFTVIGLSNGSVDVYNIQSGIHRGHY-------GKEKAHGGPIRGVVV--DGLNQVTITAGSDKLIKFWKFKTKELIQTTSLSVPPTAVLLHRESAMLAVALDDFTLNIFDIETRRLVR---RFQGHNGRVNDMTFSPDGRWLLTASMDCTIKVWDLPSGCLIDCFLLDSAVVSLTLSPTGDFLATAHVDDLGIYLWSNKSLFSLISLRPLPADFEPTVVM--------LPGVEETVVEVENTNEDIMEYESPEQLG---EKLVTLSLLPESRWKNLLNLDIIKQRNKPKEPPKVPKSAPFFIPT----LPGLVPRFASDAQGDTSQSKIVNLGVLEQKSAFFVQ--------------------------LEEALTRQNYSVPLKTIKEMGPSSVDTELRNLAP-ENGGSVEVMQSFLKMIQSMLDTKKDFEVAQAYLALFLKLHLKFISSEP 840          
BLAST of WD repeat-containing protein 36 vs. Ensembl Xenopus
Match: nfatc1 (nuclear factor of activated T cells 1 [Source:Xenbase;Acc:XB-GENE-876756])

HSP 1 Score: 350.132 bits (897), Expect = 2.178e-105
Identity = 279/913 (30.56%), Postives = 437/913 (47.86%), Query Frame = 1
Query:   16 NVNFMSFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTA-CSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQL-ACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            NV   S L+   +++G+YS ++P +++      +FYL ++VG  F+ Y  SN         L E I  +   +  +F      +  ++R K V   Y+  +E    ++   G+  ++  ++  N L+IWDI+  E + Q  F      F I  IM P  Y  KIL+ S +G + L N   NKLLY F   G  +  ++Q+P  +V+AIG    G++++ ++  D  LM   QD GPIT++ FR D   H I+   +  GH+ +WDL+ K+ + Q R  H  ++A L  V G+PLL++N+ADN+I+VW ++ P G   LLR R GH  PP  I+    G    ++LSAG+D  L  F+T  +    S+G      HG     ++     +  AL  TA   A++  WD +  CH+     TTW++ K T G H L+P  LK    L     AT   I+SCGNF +IG S+G +  +NIQSGI RG Y          +AH   I G+ V     + V I+A   +L   W F +++ I    L    T++ LH    M+AVA  D  +N+  + TR +V    R       V  + FS +   ++ A  +  +K +D  +  L+DCF     +  L ++P   FL + H DDLGIYLWS K  F  + L  LP DF+PT  +   +     ++            +++ME E   Q G     L  +S LP S + NLLN+D I+ RN  +   K   S  FF+P     L GL                A+  Q D  Q    +K   +N  R         G       L  + S++     ++ +K   PS++D E++ L P  +    + +Q+FL+++ + +    + EV Q YLA  L  ++  +  +P
Sbjct:    5 NVARGSVLFTGYRSLGVYSNHIPHVVRYHKKHKEFYLVTSVGKSFLTYNVSN--------ALPEPISCLAADRMLVFAAHSNLLKAFARNKEVVHTYQ-GHEAEIHLVQPFGD--HVISVDTSNVLMIWDIKSEEEYLQLTF--DKTNFAISAIMHPSTYLNKILLGSQQGSLQLWNIKSNKLLYTFQGWGSGVTVLQQAPAVDVVAIGLTC-GKIIIHNIKFDETLMTFQQDWGPITSLSFRTD--GHPILAAGSPLGHIGLWDLEEKKLMNQMREAHSTAIAGLTFVHGEPLLITNAADNAIRVWIFDGPGGQGRLLRFRMGHSAPPTFIRH--HGADGKQILSAGQDGTLQSFSTVHDRYSKSLG------HGKSYPYLS-----VCCALGGTAFAEARQSDWDGIVACHQQSLSCTTWNYVKCTMGAHKLKPPDLKNSKTL--EIYATASDITSCGNFTVIGLSNGSVDVYNIQSGIHRGHY-------GKEKAHGGPIRGVVV--DGLNQVTITAGSDKLIKFWKFKTKELIQTTSLSVPPTAVLLHRESAMLAVALDDFTLNIFDIETRRLVR---RFQGHNGRVNDMTFSPDGRWLLTASMDCTIKVWDLPSGCLIDCFLLDSAVVSLTLSPTGDFLATAHVDDLGIYLWSNKSLFSLISLRPLPADFEPTVVMLPGETVVEVENTN----------EDIMEYESPEQLG---EKLVTLSLLPESRWKNLLNLDIIKQRNKPKEPPKVPKSAPFFIPT----LPGL------------VPRFASDAQGDTSQV---IKVHRSNNFR------HFFGWVGRAYHLFCSYSEDCVP--LKTIKEMGPSSVDTELRNLAP-ENGGSVEVMQSFLKMIQSMLDTKKDFEVAQAYLALFLKLHLKFISSEP 833          
BLAST of WD repeat-containing protein 36 vs. Ensembl Mouse
Match: Wdr36 (WD repeat domain 36 [Source:MGI Symbol;Acc:MGI:1917819])

HSP 1 Score: 342.043 bits (876), Expect = 2.414e-102
Identity = 275/914 (30.09%), Postives = 449/914 (49.12%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDI--LSIDGYKNKLFTGCETNVY-GYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYV-LPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMA--STEFFLPQVSEGLDGL--RWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            S L+   +A+GL+S  VP +++ S     FY+ + VG  F  Y    L+LV+ S+ + +DI  ++ DG   +L      NV+  ++R K +   +K  ++    ++   G+  ++  ++  + L+IW I   E + Q  F      F I TI+ P  Y  K+L+ S +G + L N   NKLLY F    +G  + +++Q+P  +V+AIG    G+V++ ++ +D  LM+ HQD GPIT+I FR D   H IM   +  GH+ +WDL+ K+ I Q R+ H  +++ L  +  +PLLV+N ADN++++W ++ P G   LLR R GH     +I+++  G    ++LSA +D  L  F+T  E    S+G   V +   +   +     V LP      A  A++  WD +  CH+G R  +TW++ + T G ++L+P  +K      S  +AT   I+SCGNF +IG SSG +  +N+QSGI RG +     GD   +AH  ++ G+AV       VV + + R L  W+F S+  I  L LD+    + LH    ++ +A  D  + +L + TR IV      S     +  + FS +   L+  A    V+T+D  +  L+DCF        + M+P   FL ++H D LGIYLWS    +  + L  LP D+ P+  +  P   C      D  ++   +  E++E E   Q       L  +S LP S + NLLN+D I+ +N+         S  FF+P V     GL  R+   E S+D   +    +G L AQ+    +K                         L     + +Y+  + LLK   PS I+ E++ L P       + +++FL ++   + R  + E+ Q YLA  L  ++  L  +P
Sbjct:   14 SVLFAGFRALGLFSNEVPHVVRYSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADG---RLVFAAYGNVFSAFARNKEIVHTFK-GHKAEIHLLQPFGD--HVISVDTDSVLIIWHIYSEEEYLQLTF--DKSVFKISTILHPSTYLNKVLLGSEQGSLQLWNIKSNKLLYTFPGWKVG--VTALQQAPAVDVVAIGLV-SGQVVIHNIKYDETLMKFHQDWGPITSISFRTD--GHPIMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAISGLTFLHREPLLVTNGADNALRIWIFDGPAGEGRLLRFRMGHSASLTKIRYY--GQNGQQILSASQDGTLQSFSTVHEKFNKSLGHGLVNKKIVKRKGLQNTMSVRLPPITQFAAEEARQSDWDGIIACHQGKRSCSTWNYQRSTIGAYFLKPRGVKTN----SNLTATAVDITSCGNFAIIGLSSGAVDVYNMQSGIHRGNF-----GD--DKAHTGSVRGVAV-DGLNQLVVTAGSERLLKFWNFKSKVLIHSLGLDSSPNMMLLHRDSGILGLAMDDFSIAVLDIETRKIVR---EFSGHHGQINDMTFSPDGRWLISAAMDCSVRTWDLPSGCLIDCFLLDSAPLNVTMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPPDYVPSIVM-LPGT-CQTQGMEDLEEKTEPS-DEMIEYESPEQLSEQ---LVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPQSAPFFIPTVP----GLVPRFAVPEPSSDPQQSKVVNLGIL-AQKSNFYLK-------------------------LEEGLLNNQYEAALNLLKELGPSGIETELRNLSP-DDGGSVEVMRSFLSMIGMMLDRKRDFELAQAYLALFLKLHLRTLPSEP 860          
BLAST of WD repeat-containing protein 36 vs. Ensembl Mouse
Match: Wdr36 (WD repeat domain 36 [Source:MGI Symbol;Acc:MGI:1917819])

HSP 1 Score: 341.658 bits (875), Expect = 3.954e-102
Identity = 275/914 (30.09%), Postives = 449/914 (49.12%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDI--LSIDGYKNKLFTGCETNVY-GYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYV-LPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMA--STEFFLPQVSEGLDGL--RWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            S L+   +A+GL+S  VP +++ S     FY+ + VG  F  Y    L+LV+ S+ + +DI  ++ DG   +L      NV+  ++R K +   +K  ++    ++   G+  ++  ++  + L+IW I   E + Q  F      F I TI+ P  Y  K+L+ S +G + L N   NKLLY F    +G  + +++Q+P  +V+AIG    G+V++ ++ +D  LM+ HQD GPIT+I FR D   H IM   +  GH+ +WDL+ K+ I Q R+ H  +++ L  +  +PLLV+N ADN++++W ++ P G   LLR R GH     +I+++  G    ++LSA +D  L  F+T  E    S+G   V +   +   +     V LP      A  A++  WD +  CH+G R  +TW++ + T G ++L+P  +K      S  +AT   I+SCGNF +IG SSG +  +N+QSGI RG +     GD   +AH  ++ G+AV       VV + + R L  W+F S+  I  L LD+    + LH    ++ +A  D  + +L + TR IV      S     +  + FS +   L+  A    V+T+D  +  L+DCF        + M+P   FL ++H D LGIYLWS    +  + L  LP D+ P+  +  P   C      D  ++   +  E++E E   Q       L  +S LP S + NLLN+D I+ +N+         S  FF+P V     GL  R+   E S+D   +    +G L AQ+    +K                         L     + +Y+  + LLK   PS I+ E++ L P       + +++FL ++   + R  + E+ Q YLA  L  ++  L  +P
Sbjct:   14 SVLFAGFRALGLFSNEVPHVVRYSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADG---RLVFAAYGNVFSAFARNKEIVHTFK-GHKAEIHLLQPFGD--HVISVDTDSVLIIWHIYSEEEYLQLTF--DKSVFKISTILHPSTYLNKVLLGSEQGSLQLWNIKSNKLLYTFPGWKVG--VTALQQAPAVDVVAIGLV-SGQVVIHNIKYDETLMKFHQDWGPITSISFRTD--GHPIMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAISGLTFLHREPLLVTNGADNALRIWIFDGPAGEGRLLRFRMGHSASLTKIRYY--GQNGQQILSASQDGTLQSFSTVHEKFNKSLGHGLVNKKIVKRKGLQNTMSVRLPPITQFAAEEARQSDWDGIIACHQGKRSCSTWNYQRSTIGAYFLKPRGVKTN----SNLTATAVDITSCGNFAIIGLSSGAVDVYNMQSGIHRGNF-----GD--DKAHTGSVRGVAV-DGLNQLVVTAGSERLLKFWNFKSKVLIHSLGLDSSPNMMLLHRDSGILGLAMDDFSIAVLDIETRKIVR---EFSGHHGQINDMTFSPDGRWLISAAMDCSVRTWDLPSGCLIDCFLLDSAPLNVTMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPPDYVPSIVM-LPGT-CQTQGMEDLEEKTEPS-DEMIEYESPEQLSEQ---LVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPQSAPFFIPTVP----GLVPRFAVPEPSSDPQQSKVVNLGIL-AQKSNFYLK-------------------------LEEGLLNNQYEAALNLLKELGPSGIETELRNLSP-DDGGSVEVMRSFLSMIGMMLDRKRDFELAQAYLALFLKLHLRTLPSEP 860          
BLAST of WD repeat-containing protein 36 vs. UniProt/SwissProt
Match: sp|Q8NI36|WDR36_HUMAN (WD repeat-containing protein 36 OS=Homo sapiens OX=9606 GN=WDR36 PE=1 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.136e-98
Identity = 267/915 (29.18%), Postives = 442/915 (48.31%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDI--LSIDGYKNKLFTGCETNVY-GYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYV-LPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSI--RIRNENATKGMASTEFFLPQVSEGLDGL--RWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPT 2733
            S L+   +A+GL+S ++P +++ S     FY+ + VG  F  Y    L+LV+ S+ + +DI  ++ DG   +L      NV+  ++R K +   +K  ++     +   G+  ++  ++    L+IW I   E + Q  F      F I  I+ P  Y  KIL+ S +G + L N   NKLLY F    +G  + +++Q+P  +V+AIG    G+V++ ++  +  LM+  QD GPIT+I FR D   H +M   +  GH+ +WDL+ K+ I Q R+ H  ++A L  +  +PLLV+N ADN++++W ++ P G   LLR R GH  P   I+++  G    ++LSA +D  L  F+T  E    S+G   + +   +   +     V LP      A  A+E  WD +  CH+G    +TW++ K T G ++L+P  LK+        +AT   I+SCGNF +IG SSG +  +N+QSGI RG +  +       +AH+ ++ G+AV      TV   + G  L  W+F ++  I  + L +    + LH    ++ +A  D  +++L + TR IV      S     +  +AFS +   L+  A    ++T+D  +  L+DCF        + M+P   FL ++H D LGIYLWS    +  + L  LP D+ P+  +  P   C   D     +    +  EL+E +   Q       L  +S LP S + NLLN+D I  + + +   K   S  FF+P +     GL  R+   E + D   +    +G L  +  F                          C  L     + +YD  + LLK   PS I+ E++ L P    +  + +Q+FL+++   + R  + E+ Q YLA  L  ++  L  +P 
Sbjct:   67 SALFAGFRALGLFSNDIPHVVRFSALKRRFYVTTCVGKSFHTYDVQKLSLVAVSNSVPQDICCMAADG---RLVFAAYGNVFSAFARNKEIVHTFK-GHKAEIHFLQPFGD--HIISVDTDGILIIWHIYSEEEYLQLTF--DKSVFKISAILHPSTYLNKILLGSEQGSLQLWNVKSNKLLYTFPGWKVG--VTALQQAPAVDVVAIGLM-SGQVIIHNIKFNETLMKFRQDWGPITSISFRTD--GHPVMAAGSPCGHIGLWDLEDKKLINQMRNAHSTAIAGLTFLHREPLLVTNGADNALRIWIFDGPTGEGRLLRFRMGHSAPLTNIRYY--GQNGQQILSASQDGTLQSFSTVHEKFNKSLGHGLINKKRVKRKGLQNTMSVRLPPITKFAAEEARESDWDGIIACHQGKLSCSTWNYQKSTIGAYFLKPKELKKDDI-----TATAVDITSCGNFAVIGLSSGTVDVYNMQSGIHRGSFGKD-------QAHKGSVRGVAVDGLNQLTVTTGSEGL-LKFWNFKNKILIHSVSLSSSPNIMLLHRDSGILGLALDDFSISVLDIETRKIVR---EFSGHQGQINDMAFSPDGRWLISAAMDCSIRTWDLPSGCLIDCFLLDSAPLNVSMSPTGDFLATSHVDHLGIYLWSNISLYSVVSLRPLPADYVPSIVM-LPGT-CQTQDVEVSEETVEPS-DELIEYDSPEQLNEQ---LVTLSLLPESRWKNLLNLDVIKKKNKPKEPPKVPKSAPFFIPTIP----GLVPRYAAPEQNNDPQQSKVVNLGVLAQKSDF--------------------------CLKLEEGLVNNKYDTALNLLKESGPSGIETELRSLSPDCGGS-IEVMQSFLKMIGMMLDRKRDFELAQAYLALFLKLHLKMLPSEPV 913          
BLAST of WD repeat-containing protein 36 vs. UniProt/SwissProt
Match: sp|O14053|UTP21_SCHPO (U3 small nucleolar RNA-associated protein 21 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC1672.07 PE=3 SV=1)

HSP 1 Score: 259.225 bits (661), Expect = 1.268e-71
Identity = 234/881 (26.56%), Postives = 395/881 (44.84%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGG----EVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN--IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTV----VISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIA--DGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSL---------LAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLD--PIYHE 2595
            S +Y P ++IG  S  VP  I++ G   F + ++VG  F  Y    L L+    +LD++I  +  +K+ +     + ++ Y R K +  +   +       +   GE  ++        + +W         E+   FL  + ++   I +++ P  Y  KIL+  + G + + N   +K ++ F    G  I S+ Q+P+ +V+A+G    GR+++ +L +  +LME  QD G + +  FR D     I+ ++   G ++ WDL  +R    + + H GS+  +  + G+P+LV+   DNS+K W ++  DG P +LRSRNGH++PP+ +KF+  G     L+SA  D  L   + +Q+SQ   + +  V     + + V  E+  LP    L++ + +E  WD V   H+      TW++  +T GQH L  +           +S     +S CGNF LIG S G +  +N+QSGI+R  +             ++++SG  V       V    V ++    L  WDF   + I  L + + IT      S D+VAVA  D  + ++ + TR IV      S   N + +  FS     ++ A  DG  ++T+D     L+D   T    T L  AP   +L +TH D +GI LW+    F  +    L LD      + AP V      +           +  + +E   ++   +S          L  +S LP + +  L+N+++I+ RN  +   K      FFLP +                DQS A           +Q +  + +    K   +AS ++ G++   S LL    D   D + + LKS  P+ ID EI+ LD  P Y E
Sbjct:   21 SRIYAPFRSIGHVSNAVPFDIEARGTH-FLVTTSVGNTFQTYDCEKLNLLFVGKQLDKEITCLKSFKDFMLVAAGSKIFAYKRGKIIWDIDVEQEHGTVTHLDAFGE--WIIACTSSRHVYVWKHASKYSVPELHTTFLPNTNAD---ITSLLHPSTYLNKILLGFSDGALQIWNLRVSKRVHEFQEFFGDGITSLTQAPVLDVLAVGTIS-GRIVIFNLKNGSILMEFKQD-GQVLSCSFRTDGTP--ILASSNPIGDLSFWDLSKRRIQNVTYNAHFGSLPKIQFLNGQPILVTAGPDNSLKEWIFDSMDGAPRILRSRNGHYEPPSFVKFY--GKSVHFLISAATDRSLRAVSLYQDSQSTELSQGSVISKAKKLN-VRPEELKLPEITALSSSNTREKYWDNVLTAHKNDSSARTWNWKSKTLGQHVLPTS---------DGTSVRSVCVSCCGNFGLIGSSKGVVDVYNMQSGIKRKSF------------GQSSLSGKPVTAVMLDNVNRILVTASLDGILKFWDFNKGNLIDSLDVGSSITHAIYQHSSDLVAVACDDFGIRIVDVQTRKIVRELWGHS---NRLTSFDFSDTGRWLVTASLDGT-IRTWDLPTGHLIDSISTPSVCTSLTFAPTGDYLATTHVDQVGISLWTNLSMFKHVSTKALRLD--DVVEVSAPSVSGEKGISVV---------EAALNVESNAEDEEDISYRTMDQLDPNLQTLSKLPRTQWQTLINLEAIKARNAPKEVPKVPEKAPFFLPSLK---------------DQSEATVP--------KQPIATEIS----KPTAVASIKVSGTE--FSTLLHGNDD---DAFFEYLKSLGPAKIDLEIRSLDAYPPYEE 820          
BLAST of WD repeat-containing protein 36 vs. UniProt/SwissProt
Match: sp|Q06078|UTP21_YEAST (U3 small nucleolar RNA-associated protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UTP21 PE=1 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 6.298e-47
Identity = 223/891 (25.03%), Postives = 389/891 (43.66%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDK-LDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIW------DIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHE---GSVASLWCVPGKPLLVSNSADNSIK--VWNYERPDGT-------PLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMG-RAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGD-GLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIAD-GNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSL------LAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGT---------AAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASD-EEYDKWIQLLKSFSPSAIDYEIQMLD 2580
            S ++ P + IG  S  VP    ++G   FY+ + VG  F +Y  + L L+  S+K     I+++  + + ++   E  V  Y R      + + E + N   + + G+  YLC   + N + I+      D    E + + L  ++ +   I ++     Y  K+ V  TK  + L N    KL++  N    +I + + +P+ ++IA+G    G V+M ++     +  +      I+++ FR D   HL +   TS+G +  +DLD +  I   ++ H    G V     + G+P++V++  DNS+K  V++     G+       P  LRSR GH +PP+ I F      S  +LSA +D  L  F+  +++Q   M  R +  Q G R    T +    P  + L   +A+   W+ +   H+  +   TW    +  G+   +        F+ S       A+S CGNF  IG S+G +  +N+QSGI R  Y          + H+ A++G+++       V     G  +  +DF     +G L LDA IT++  H S D+ A+A  D  +V +  +T+ +V      S   N + A  FS E   ++ A   + ++T+D      +D        T ++ +PN   L +TH    GI +W+ +  F    +S   +D      +  P      +D+       +   ++L +I+       + SL      L  +S  P S  + LL++D IR R+  + A K      FFL      L G +  DE    +  A  T          A  +LDA++Q  + K T              +G ++  +  LR  S  ++Y   +  L +FSP+A+D EI+ L+
Sbjct:   21 SKIFSPFRIIGNVSNGVPFATGTLGST-FYIVTCVGKTFQIYDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIE-EHLLELETDANVEHLCIFGD--YLCASTDDNSIFIYKKSDPQDKYPSEFYTK-LTVTEIQGGEIVSLQHLATYLNKLTVV-TKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTV-TGEVIMFNMRKGKRIRTIKIPQSRISSLSFRTDGSSHLSV--GTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAF--ADSQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSK-FPEIVALAIENARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTT---DDGFVKS------VAMSQCGNFGFIGSSNGSITIYNMQSGILRKKY----------KLHKRAVTGISLDGMNRKMVSCGLDG-IVGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHS---NRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQF--KTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNT----YTSLEQIDKELLTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQ-----LSGEKVGDEASVREGIAHETPEEIHRRDQEAQKKLDAEEQMNKFKVTG------------RLGFESHFTKQLREGSQSKDYSSLLATLINFSPAAVDLEIRSLN 853          
BLAST of WD repeat-containing protein 36 vs. UniProt/SwissProt
Match: sp|Q6P5M2|WDR61_DANRE (WD repeat-containing protein 61 OS=Danio rerio OX=7955 GN=wdr61 PE=2 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 1.724e-7
Identity = 69/297 (23.23%), Postives = 127/297 (42.76%), Query Frame = 1
Query:  247 GCETNVYGYSRAKHVSKVYKYENEK---NWRIIVVLGEEGYLCGINECN---------------RLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFNI-GQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFN 1080
            G ET V G      + KV+K+ +EK    W +      EG+  G+   N                + +WD+E G+          +      T+    + K+ I   S  GK+++      K  +  +  G+ I+S+  SP    +A G   DG + + D+    +L  L     PI ++ F  D +   +++TA+ +G++ ++D+    N+  +   H   V S+   P     VS+S+D SIKVW+             ++  W     +K+ P G   S+++SAG D  + +++
Sbjct:   31 GSETIVTG--SLDDLVKVWKWSDEKLELQWTL------EGHQLGVVSVNISQNGAIAASSSLDAHIRLWDLETGKQIKSM----DAGPVDAWTVAFSPDSKY-IATGSHLGKVNIFGVESGKKEHSLDTRGKFILSIAYSPDGKYLASGAI-DGIINIFDIATGKLLHTLEGHAMPIRSLTFSPDSQ---LLVTASDDGYIKIYDV-QHANLAGTLSGHGSWVLSVAFSPDDTHFVSSSSDKSIKVWDTSSRSCVNTFFDHQDQVWS----VKYNPTG---SKIVSAGDDRAIHIYD 302          
BLAST of WD repeat-containing protein 36 vs. TrEMBL
Match: A0A023ZS89 (WD repeat-containing protein 36 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 536.184 bits (1380), Expect = 0.000e+0
Identity = 275/275 (100.00%), Postives = 275/275 (100.00%), Query Frame = 1
Query: 1993 MKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPTAAMSNPETSQMLSGDGDVLLTSDKPDDK 2817
            MKLSGLPLDFQPTKTLDAPKVYCADDDAADENDEGAEAPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPTAAMSNPETSQMLSGDGDVLLTSDKPDDK
Sbjct:    1 MKLSGLPLDFQPTKTLDAPKVYCADDDAADENDEGAEAPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPTAAMSNPETSQMLSGDGDVLLTSDKPDDK 275          
BLAST of WD repeat-containing protein 36 vs. TrEMBL
Match: A0A5K4F2V5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 6.828e-124
Identity = 315/1069 (29.47%), Postives = 508/1069 (47.52%), Query Frame = 1
Query:   28 MSFLYHPLKAIGLYSTNVPLLIKSVGDDD-FYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRN---------------------DIEEHLIMLTATSNGHVAMWDLDTK---RNIGQSRHCHEGSVASLWCVPG---KPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELL-SAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQ---YVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILK----QRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFD---LVMIADGNL-VKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKV---------YCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSL--------LAQMSGLPPSYFSNLLNIDSIRIRNENATK-------------GMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGS----DNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDP----------------IY-HETR-YQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPTAAMSNPETSQMLSGDGDVLLTSDKPDDKDRLETLS-------MVIAVVDTMRRSSTQLSKDLNSIIEMAQFAYN 2934
            MS +YHP + +GL S++VP ++K + +   +Y     G  F +Y+   L L+ +SD L+  I       N L       +Y +  ++++  + + ++  N    +   E  +L  ++E     +W+ +  EV     F +K+  F + +++ P NYK K+L  S +G + L +    KL+Y F      +  ++Q+P  +V AIG   DGRV+  +L +D+ LM   QD G IT+I FR+                     D    + ++T    G++  W L      R++G++R+ H GSV +++C+PG      +V++  DN IKV  ++R DG+P  +  R GH +PP RI FWP       LL SAG+D  L +F+TF E    S+G AY P   P   + TR+Q   ++LP  + + ACS +   WD+V   H G R VT+W+F+K TRGQH+ +P        + + L+ ++ AT   +++CGN+ LIGYS+G + KFN+QSG+ERG Y   GS      AH  +I GLAV     + V I+    ++  W F      G L L +    +  H   D++AVA  + ++ L+ +    V   IR  ++      V     FD   LV    G+L VKT+D ++N+L+DCF+   PIT + ++  + FL +TH + LGIYLW  +  +  + L  LP+DF P+       +          C   +   + D       E M+   + + G HV +        L  +SG+P S+F+ LLN+D IR RN  A K              + +  FFLP V E   GL   D++               L  +QQF+  KT  TNRKR  L       +      L   L+RA S++E+D+   +LKS   S +D EI++L P                 Y H T  Y  L  FLR + N+ +   + ++  + L  LL  + D L    T A +N         + D +       D+ ++++LS       ++   + T R++ T L+  +   + +  F  N
Sbjct:    1 MSNIYHPYRVLGLCSSDVPFVVKYIPNSSAYYAIVPTGERFNIYKLPRLTLIGSSDPLEFPIKCFTSCGNVLVAASRETIYIFRNSRYL--LQRLQHHTNIITHLCSLENSFLVSVDEGGLTQVWNSKSWEVVSHIEFSTKA--FCVTSLINPINYKNKVLFGSYQGPLQLWDVISRKLIYWFKGFDSAVTCLQQAPAFDVCAIGLA-DGRVVTHNLKYDVTLMVFAQDGGAITSIGFRSGSHGLQNPTNVDEKGRITLLPDDNNDVYLITGCETGYINCWKLQNNGKSRSVGEARNLHWGSVITIYCIPGGDGASAMVTSGTDNCIKVSYFDRSDGSPRTIYRRIGHSRPPNRILFWPGSSAGGGLLLSAGKDGVLRIFSTFNEYMNKSLGCAYAPG-VPERRKTTRQQRLPWLLPDVVHMAACSTRAEAWDSVVAIHSGKRQVTSWNFAKATRGQHWFDPLKFHGCDDEANRLYKKTVATCAFLTNCGNYALIGYSNGDVFKFNMQSGLERGSY---GS----PTAHFCSIVGLAVNNV--NRVTITVGESEIRFWSFHEHKLRGQLDLPSTSLLVRFHADSDVLAVALSNAIIILVDIIHRKV---IRTFINSEVQLCVDMDISFDGRWLVSAHHGDLLVKTWDIVDNKLIDCFRVELPITSIALSRANEFLCTTHANCLGIYLWDNRATYKHLHLQPLPIDFVPSGNQSPVSLPTRILMTQNTCDVIELGMDTDISKYMDIEYMDDLSSEKCGEHVYISPEQLQCHLLTLSGIPSSFFTTLLNLDFIRQRNHQAGKLLNNNTATHSVAENLMNLPFFLP-VVETNKGLVSADDDFG-----------NGLSTKQQFIN-KT--TNRKRRGLLDKDFEHAVEPIHGLSMRLIRAKSNDEFDQISHVLKSVGTSGLDLEIRLLVPSAEDEMACCNPNQTKTFYDHVTNPYLKLHGFLRYIINRFQSNRDFDLACICLEILLQQHSDILFRR-THAQNNLLNVNQNLDEIDEMYLQIVEKDQVKVDSLSPYFVTLILINQAIKTKRKAQTNLTNCIAQSLCLVDFIRN 1035          
BLAST of WD repeat-containing protein 36 vs. TrEMBL
Match: A0A158QVA8 (Utp21 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS7573 PE=4 SV=1)

HSP 1 Score: 409.068 bits (1050), Expect = 1.296e-122
Identity = 308/992 (31.05%), Postives = 493/992 (49.70%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIE-GGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF-NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRND--------------IEE------HLIMLTATSNGHVAMWDLD-------TKRNIGQSRHCHEGSVASLWCVP---GKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELL-SAGRDSCLLVFNTFQESQQFSMGRAYVP--QHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHF----LFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIG-LLILDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN--LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQ-----------PTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPAN-------QNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGM--ASTE--FFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRA---ELASSQMI---GSDNLCSLL-----LRAASDEEYDKWIQLLKSFSPSAIDYEIQML------------------DPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIE 2724
            S ++ P +A+GL STNVP ++K      ++ +   +G  F VY+  NL LV  SD L  DI +I   K+ ++   E  +Y +   +HV+  +K E   +    ++   + YL   +E +  ++W+++  G+ F +  FP   + F I  I  P  Y  K+L+ S++G + L   +  K +Y F   G  +  + Q+P  +V AIG G +G+V++ +L +D+ L+ + QD G IT+IEFR+D              IE       ++ +LT + +GH++MW L+       T R + Q    H   + S++C+P       LV+N ADN +KV  ++RPDG P     R+GH  PP +I FW  G     LL S+G DS L +F+T+ E    ++GRAY P      +   V R  ++LP A  L     +   WD++A+ H   R VTTW+F K TRG+H+L+P     R      +  ++ AT   ++ CGNF++IGYSSG + KFNIQSG+E G +     GD    AH +A+ G+ V  T  + ++ S    ++  W+F SR+ I   L L +       H  GDM+A+A   G + L+ +    +F +  ++   +    +  S +  L++ A     L+K++D ++ RLVDCF+   P+T L ++P+D  L +TH   LG+YLWS K  +  + L  LP ++            PT++L AP+ +   +D      E         E  PAN       Q+G     L  +SGLP SYFS  L +D+I+ RN  A + +  A  E  FFLP + E   G+ WLDE+D       GTA              KT    RKRA   +++  +++   GS+ L S++     L   +D+  D+ +   +S +PSA+D EI++L                    +     Y  L AFL LL N+ RR  +V+     L  +L ++ D ++ 
Sbjct:    5 SSIFQPFRALGLASTNVPFVVKYKPHAKEYNILVPIGERFNVYQLPNLKLVGISDCLPGDIAAITSDKHFVYGAVENTIYAFRGLRHVA--FKLEGHSSPISHLLAFGDDYLASYDESSLFIVWNLKTKGKCFGK-AFPE--DTFCISAICHPSGYGDKLLLGSSQGPLQLWKTSSQKPIYWFKGFGSSVTCIVQTPAVDVCAIGLG-NGQVVLHNLRYDMSLVSVAQDGGAITSIEFRSDSSGITTSDVLKSAGIESLVEPTANIYLLTGSESGHLSMWQLENSEESGGTCRAVNQVEEFHLARITSMFCIPSGDAAGALVTNGADNCVKVSYFDRPDGGPRTGHIRSGHQLPPTKIAFWTGGSAGGNLLVSSGPDSQLRIFSTYNERYDKNLGRAYAPGMPSAKKLKVVDRIPWLLPGASALAVSPGRAHDWDSLAVVHSNRREVTTWNFIKATRGKHWLDPKKFHGRGGEALRIHKKTIATCLCMTRCGNFVVIGYSSGDIIKFNIQSGLEYGAF-----GDE--TAHNSAVVGVHV--TNVNRLLTSVGEAEVKFWNFASRELISEALTLPSPPRLSRFHEDGDMLAIALSIGEIILINVLTRRIFRRF-SNPPTHPCTDLTLSSDGTLMVTAHRGDPLIKSWDVVDCRLVDCFRVVHPVTSLALSPSDDVLATTHASCLGVYLWSNKAVYQKLHLKPLPSEYAPPLEPSSTASLPTESLTAPRQFDDAEDIYTGAGE---------EAAPANYVSPDQLQDG-----LMTLSGLPASYFSAFLQLDAIKKRNAEAIRVVDEAPVELPFFLPAI-ESTTGMVWLDEDDD-----LGTAT-------------KTEPKKRKRAGGKQVSLDEILLGGGSNILTSVIGDGNSLDLLNDDTCDEVMSRYRSLNPSALDAEIRLLVLPRDELVDALDAVDDNNVAVIAVNPYARLSAFLTLLLNRFRRNLDVDFATACLESVLRYHGDVIVR 947          
BLAST of WD repeat-containing protein 36 vs. TrEMBL
Match: A0A210QJD0 (WD repeat-containing protein 36 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08760 PE=4 SV=1)

HSP 1 Score: 404.445 bits (1038), Expect = 1.416e-121
Identity = 280/915 (30.60%), Postives = 473/915 (51.69%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF---NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSS-----ATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGR-QLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGNL-VKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTE--FFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPT 2733
            S ++   +A+G  S +VPL ++      D Y+ + VG  + VY  S L +V  SD   +DI  +      +FTGC+  +  Y+R K +S  Y+  +EK+  +++  GE  +L  ++E + + +WD++   V+ +  F + +  F + T+M P  Y  KIL+ S +GK+ L N   +K+LY+F   N G  I + +QSP  +V+AIG   DG++++ +L  D  +++  QD GP+T+I FR D   H +M+T ++ GH+A+WDL+ ++   Q R  H  SV  L CV  +PL++++++DNS+KVW  + PDG   LL  R+GH  PP R++ +  G     +LS G+DS +  F+T  +    S+GRA   +   R+  + ++++++P+     + S+++  WD +  CH G    TTWS+ + T GQH         +H  F+  +     A    IS CGNF +IGYSSGH+ K+N+QSGI RG Y     GD    AH+ ++ G+A+     + ++I+A G   +  W F  R  +  L L   I+ + LH    M+AV+  +  + ++ + T+ +V   +  S   N++  + FS +   ++ A  +  V+T+D    RLVDCF     +T L M+P   FLV+ H DD+G+YLWS    F  + L  LP DF+P  TL  P        +  + DE     ++L + +   Q       L  +S LP S + NLLN+D+IR RN+      A     FFLP V+ GL+  ++ ++E   D+S++                           ++    +     L  +L + A +  +D+ +Q++K   PSAID EI+ L+P    +  + +  FL  +   +    + E+   YL   +  +   +  +PT
Sbjct:    5 SKIFEGYRALGFVSNHVPLAVRYHQKHKDNYVVTCVGKSYHVYNVSKLGIVCVSDIHPDDINCLAVDSKFVFTGCKNVIRAYTRWKQLSFTYE-GHEKDIHMLLPFGE--HLVSVDEESTVKVWDVDAEVVYMEMKFNNST--FCVTTLMHPSTYLNKILLGSKQGKLQLWNIRTDKMLYMFDGWNAG--ITATEQSPAIDVVAIGLD-DGQIILHNLKFDETVIKFRQDWGPVTSIGFRTD--GHPVMVTGSAVGHMALWDLEERKLSSQIREAHSTSVTGLVCVASEPLIITSASDNSLKVWIMDLPDGGGRLLNQRSGHSAPPTRLRHY--GNDGKNILSTGQDSTMRSFSTIHDKHYKSLGRASYNKTETRKSGLKKDKHMMPSVTHFVSESSRQSDWDNIVACHRGLCTATTWSYQRSTMGQHRF-------KHDRFNGKTMHDVVAQAVDISPCGNFTVIGYSSGHVDKYNLQSGIHRGSY-----GDP--TAHDCSVRGVAI--DGLNQMLITAGGTGDIKFWKFKDRKLLKCLQLKNQISQICLHKESSMMAVSHDNFSIMIVDIDTKRVVRTFLGHS---NSITDMTFSTDSRWLITAAMDCSVRTWDMPTGRLVDCFAVDSAVTTLSMSPTGDFLVTAHVDDIGVYLWSNLTLFSHVPLRPLPADFEP-HTLSMPAT-SKQKPSGVDEDEEDPTEEDLTDFKSPQQISDE---LVTLSLLPNSRWQNLLNLDTIRRRNKPKEPPKAPKAAPFFLPTVA-GLE-FKFAEQEAEEDKSSS---------------------------KIIKGNLQPLSGLGKVLTQDAEEGSFDQTLQMMKKLGPSAIDIEIRSLEPDGGGS-LELVSCFLSFIGYVLTTRRDFELANAYLGLFIQVHGSLIAAEPT 853          
BLAST of WD repeat-containing protein 36 vs. TrEMBL
Match: A0A4E0R0U9 (WD repeat containing protein 36 OS=Fasciola hepatica OX=6192 GN=D915_008284 PE=4 SV=1)

HSP 1 Score: 404.831 bits (1039), Expect = 4.841e-121
Identity = 304/1049 (28.98%), Postives = 494/1049 (47.09%), Query Frame = 1
Query:   28 MSFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVS-KVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIE---------------------EHLIMLTATSNGHVAMWDLDT---KRNIGQSRHCHEGSVASLWCVPGKPL---LVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSEL-LSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVT---REQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRH----FLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHK--IRASLSPNAVAAV--AFSHE-FDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPT---KTLDAPKVYCXXXXXXXXXXXXX------------XXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTE----FFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHE-----------------TRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPTAAMSNPETSQMLSGDGDVLLTSDKPDDKDRLETLSMVIAVVDTMRRSSTQLSKDLNSIIEMAQFAYN 2934
            MS ++ P + +GL S++VP +++ +   +D+Y F  VG  F VY+   L LV+ SD L+  I +       ++      +Y +   + ++ +++K+ +   +  ++  G+  +L  ++E   LV+W +E  +V  +  F SK   F I  ++ P +Y+ KIL+ S +G + L N    K +Y F   G  +  + Q+P  ++ AIG   DG V + +L +DI L+    D G +T+I F+ D E                      +L +    + G ++ W L      R +G ++H H   + S++C+PG      LV+  ADN IKV  ++RPDG    +  R GH++PP RI FWP   +   L LSAG+DS + +F+TF +    S+GRAY P   P   + T   R  ++LP    ++ C+ +   WD+V   H   R  TTW+F   TRG+H+L+P     +      L+  + AT   I++CGN++LIGYS+G +  FN+QSG+E+G Y            H  A+ G+AV       V ++  G+++  W F  R+ +    L    T    H   D +AVA   G ++L  +T     H+  IR   +P+    V  AFS + F L+    G+ L+KT+D I+ RL+DCF+   PIT + ++P   FL +TH + LG+YLW     +  + L  L  D+ P    K +  P             +  +             +P+E+ E    N        L  +SGLP S+ + LLN+D+I  RN  A    A  +    FFLP V E   GL W+D+E             G+   Q    + +     R+  E + + +     L   L+RA SD ++D  ++ LKS  PSA+D EI++L P   +                 T    L  FLRLL N+ +R  +V++  +    +L    D L     + +S+  T++ L      LL+ +     D  ETL +V   V     S   L++ +N  I +  F  N
Sbjct:    1 MSNIFQPYRVVGLCSSDVPFIVRYAAHSNDYYAFVPVGENFNVYKLPRLTLVAISDNLNAPIKAFTSSAKYVYAASGNTIYAFRNMRFLACELHKHCHSITY--LLAFGQS-FLASVDESGLLVVWALETHDVVFEMQFDSKV--FRISCLLGPLSYRNKILLGSHQGALQLWNVQSQKQIYWFKGFGAAVTCLTQAPAVDLCAIGLA-DGSVYLHNLRYDITLLRFVHDGGAVTSITFKTDSEGLNNPCNVRPENELSILPSQQTNLYIAVGNAAGQLSCWQLKEDGESRPVGSTKHLHWDRIVSMFCIPGGESAGSLVTAGADNCIKVSCFDRPDGGLRTVFKRAGHFRPPNRICFWPGSSVGGSLILSAGQDSVMRIFSTFNQYMDKSLGRAYAPG-APDSRKATVDQRSAWLLPGCSKVSLCATRAADWDSVVAIHADRRQATTWNFVNATRGKHWLDPKKFVGKGGAAVRLYKHTVATAVCITNCGNYVLIGYSTGDVVLFNLQSGLEQGYY-------DKPSVHPGAVVGIAVNNVMH--VAVTVGGQEIRFWSFRKREMLHSEELPTVATQSLFHSDNDTLAVALSTGPIHLYDVT-----HRQLIRRFPNPDTQPCVDMAFSSDGFWLISAHRGDPLIKTWDIIHGRLIDCFRVSAPITSIALSPAGEFLATTHANCLGVYLWDNCGTYKRLHLQLLSDDYVPAVHKKPVAMPSRSIVTLFKDSSVENQSDTEDIEMHSVDQTSPKEVAESR-YNSPDQLADTLITLSGLPVSHLTGLLNLDTILERNRRAIAVRADKQQALPFFLP-VVETDKGLAWVDDEKDGGPK-------GEQSKQPNSTQSRVVTQKRRLEEDSLTALEPIPGLGVRLVRARSDLDFDDIMRTLKSLGPSALDLEIRLLGPSAEDELIAECALNASESTVLRTSRDRLHGFLRLLINRFQRNLDVDLACVCFELVLQRYGDLLFA--RSGVSSSGTTESLESHIRNLLSDEAKSGSDN-ETLRLVAQAVKVKSASQMLLARRVNRSICLVDFIRN 1016          
BLAST of WD repeat-containing protein 36 vs. Ensembl Cavefish
Match: wdr36 (WD repeat domain 36 [Source:NCBI gene;Acc:103045060])

HSP 1 Score: 365.155 bits (936), Expect = 6.195e-111
Identity = 266/909 (29.26%), Postives = 448/909 (49.28%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF-NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELME-IEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEE-YDKWIQLLKSFSPSAIDYEIQMLDP-IYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            S ++   +A+GLYS+++P +++      +FY+ +AVG  F  Y    L +VS S+ L EDI  +   +  ++      +  +++ + V   YK  ++ +  +++  G+  +L  +++ + ++IWD+E  + + Q  F   S  F +  +M P  Y  KIL  S++G + L N   NKLL+ F      +  ++Q+P  +V+ IG    G++++ ++  +  LM+  QD GPITA+ FR D   H +M   +  GH+ +WDL+ K+ IGQ R  H  ++A L  +  +PLL+SN ADN+I+VW ++ P G   LLR R GH  PP +++ +        +LSAG+D  L  F+T  E    S+GR  + +   ++  V  +   LP      + SA++  WD +  CH+G    TTW++ K + G H LEP    +   L     AT   ISSCGNF ++  SSGH+  +NIQSG  RG +  +        AH   + G+AV       VV + A R L  W F S++ +    L +   S  LH    M+A+A  D  +++L + TR  V    R       V  + FS +   +++A  +  ++T+D  +  LV+CF        +  +P   FL S+H D LGIYLWS       + L  LP D++P+  +  P   C   D  + + +      E+ E + PA  +      L  +S LP S + NLLN+D I+ RN  +   K   +  FF+P +  GL                             QF +++T   + +++++ +  M+   +   L L  A +   Y+  +Q LK   PSAID E++ L P +  + R   +Q+FL+++   +    + ++ Q YLA  L  ++  + E P
Sbjct:    9 SSIFSGFRALGLYSSHLPHVVRFHKKHREFYVVTAVGQCFHTYNVKKLGIVSVSNALSEDISCLAADRMLVYAAYGKVISAFAKNREVVHTYK-GHQADVHLLLPFGD--HLISVDKESVVIIWDVESEDTYLQISFDKAS--FEVSAVMHPSTYLNKILFGSSQGSLQLWNVKSNKLLFTFPGWACAVTVLQQTPAVDVVGIGLA-SGQIIIHNIKFNETLMKFQQDWGPITALSFRTD--GHPVMAAGSPVGHIGLWDLEEKKLIGQMRDAHTTAIAGLTFLHSEPLLISNGADNAIRVWIFDTPGGEGRLLRFRMGHSAPPTKVQHYDLS--GQHILSAGQDGTLQSFSTVHERFNKSLGRGSLNKAKSKKKSVLYDTAKLPPITTFASESARQSDWDGIVACHQGFLVTTTWNYQKGSMGAHKLEPERFNKNRAL--NVHATAVDISSCGNFAVVALSSGHIDAYNIQSGFHRGQFGKDS-------AHSGPVRGVAV-DGLNELVVSAGADRLLKIWKFKSKELLHTDSLPSSPASTLLHRDSGMLAIALDDFTISILDMETRRTVR---RFCGQRGQVNDMTFSPDGRWLIVASMDCTIRTWDLPSGSLVNCFLVDSAAVSISFSPTGNFLASSHVDCLGIYLWSNNTLCSLVSLCPLPADYEPSVVM-LPGT-CPSKDDEEVDTDVESL--EMAEYVSPAQLD----EQLITLSLLPESRWKNLLNLDIIKKRNKPKEPPKVPKAAPFFIPTI-PGL---------------------------VPQFGQVET--PSEEQSKVVNLGMLAQKSSFYLQLEGALETNLYEGAVQFLKELGPSAIDTELRSLAPDMGGDIRV--MQSFLKMIGTMLHLKKDFDLAQAYLALFLKLHLQLIAEQP 854          
BLAST of WD repeat-containing protein 36 vs. Ensembl Cavefish
Match: wdr36 (WD repeat domain 36 [Source:NCBI gene;Acc:103045060])

HSP 1 Score: 361.303 bits (926), Expect = 8.366e-110
Identity = 264/899 (29.37%), Postives = 443/899 (49.28%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF-NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELME-IEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEE-YDKWIQLLKSFSPSAIDYEIQMLDP-IYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLN 2700
            S ++   +A+GLYS+++P +++      +FY+ +AVG  F  Y    L +VS S+ L EDI  +   +  ++      +  +++ + V   YK  ++ +  +++  G+  +L  +++ + ++IWD+E  + + Q  F   S  F +  +M P  Y  KIL  S++G + L N   NKLL+ F      +  ++Q+P  +V+ IG    G++++ ++  +  LM+  QD GPITA+ FR D   H +M   +  GH+ +WDL+ K+ IGQ R  H  ++A L  +  +PLL+SN ADN+I+VW ++ P G   LLR R GH  PP +++ +        +LSAG+D  L  F+T  E    S+GR  + +   ++  V  +   LP      + SA++  WD +  CH+G    TTW++ K + G H LEP    +   L     AT   ISSCGNF ++  SSGH+  +NIQSG  RG +  +        AH   + G+AV       VV + A R L  W F S++ +    L +   S  LH    M+A+A  D  +++L + TR  V    R       V  + FS +   +++A  +  ++T+D  +  LV+CF        +  +P   FL S+H D LGIYLWS       + L  LP D++P+  +  P   C   D  + + +      E+ E + PA  +      L  +S LP S + NLLN+D I+ RN  +   K   +  FF+P +  GL                             QF +++T   + +++++ +  M+   +   L L  A +   Y+  +Q LK   PSAID E++ L P +  + R   +Q+FL+++   +    + ++ Q YLA  L 
Sbjct:    9 SSIFSGFRALGLYSSHLPHVVRFHKKHREFYVVTAVGQCFHTYNVKKLGIVSVSNALSEDISCLAADRMLVYAAYGKVISAFAKNREVVHTYK-GHQADVHLLLPFGD--HLISVDKESVVIIWDVESEDTYLQISFDKAS--FEVSAVMHPSTYLNKILFGSSQGSLQLWNVKSNKLLFTFPGWACAVTVLQQTPAVDVVGIGLA-SGQIIIHNIKFNETLMKFQQDWGPITALSFRTD--GHPVMAAGSPVGHIGLWDLEEKKLIGQMRDAHTTAIAGLTFLHSEPLLISNGADNAIRVWIFDTPGGEGRLLRFRMGHSAPPTKVQHYDLS--GQHILSAGQDGTLQSFSTVHERFNKSLGRGSLNKAKSKKKSVLYDTAKLPPITTFASESARQSDWDGIVACHQGFLVTTTWNYQKGSMGAHKLEPERFNKNRAL--NVHATAVDISSCGNFAVVALSSGHIDAYNIQSGFHRGQFGKDS-------AHSGPVRGVAV-DGLNELVVSAGADRLLKIWKFKSKELLHTDSLPSSPASTLLHRDSGMLAIALDDFTISILDMETRRTVR---RFCGQRGQVNDMTFSPDGRWLIVASMDCTIRTWDLPSGSLVNCFLVDSAAVSISFSPTGNFLASSHVDCLGIYLWSNNTLCSLVSLCPLPADYEPSVVM-LPGT-CPSKDDEEVDTDVESL--EMAEYVSPAQLD----EQLITLSLLPESRWKNLLNLDIIKKRNKPKEPPKVPKAAPFFIPTI-PGL---------------------------VPQFGQVET--PSEEQSKVVNLGMLAQKSSFYLQLEGALETNLYEGAVQFLKELGPSAIDTELRSLAPDMGGDIRV--MQSFLKMIGTMLHLKKDFDLAQAYLALFLK 844          
BLAST of WD repeat-containing protein 36 vs. Ensembl Cavefish
Match: wdr36 (WD repeat domain 36 [Source:NCBI gene;Acc:103045060])

HSP 1 Score: 346.28 bits (887), Expect = 4.128e-104
Identity = 262/909 (28.82%), Postives = 447/909 (49.17%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF-NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCA-ISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN-LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEE-YDKWIQLLKSFSPSAIDYEIQMLDP-IYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            S ++   +A+GLYS+++P +++      +FY+ +AVG  F  Y        + S + ++DI  +   +  ++      +  +++ + V   YK  ++ +  +++  G+  +L  +++ + ++IWD+E  + + Q  F   S  F +  +M P  Y  KIL  S++G + L N   NKLL+ F      +  ++Q+P  +V+ IG    G++++ ++  +  LM+  QD GPITA+ FR D   H +M   +  GH+ +WDL+ K+ IGQ R  H  ++A L  +  +PLL+SN ADN+I+VW ++ P G   LLR R GH  PP +++ +        +LSAG+D  L  F+T  E    S+GR  + +   ++  V  +   LP      + SA++  WD +  CH+G    TTW++ K + G H LEP    +R   F+++ A     ISSCGNF ++  SSGH+  +NIQSG  RG +  +        AH   + G+AV       VV + A R L  W F S++ +    L +   S  LH    M+A+A  D  +++L + TR  V    R       V  + FS +   +++A  +  ++T+D  +  LV+CF        +  +P   FL S+H D LGIYLWS       + L  LP D++P+  +  P   C  DD   + D  +    E   + PA  +      L  +S LP S + NLLN+D I+ RN  +   K   +  FF+P +     GL                          QF +++T   + +++++ +  M+   +   L L  A +   Y+  +Q LK   PSAID E++ L P +  + R   +Q+FL+++   +    + ++ Q YLA  L  ++  + E P
Sbjct:    9 SSIFSGFRALGLYSSHLPHVVRFHKKHREFYVVTAVGQCFHTY--------NVSPRGNQDISCLAADRMLVYAAYGKVISAFAKNREVVHTYK-GHQADVHLLLPFGD--HLISVDKESVVIIWDVESEDTYLQISFDKAS--FEVSAVMHPSTYLNKILFGSSQGSLQLWNVKSNKLLFTFPGWACAVTVLQQTPAVDVVGIGLA-SGQIIIHNIKFNETLMKFQQDWGPITALSFRTD--GHPVMAAGSPVGHIGLWDLEEKKLIGQMRDAHTTAIAGLTFLHSEPLLISNGADNAIRVWIFDTPGGEGRLLRFRMGHSAPPTKVQHYDLS--GQHILSAGQDGTLQSFSTVHERFNKSLGRGSLNKAKSKKKSVLYDTAKLPPITTFASESARQSDWDGIVACHQGFLVTTTWNYQKGSMGAHKLEP----ER---FNKNRALNAVDISSCGNFAVVALSSGHIDAYNIQSGFHRGQFGKDS-------AHSGPVRGVAV-DGLNELVVSAGADRLLKIWKFKSKELLHTDSLPSSPASTLLHRDSGMLAIALDDFTISILDMETRRTVR---RFCGQRGQVNDMTFSPDGRWLIVASMDCTIRTWDLPSGSLVNCFLVDSAAVSISFSPTGNFLASSHVDCLGIYLWSNNTLCSLVSLCPLPADYEPSVVM-LPGT-CPTDDEEVDTDVESLEMAEY--VSPAQLD----EQLITLSLLPESRWKNLLNLDIIKKRNKPKEPPKVPKAAPFFIPTIP----GLV------------------------PQFGQVET--PSEEQSKVVNLGMLAQKSSFYLQLEGALETNLYEGAVQFLKELGPSAIDTELRSLAPDMGGDIRV--MQSFLKMIGTMLHLKKDFDLAQAYLALFLKLHLQLIAEQP 841          
BLAST of WD repeat-containing protein 36 vs. Ensembl Cavefish
Match: wdr36 (WD repeat domain 36 [Source:NCBI gene;Acc:103045060])

HSP 1 Score: 308.531 bits (789), Expect = 2.112e-90
Identity = 244/915 (26.67%), Postives = 423/915 (46.23%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVF-NIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIA-DGNLVKTFDYINNRLVDCFKTRR-PITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLD------MKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELME-IEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMA--STEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEE-YDKWIQLLKSFSPSAIDYEIQMLDP-IYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDP 2730
            S ++   +A+GLYS+++P +++      +FY+ +AVG  F  Y    L +VS S+ L EDI  +   +  ++      +  +++ + V   YK  ++ +  +++  G+  +L  +++ + ++IWD+E  + + Q  F   S  F +  +M P  Y  KIL  S++G + L N   NKLL+ F      +  ++Q+P  +V+ IG    G++++ ++  +  LM+  QD GPITA+ FR D   H +M   +  GH+ +WDL+ K+ IGQ R  H  ++A L  +  +PLL+SN ADN+I+VW ++ P G   LLR R GH  PP +++ +        +LSAG+D  L  F+T  E    S+GR  + +   ++  V  +   LP      + SA++  WD +  CH+G    TTW++ K + G H LEP    +   L     AT   ISSCGNF ++  SSGH+  +NIQSG  RG +  +        AH   + G+AV                         D +  L++ A                    G   LL++ +F     +     P++ A+     +  ++ IA D   +   D    R V  F  +R  +  +  +P+  +L+    D   I  W L     +      + L  LP D++P+  +  P   C   D  + + +      E+ E + PA  +      L  +S LP S + NLLN+D I+ RN+         +  FF+P +     GL                          QF +++T   + +++++ +  M+   +   L L  A +   Y+  +Q LK   PSAID E++ L P +  + R   +Q+FL+++   +    + ++ Q YLA  L  ++  + E P
Sbjct:    9 SSIFSGFRALGLYSSHLPHVVRFHKKHREFYVVTAVGQCFHTYNVKKLGIVSVSNALSEDISCLAADRMLVYAAYGKVISAFAKNREVVHTYK-GHQADVHLLLPFGD--HLISVDKESVVIIWDVESEDTYLQISFDKAS--FEVSAVMHPSTYLNKILFGSSQGSLQLWNVKSNKLLFTFPGWACAVTVLQQTPAVDVVGIGLA-SGQIIIHNIKFNETLMKFQQDWGPITALSFRTD--GHPVMAAGSPVGHIGLWDLEEKKLIGQMRDAHTTAIAGLTFLHSEPLLISNGADNAIRVWIFDTPGGEGRLLRFRMGHSAPPTKVQHYDLS--GQHILSAGQDGTLQSFSTVHERFNKSLGRGSLNKAKSKKKSVLYDTAKLPPITTFASESARQSDWDGIVACHQGFLVTTTWNYQKGSMGAHKLEPERFNKNRAL--NVHATAVDISSCGNFAVVALSSGHIDAYNIQSGFHRGQFGKDS-------AHSGPVRGVAV-------------------------DGLNELVVSA--------------------GADRLLKIWKFKSKELLHTDSLPSSPASTLLHRDSGMLAIALDDFTISILDMETRRTVRRFCGQRGQVNDMTFSPDGRWLIVASMD-CTIRTWDLPSGRSNNTLCSLVSLCPLPADYEPSVVM-LPGT-CPSKDDEEVDTDVESL--EMAEYVSPAQLD----EQLITLSLLPESRWKNLLNLDIIKKRNKPKEPPKVPKAAPFFIPTIP----GLV------------------------PQFGQVETP--SEEQSKVVNLGMLAQKSSFYLQLEGALETNLYEGAVQFLKELGPSAIDTELRSLAPDMGGDIRV--MQSFLKMIGTMLHLKKDFDLAQAYLALFLKLHLQLIAEQP 818          
BLAST of WD repeat-containing protein 36 vs. Ensembl Sea Lamprey
Match: wdr36 (WD repeat domain 36 [Source:ZFIN;Acc:ZDB-GENE-030131-464])

HSP 1 Score: 285.419 bits (729), Expect = 6.132e-83
Identity = 193/629 (30.68%), Postives = 309/629 (49.13%), Query Frame = 1
Query:  163 SNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLA---VGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNA--VAAVAFSHEFDLVMIADGNL-VKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQP 2028
            + LA+VS S+ L EDI  +   +   F    + +   +R K V   Y   + +   +++ LG+  +L  ++  N LV+WD++  E + +       + F I  +M P  Y  K+L+ S +G + L N    KLL+ F     E+  ++Q+P  +V+ +G    G V + ++  D  LM+ HQD GP+T I FR D     +M T +S GH+A+WDL  ++ + Q R  H  +VA    +  +PLL++ + DN+IKVW +E   G+P LLR R GH  PP  I+    G     +LSAG+D  L  F+   +    S+GR  + +   ++  +  +   LP      + +A++  WD +  CH G   V+TWSF + + G H LEP  +K+       ++AT   +S CGNF +IG SSGH+  +N+QSG+ RG +   GS      AH   +  +A   +GQ A S          L  W F SR  +   +L A      LH    ++AV   D    L  L   +   KI   L+ +   +    FS +   ++ A  +  V+T+D  +   +D      P+  L M+P   +L +   D LGIYLWS +  +  + L  LP D++P
Sbjct:    2 NKLAIVSISNALPEDISCLAANRMLAFAAYGSKIATIARGKEVVHTYDGHSGEV-HLLLPLGD--HLVSVDRDNILVVWDVQTEEEYLRL--EPDPQVFGISAVMHPSTYMNKVLLGSRQGPLQLWNLKTGKLLFTFKGWASEVTCLQQAPAVDVVGVGLQ-SGSVFLHNIKVDETLMKFHQDWGPVTCISFRTDGPA--VMATGSSLGHIALWDLHDRKLLAQMRDTHAAAVAGATFIHNEPLLLTTAGDNAIKVWVFESAGGSPRLLRERCGHSAPPTSIRH--HGQDGFNILSAGQDGTLQSFSVVHDRFNKSLGRGSINKKKSKKKGLKLDTMKLPPICAFASETARQSDWDGIVSCHRGFVSVSTWSFLRGSMGSHRLEPEGMKRDR--TDPTTATAVTVSPCGNFAIIGLSSGHVNVYNLQSGLPRGSF---GS----PTAHGGPVRAVALDLLGQMAVSV----GGDLALRVWGFKSRALLHETLLPAAPGGAILHRDSGLLAVWCDD----LSVLVFDVEIKKIVRVLNGHGAQITDATFSPDGRWLLTASMDRSVRTWDLPSGWYIDVLAVSSPVVSLSMSPTGDYLATALSDHLGIYLWSNRSMYTHVSLRPLPADYEP 603          
BLAST of WD repeat-containing protein 36 vs. Ensembl Yeast
Match: UTP21 (Subunit of U3-containing 90S preribosome and SSU processome complexes; involved in production of 18S rRNA and assembly of small ribosomal subunit; synthetic defect with STI1 Hsp90 cochaperone; human homolog linked to glaucoma; Small Subunit processome is also known as SSU processome [Source:SGD;Acc:S000004401])

HSP 1 Score: 186.037 bits (471), Expect = 9.070e-49
Identity = 223/891 (25.03%), Postives = 389/891 (43.66%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDK-LDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIW------DIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHE---GSVASLWCVPGKPLLVSNSADNSIK--VWNYERPDGT-------PLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMG-RAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGD-GLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIAD-GNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSL------LAQMSGLPPSYFSNLLNIDSIRIRN--ENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGT---------AAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASD-EEYDKWIQLLKSFSPSAIDYEIQMLD 2580
            S ++ P + IG  S  VP    ++G   FY+ + VG  F +Y  + L L+  S+K     I+++  + + ++   E  V  Y R      + + E + N   + + G+  YLC   + N + I+      D    E + + L  ++ +   I ++     Y  K+ V  TK  + L N    KL++  N    +I + + +P+ ++IA+G    G V+M ++     +  +      I+++ FR D   HL +   TS+G +  +DLD +  I   ++ H    G V     + G+P++V++  DNS+K  V++     G+       P  LRSR GH +PP+ I F      S  +LSA +D  L  F+  +++Q   M  R +  Q G R    T +    P  + L   +A+   W+ +   H+  +   TW    +  G+   +        F+ S       A+S CGNF  IG S+G +  +N+QSGI R  Y          + H+ A++G+++       V     G  +  +DF     +G L LDA IT++  H S D+ A+A  D  +V +  +T+ +V      S   N + A  FS E   ++ A   + ++T+D      +D        T ++ +PN   L +TH    GI +W+ +  F    +S   +D      +  P      +D+       +   ++L +I+       + SL      L  +S  P S  + LL++D IR R+  + A K      FFL      L G +  DE    +  A  T          A  +LDA++Q  + K T              +G ++  +  LR  S  ++Y   +  L +FSP+A+D EI+ L+
Sbjct:   21 SKIFSPFRIIGNVSNGVPFATGTLGST-FYIVTCVGKTFQIYDANTLHLLFVSEKETPSSIVALSAHFHYVYAAYENKVGIYKRGIE-EHLLELETDANVEHLCIFGD--YLCASTDDNSIFIYKKSDPQDKYPSEFYTK-LTVTEIQGGEIVSLQHLATYLNKLTVV-TKSNVLLFNVRTGKLVFTSNEFPDQITTAEPAPVLDIIALGTV-TGEVIMFNMRKGKRIRTIKIPQSRISSLSFRTDGSSHLSV--GTSSGDLIFYDLDRRSRIHVLKNIHRESYGGVTQATFLNGQPIIVTSGGDNSLKEYVFDPSLSQGSGDVVVQPPRYLRSRGGHSQPPSYIAF--ADSQSHFMLSASKDRSLWSFSLRKDAQSQEMSQRLHKKQDGGRVGGSTIKSK-FPEIVALAIENARIGEWENIITAHKDEKFARTWDMRNKRVGRWTFDTT---DDGFVKS------VAMSQCGNFGFIGSSNGSITIYNMQSGILRKKY----------KLHKRAVTGISLDGMNRKMVSCGLDG-IVGFYDFNKSTLLGKLKLDAPITAMVYHRSSDLFALALDDLSIVVIDAVTQRVVRQLWGHS---NRITAFDFSPEGRWIVSASLDSTIRTWDLPTGGCIDGIIVDNVATNVKFSPNGDLLATTHVTGNGICIWTNRAQF--KTVSTRTIDESEFARMALPSTSVRGNDSMLSGALESNGGEDLNDIDFNT----YTSLEQIDKELLTLSIGPRSKMNTLLHLDVIRKRSKPKEAPKKSEKLPFFLQ-----LSGEKVGDEASVREGIAHETPEEIHRRDQEAQKKLDAEEQMNKFKVTG------------RLGFESHFTKQLREGSQSKDYSSLLATLINFSPAAVDLEIRSLN 853          
BLAST of WD repeat-containing protein 36 vs. Ensembl Nematostella
Match: EDO46560 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPT3])

HSP 1 Score: 58.5362 bits (140), Expect = 4.481e-9
Identity = 56/197 (28.43%), Postives = 94/197 (47.72%), Query Frame = 1
Query:  499 KIL-VASTKGKMHLINYAKNKLLYVFNI-GQEIMSMKQSPMDNVIAIGCGG-DGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFN 1080
            KIL   S  GK++LIN    K     +  G+  MS+  SP  + IA  CG  DG + + DL  + +L  L     PI ++ F  D +   +++TA+ +GH+ M+D+    N+  +   H   V S+   P     VS+S+D ++KVW+     GT     +   H      +K+   G   S ++S   D  ++V++
Sbjct:  116 KILATGSHSGKVNLINLELGKKESSLDTRGKFTMSLAYSPDGHYIA--CGAIDGIINIFDLTTNKLLHTLEGHAMPIRSLTFSPDSQ---LLITASDDGHIKMYDVQ-HANLAGTLSGHSSWVLSVAFCPDNTHFVSSSSDKTVKVWDA----GTRRCTHTFYEHTDQVWGVKYNATG---SRIVSVSDDRSIIVYD 299          
BLAST of WD repeat-containing protein 36 vs. Ensembl Nematostella
Match: EDO45665 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS02])

HSP 1 Score: 50.0618 bits (118), Expect = 5.368e-6
Identity = 42/165 (25.45%), Postives = 75/165 (45.45%), Query Frame = 1
Query:  598 MKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADN-SIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQ 1089
            +  SP  N IA G G DG+V + + +     +  H+    +TA+ F  + +   ++L+A+ +G V  +DL+  RN            ++L       ++ + S D   I VW+ +    T  LL    GH  P + + F P  P+   L+S   D  + ++N F+
Sbjct:  344 LAYSPDGNYIATG-GDDGKVKLWNTMTGFCFVTFHEHSASVTAVTFSPNGQ---VVLSASLDGTVRAFDLNRYRNFRTFASPRPAQFSTLALDSSGEVVAAGSRDTFEIFVWSIQ----TGRLLEVLAGHEAPVSSLAFSPSHPV---LISGAWDKTVRLWNVFE 497          
BLAST of WD repeat-containing protein 36 vs. Ensembl Medaka
Match: wdr36 (WD repeat domain 36 [Source:NCBI gene;Acc:101173836])

HSP 1 Score: 333.954 bits (855), Expect = 1.595e-99
Identity = 258/862 (29.93%), Postives = 409/862 (47.45%), Query Frame = 1
Query:   31 SFLYHPLKAIGLYSTNVPLLIK-SVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKN-WRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFN-IGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYV--PQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQL-TRFIV--FHKIRASLSPNAVAAVAFSHEFD-LVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELME--IEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNE--NATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQML 2577
            S L+   + +GLYS +VP   +      +FYL +A G  F  +  + L +V+ S+ L +DI  +   +  +F      +  +SR K V  V +Y   K   ++++ LG++  L   +    +++WD++GG V+ Q  F   S  F +  IM P  Y  K+L+ S++G + L N   +KLLY F      + +++QSP  +V+ +G    GR+++ ++  D  LM   QD GP+ ++ FR D     I+ + +  GH+A WDL+ ++   Q RH H  +VA    + G+PLLV+N ADN+IKVW +++  G   LLRSR GH  PP  I+    G     +LSAG+D  L  F+T  E    ++G   V   +   ++  ++ E+  LPA    ++   ++  WD +  CH G    TTWS+ + T G H+L+P   K+  F      A+   I++CGNF +IG S G +  +N+QSG+ RG +   G      +AH+  + GL+V      T  I A+   L  W F ++    +L L +   +L LH    M+A+A  D  + ++ + TR  V  F   R +     V  + FS +   LV +A    ++T+D  +  LVDCF        + M+P   FL + H D LG++LW+ K     + L  LP D+QP +    P +           DE  E P E  +   + A Q G     L  +S LP S + +LL++D I+ RN          S  FFLP     L GL                          +F    T D++ +   L    +       S L  A     YD  ++LLK   P+A+  EI  L
Sbjct:    6 SSLFSGFRVLGLYSNHVPHAFRYHAKHREFYLVTASGQRFHTFNVNRLGIVAVSNSLQDDITCLAADRMLVFAATGRLICSFSRNKEV--VMRYHGHKQEVQLLLPLGDQ--LISSDCGGEVIVWDVQGGHVYLQLKFDPLS--FAVSAIMHPSTYLNKVLLGSSQGALQLWNIKSSKLLYTFTGWSAGVTALQQSPAVDVVGVGTA-TGRIIIHNIRLDETLMSFTQDWGPVCSLSFRTDGPP--IVASGSPQGHIAFWDLERRQLAAQQRHAHRTAVAGATFLHGEPLLVTNGADNAIKVWIFDQEGGGARLLRSRQGHSAPPIVIRH--HGNDGKNILSAGQDGTLQSFSTVHERFNKNLGHGSVCKKKEKKKKKGLSYEELRLPAITAFSSAVTRQSEWDGIVACHRGRLAATTWSYYRSTMGAHHLQPPGAKRGSF------ASAVDITACGNFAVIGSSCGRIDVYNLQSGLHRGCFGDGG------KAHDGTVRGLSVDALNHMTFSI-ASDSLLKFWRFKTKKQEDVLQLSSVPGTLKLHRESGMLALAFDDFTLAIVDIETRRTVRKFAGHRGN-----VNDMTFSPDGRWLVTVAMDCTIRTWDLPSGSLVDCFLVAVAPVSVSMSPTGDFLATAHVDHLGVFLWTNKSLCGPVGLRPLPADYQPAEE-TIPGI--------TAEDEDLEVPSEEADDVYQSAEQLGAE---LVTLSLLPESRWKSLLHLDDIKRRNRPTAPPTPPPSAPFFLPT----LPGL------------------------TPRFSLPATADSDAQSKVLPLGLLAQRSEFGSALESAQQSGSYDPPLRLLKDLGPAALSVEITCL 798          
BLAST of WD repeat-containing protein 36 vs. Planmine SMEST
Match: SMESG000037091.1 (SMESG000037091.1)

HSP 1 Score: 1968.36 bits (5098), Expect = 0.000e+0
Identity = 959/971 (98.76%), Postives = 965/971 (99.38%), Query Frame = 1
Query:   28 MSFLYHPLKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFNIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCXXXXXXXXXXXXXXXPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIEDPTAAMSNPETSQMLSGDGDVLLTSDKPDDKDRLETLSMVIAVVDTMRRSSTQLSKDLNSIIEMAQFAYNNL 2940
            MSFLYH LKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHV KVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFNIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWN+ERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQE+QQFSMGRAYVP HGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLL+LDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCADDDAADENDEGAEAPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAEL SSQMIGSDNLCSLLLRAASDEEYDK IQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCL+EDPT+AMSNPETSQ LSGDGDVLLTSDKPDDKDRLETL+MVIAVVDTMRRSSTQLSKDLNSIIEMAQFAYNNL
Sbjct:    1 MSFLYHALKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLALVSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVFKVYKYENEKNWRIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIMQPRNYKFKILVASTKGKMHLINYAKNKLLYVFNIGQEIMSMKQSPMDNVIAIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTATSNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKVWNFERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVFNTFQENQQFSMGRAYVPHHGPREDRVTREQYVLPAALDLTACSAKEFCWDTVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAISSCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLAVGQTATSTVVISAAGRQLACWDFVSRDNIGLLVLDADITSLTLHPSGDMVAVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGNLVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLKLHFLDMKLSGLPLDFQPTKTLDAPKVYCADDDAADENDEGAEAPQELMEIEPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFFLPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRKRAELTSSQMIGSDNLCSLLLRAASDEEYDKCIQLLKSFSPSAIDYEIQMLDPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLVEDPTSAMSNPETSQTLSGDGDVLLTSDKPDDKDRLETLAMVIAVVDTMRRSSTQLSKDLNSIIEMAQFAYNNL 971          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 36 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
WDR364.661e-10029.18WD repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR364.449e-9929.18WD repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:3... [more]
WDR364.449e-9929.18WD repeat domain 36 [Source:HGNC Symbol;Acc:HGNC:3... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Y45F10D.74.310e-6126.12pep chromosome:WBcel235:IV:13789085:13796224:1 gen... [more]
Y45F10D.74.310e-6126.12pep chromosome:WBcel235:IV:13788936:13796223:1 gen... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG97991.279e-9829.64gene:FBgn0038146 transcript:FBtr0082763[more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr361.137e-10127.92WD repeat domain 36 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfatc17.037e-11330.34nuclear factor of activated T cells 1 [Source:Xenb... [more]
nfatc11.102e-11230.61nuclear factor of activated T cells 1 [Source:Xenb... [more]
nfatc18.904e-11030.23nuclear factor of activated T cells 1 [Source:Xenb... [more]
nfatc12.962e-10930.13nuclear factor of activated T cells 1 [Source:Xenb... [more]
nfatc12.178e-10530.56nuclear factor of activated T cells 1 [Source:Xenb... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Wdr362.414e-10230.09WD repeat domain 36 [Source:MGI Symbol;Acc:MGI:191... [more]
Wdr363.954e-10230.09WD repeat domain 36 [Source:MGI Symbol;Acc:MGI:191... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q8NI36|WDR36_HUMAN2.136e-9829.18WD repeat-containing protein 36 OS=Homo sapiens OX... [more]
sp|O14053|UTP21_SCHPO1.268e-7126.56U3 small nucleolar RNA-associated protein 21 homol... [more]
sp|Q06078|UTP21_YEAST6.298e-4725.03U3 small nucleolar RNA-associated protein 21 OS=Sa... [more]
sp|Q6P5M2|WDR61_DANRE1.724e-723.23WD repeat-containing protein 61 OS=Danio rerio OX=... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023ZS890.000e+0100.00WD repeat-containing protein 36 (Fragment) OS=Schm... [more]
A0A5K4F2V56.828e-12429.47Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A158QVA81.296e-12231.05Utp21 domain-containing protein OS=Mesocestoides c... [more]
A0A210QJD01.416e-12130.60WD repeat-containing protein 36 OS=Mizuhopecten ye... [more]
A0A4E0R0U94.841e-12128.98WD repeat containing protein 36 OS=Fasciola hepati... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
wdr366.195e-11129.26WD repeat domain 36 [Source:NCBI gene;Acc:10304506... [more]
wdr368.366e-11029.37WD repeat domain 36 [Source:NCBI gene;Acc:10304506... [more]
wdr364.128e-10428.82WD repeat domain 36 [Source:NCBI gene;Acc:10304506... [more]
wdr362.112e-9026.67WD repeat domain 36 [Source:NCBI gene;Acc:10304506... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr366.132e-8330.68WD repeat domain 36 [Source:ZFIN;Acc:ZDB-GENE-0301... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
UTP219.070e-4925.03Subunit of U3-containing 90S preribosome and SSU p... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO465604.481e-928.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456655.368e-625.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
wdr361.595e-9929.93WD repeat domain 36 [Source:NCBI gene;Acc:10117383... [more]
back to top
BLAST of WD repeat-containing protein 36 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000037091.10.000e+098.76SMESG000037091.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30025781
GenBankAHY82404.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30025781 ID=SMED30025781|Name=WD repeat-containing protein 36|organism=Schmidtea mediterranea sexual|type=transcript|length=2985bp
ATTTTTATTTAATCGAACGTGAATTTTATGTCTTTTTTATATCATCCTTT
GAAAGCGATTGGCTTGTATTCTACAAATGTACCTTTGCTCATCAAATCTG
TCGGAGATGATGATTTCTATTTATTTTCTGCCGTAGGATGTTATTTCGTT
GTTTATCGATTTTCAAATCTAGCATTAGTTAGCACAAGTGATAAATTAGA
CGAAGATATACTATCTATTGATGGATATAAAAATAAATTATTCACTGGTT
GTGAAACCAATGTTTATGGATATTCTCGAGCAAAACATGTGTCTAAAGTG
TACAAATATGAAAATGAAAAGAATTGGAGAATTATTGTAGTTCTCGGTGA
AGAGGGATATCTGTGTGGAATAAATGAATGTAATCGATTAGTCATATGGG
ACATTGAAGGTGGAGAAGTATTTTGCCAGTTTCTGTTTCCATCGAAAAGC
GAGGAATTCATTATAAAAACAATAATGCAGCCAAGAAATTATAAATTTAA
GATCCTTGTTGCCAGTACGAAAGGAAAAATGCATTTGATAAATTATGCCA
AGAACAAATTGCTATATGTATTCAACATTGGTCAGGAGATAATGTCAATG
AAGCAGTCGCCTATGGATAATGTAATTGCCATTGGATGCGGAGGTGACGG
CCGAGTGTTGATGCTGGATTTAGTGCATGACATTGTGTTAATGGAATTGC
ATCAAGATCTGGGTCCAATCACCGCGATCGAGTTCAGGAATGATATCGAG
GAGCACCTGATCATGCTGACTGCCACTAGCAACGGCCACGTGGCCATGTG
GGATCTCGACACCAAGCGCAATATCGGCCAATCAAGACATTGCCACGAGG
GCTCAGTGGCCTCTCTGTGGTGCGTGCCCGGTAAACCGTTGCTCGTATCG
AATTCCGCGGACAACAGCATCAAAGTGTGGAATTACGAGCGGCCCGATGG
GACGCCGCTGCTGTTGCGCAGTAGAAACGGGCATTGGAAACCGCCGGCGC
GTATCAAGTTCTGGCCGCGCGGACCAATGAGCAGCGAGCTGCTGAGTGCC
GGCAGGGACAGTTGCCTGCTGGTATTCAATACATTCCAGGAGAGCCAGCA
ATTCAGCATGGGGCGCGCCTATGTGCCTCAACACGGGCCCAGGGAGGACA
GGGTAACCCGGGAGCAATACGTGCTGCCCGCCGCCCTCGACCTGACTGCA
TGCAGTGCCAAGGAGTTCTGCTGGGATACCGTTGCCATGTGCCATGAGGG
CCACCGACCTGTCACCACCTGGTCATTCAGCAAGCGCACTCGTGGACAGC
ATTATCTCGAGCCCGCCATTCTCAAGCAGCGCCATTTCTTATTCTCGCGC
TCCTCTGCTACCCGATGCGCCATCAGCAGTTGCGGCAATTTCATCCTCAT
CGGATACTCGAGCGGACATCTCGCTAAGTTCAACATCCAATCAGGCATCG
AGCGCGGTTTATACGTGGCCAATGGATCCGGCGATTCGTATTCTCGCGCT
CATGAAGCAGCGATATCGGGACTCGCGGTTGGCCAGACCGCCACGAGCAC
CGTTGTGATCAGTGCAGCCGGCCGCCAATTGGCCTGCTGGGATTTCGTGA
GTCGAGACAACATCGGGCTGCTGATTCTCGATGCCGACATTACTAGCCTG
ACTCTCCATCCGTCCGGGGACATGGTAGCCGTTGCCACTGGCGACGGACT
TGTCAATCTCCTCCAGCTCACCAGATTCATCGTATTTCATAAAATCCGCG
CCTCCCTGAGCCCCAATGCCGTCGCTGCTGTCGCTTTCAGCCATGAATTC
GATCTCGTAATGATTGCTGACGGCAACCTCGTTAAGACATTCGATTACAT
CAACAATCGATTGGTGGATTGCTTCAAGACCCGCCGGCCAATCACGCAGC
TGGAAATGGCACCGAATGACGCGTTCCTCGTCTCGACTCACCAGGACGAC
CTCGGGATTTATCTCTGGTCCTTAAAGCTGCATTTCCTTGACATGAAGCT
GTCAGGCTTGCCGCTCGACTTTCAACCAACGAAAACATTGGATGCTCCAA
AGGTTTACTGTGCTGATGATGATGCGGCCGATGAGAACGATGAGGGAGCC
GAGGCGCCACAGGAACTGATGGAAATTGAACCGGCCAATCAGAACGGAGG
CCACGTGTCGCTACTGGCCCAAATGTCCGGCCTGCCGCCATCATATTTCT
CCAACTTGCTCAACATCGACAGCATCAGGATTCGCAACGAGAACGCTACC
AAAGGAATGGCGTCGACCGAGTTCTTCCTGCCGCAAGTCTCAGAGGGATT
GGATGGCCTGCGCTGGTTGGATGAGGAGGATTCAGCGGACCAATCAGCGG
CGGGAACGGCTGCCGTTGGCCAATTGGATGCCCAGCAGCAATTCCTGCGC
ATGAAGACAACCGACACCAATAGGAAGCGAGCGGAACTAGCGAGCAGTCA
AATGATTGGCTCAGACAATTTGTGCAGTCTGCTGCTGCGCGCCGCATCAG
ATGAGGAATATGACAAATGGATCCAGCTGCTCAAGAGTTTCTCGCCAAGC
GCCATCGACTATGAGATCCAGATGCTCGATCCGATCTACCACGAGACTCG
CTACCAGCCATTGCAGGCGTTCCTGAGGCTGCTGGACAACCAGATGAGAC
GCCTCAATAATGTGGAGGTTTGCCAGATGTACTTGGCCTGCCTTCTCAAT
CACAATATCGATTGCCTTATTGAGGATCCCACCGCAGCCATGTCAAATCC
GGAAACGTCCCAAATGCTCAGTGGTGATGGTGACGTCCTTCTCACATCCG
ATAAGCCCGATGATAAAGACAGGCTGGAAACATTGTCAATGGTCATCGCA
GTTGTCGACACGATGCGCCGTTCCAGCACTCAATTGTCAAAGGATCTCAA
CTCAATTATTGAGATGGCCCAGTTCGCATACAATAATTTGTAGCAATAGA
TTTATTTTCGTTCCATCGTTTTTATTTGTTTAATT
back to top

protein sequence of SMED30025781-orf-1

>SMED30025781-orf-1 ID=SMED30025781-orf-1|Name=SMED30025781-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=972bp
MSFLYHPLKAIGLYSTNVPLLIKSVGDDDFYLFSAVGCYFVVYRFSNLAL
VSTSDKLDEDILSIDGYKNKLFTGCETNVYGYSRAKHVSKVYKYENEKNW
RIIVVLGEEGYLCGINECNRLVIWDIEGGEVFCQFLFPSKSEEFIIKTIM
QPRNYKFKILVASTKGKMHLINYAKNKLLYVFNIGQEIMSMKQSPMDNVI
AIGCGGDGRVLMLDLVHDIVLMELHQDLGPITAIEFRNDIEEHLIMLTAT
SNGHVAMWDLDTKRNIGQSRHCHEGSVASLWCVPGKPLLVSNSADNSIKV
WNYERPDGTPLLLRSRNGHWKPPARIKFWPRGPMSSELLSAGRDSCLLVF
NTFQESQQFSMGRAYVPQHGPREDRVTREQYVLPAALDLTACSAKEFCWD
TVAMCHEGHRPVTTWSFSKRTRGQHYLEPAILKQRHFLFSRSSATRCAIS
SCGNFILIGYSSGHLAKFNIQSGIERGLYVANGSGDSYSRAHEAAISGLA
VGQTATSTVVISAAGRQLACWDFVSRDNIGLLILDADITSLTLHPSGDMV
AVATGDGLVNLLQLTRFIVFHKIRASLSPNAVAAVAFSHEFDLVMIADGN
LVKTFDYINNRLVDCFKTRRPITQLEMAPNDAFLVSTHQDDLGIYLWSLK
LHFLDMKLSGLPLDFQPTKTLDAPKVYCADDDAADENDEGAEAPQELMEI
EPANQNGGHVSLLAQMSGLPPSYFSNLLNIDSIRIRNENATKGMASTEFF
LPQVSEGLDGLRWLDEEDSADQSAAGTAAVGQLDAQQQFLRMKTTDTNRK
RAELASSQMIGSDNLCSLLLRAASDEEYDKWIQLLKSFSPSAIDYEIQML
DPIYHETRYQPLQAFLRLLDNQMRRLNNVEVCQMYLACLLNHNIDCLIED
PTAAMSNPETSQMLSGDGDVLLTSDKPDDKDRLETLSMVIAVVDTMRRSS
TQLSKDLNSIIEMAQFAYNNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000142posterior region of the whole animal
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR007319SSU_processome_Utp21
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR011047Quinoprotein_ADH-like_supfam
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0032040small-subunit processome
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 333..373
e-value: 68.0
score: 5.4
coord: 114..153
e-value: 0.045
score: 22.9
coord: 68..110
e-value: 25.0
score: 8.2
coord: 460..499
e-value: 6.9
score: 11.7
coord: 26..65
e-value: 19.0
score: 8.9
coord: 160..202
e-value: 40.0
score: 6.9
coord: 376..414
e-value: 9.5
score: 10.8
coord: 282..320
e-value: 190.0
score: 2.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 121..155
score: 10.141
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 167..527
e-value: 2.3E-63
score: 216.1
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 1..166
e-value: 9.7E-33
score: 115.6
IPR007319Small-subunit processome, Utp21PFAMPF04192Utp21coord: 564..754
e-value: 3.8E-23
score: 82.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 758..777
NoneNo IPR availablePANTHERPTHR22840FAMILY NOT NAMEDcoord: 1..818
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 97..111
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 75..162
score: 13.976
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 35..500